F437690

General Info

Members Datasets Scaffolds Average Seq Length
411 300 822 101

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904419702|2904422798
Length 99
Sequence HLKYVIDPYQLEAFEDYGKRWIKIVNRLGGHHHGYFMPSEGANNIAYALFSFPSLTAYENYRKQMFSKDDKECVEAFKLAEDTRCIISYERTFLSPVFE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
86 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
146 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
163 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
218 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
222 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
237 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
238 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
239 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
240 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
241 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
242 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
243 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
244 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
245 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
246 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
247 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
248 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
249 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
250 2643221618 Ensifer sp. Root231 Isolate Unclassified
251 2643221626 Ensifer sp. Root31 Isolate Unclassified
252 2643221638 Duganella sp. Root336D2 Isolate Unclassified
253 2643221655 Ensifer sp. Root1252 Isolate Unclassified
254 2643221659 Ensifer sp. Root127 Isolate Unclassified
255 2643221683 Variovorax sp. Root473 Isolate Unclassified
256 2643221698 Ensifer sp. Root142 Isolate Unclassified
257 2643221712 Ensifer sp. Root258 Isolate Unclassified
258 2643221723 Ensifer sp. Root278 Isolate Unclassified
259 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
260 2738543013 Variovorax sp. BT01 Isolate Unclassified
261 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
262 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
263 2818991452 Burkholderia cepacia 561 Isolate Unclassified
264 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
265 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
266 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
267 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
268 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
269 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
270 2844163670 Ensifer sp. 1H6 Isolate Unclassified
271 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
272 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
273 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
274 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
275 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
276 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
277 2904424332 Duganella sp. 1411 Isolate Rhizosphere
278 2909042592 Labrys sp. LIt4 Isolate Nodule
279 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
280 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
281 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
282 2928070936 Variovorax gossypii 1167 Isolate Unclassified
283 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
284 2928163908 Burkholderia sp. 567 Isolate Unclassified
285 2928170801 Burkholderia sp. 572 Isolate Unclassified
286 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
287 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
288 2941479691
289 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
290 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
291 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
292 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
293 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
294 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
295 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
296 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
297 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
298 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
299 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
300 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.18
Metatranscriptomes 0
Isolates 15.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.38
Nodule 3.65
Rhizoplane 3.16
Rhizosphere 49.88
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10042844 3300001979 Bacteria 1353
2 JGI24740J21852_10069469 3300001979 Bacteria 947
3 JGI24739J22299_10125816 3300001989 Bacteria 764
4 JGI24751J29686_10113517 3300002459 Unclassified 568
5 JGI25155J39150_1000054 3300002704 Bacteria 74407
6 JGI25156J39149_1000238 3300002705 Bacteria 37951
7 JGI25162J39368_1000026 3300002737 Bacteria 227710
8 JGI25162J39368_1000244 3300002737 Bacteria 54424
9 JGI25154J39366_1000104 3300002738 Bacteria 74407
10 JGI25157J39369_1000270 3300002741 Bacteria 37955
11 JGI25164J39214_1003077 3300002772 Bacteria 2227
12 JGI25159J45721_1000015 3300002987 Bacteria 142431
13 JGI25151J46595_10030552 3300003187 Bacteria 2117
14 JGI25165J46597_1000031 3300003214 Bacteria 296858
15 JGI25165J46597_1000553 3300003214 Bacteria 34037
16 JGI25165J46597_1000796 3300003214 Bacteria 23932
17 rootL2_10013126 3300003322 Bacteria 1798
18 rootH1_10123448 3300003323 Bacteria 1018
19 JGI25160J50197_1000003 3300003354 Bacteria 482719
20 JGI25161J50226_1000219 3300003374 Bacteria 35426
21 Ga0055538_1000018 3300003751 Bacteria 296858
22 Ga0055539_1000023 3300003752 Bacteria 296858
23 Ga0055533_1000031 3300003756 Bacteria 296858
24 Ga0055532_1000631 3300003758 Bacteria 13727
25 Ga0055532_1000856 3300003758 Bacteria 10307
26 Ga0055525_1000039 3300003759 Bacteria 296858
27 Ga0055527_1000288 3300003760 Bacteria 29471
28 Ga0055535_1000604 3300003761 Bacteria 29593
29 Ga0055542_1000633 3300003762 Bacteria 29593
30 Ga0055529_1000568 3300003763 Bacteria 30261
31 Ga0055526_1002811 3300003771 Bacteria 11529
32 Ga0055524_1017379 3300003775 Bacteria 2540
33 Ga0055536_1001135 3300003781 Bacteria 16683
34 Ga0055536_1004549 3300003781 Bacteria 7048
35 Ga0055528_1002882 3300003790 Bacteria 8946
36 Ga0055528_1050514 3300003790 Bacteria 845
37 Ga0055530_10017692 3300003791 Bacteria 2223
38 Ga0055540_1003629 3300003792 Bacteria 7362
39 Ga0055531_10045691 3300003794 Bacteria 1213
40 Ga0055541_1000016 3300003841 Bacteria 296861
41 Ga0055541_1010685 3300003841 Bacteria 1371
42 Ga0058692_1003605 3300003856 Bacteria 4752
43 Ga0058692_1037160 3300003856 Bacteria 877
44 Ga0055543_1001874 3300004625 Bacteria 7649
45 Ga0065165_1000025 3300005262 Bacteria 246909
46 Ga0065707_10140535 3300005295 Bacteria 1779
47 Ga0070658_10056291 3300005327 Bacteria 3195
48 Ga0070670_100000002 3300005331 Bacteria 568775
49 Ga0070666_10005140 3300005335 Bacteria 8010
50 Ga0070669_100038582 3300005353 Bacteria 3468
51 Ga0070671_100000024 3300005355 Bacteria 122109
52 Ga0070688_100000799 3300005365 Bacteria 15526
53 Ga0070667_100000018 3300005367 Bacteria 226033
54 Ga0070667_100022429 3300005367 Bacteria 5236
55 Ga0070705_100594147 3300005440 Bacteria 855
56 Ga0070708_100559750 3300005445 Bacteria 1078
57 Ga0070685_10000001 3300005466 Bacteria 349867
58 Ga0070706_101657307 3300005467 Unclassified 583
59 Ga0070684_101677047 3300005535 Bacteria 600
60 Ga0070665_100007404 3300005548 Bacteria 11167
61 Ga0070665_100130990 3300005548 Bacteria 2510
62 Ga0068854_100016147 3300005578 Bacteria 4969
63 Ga0068852_100133718 3300005616 Bacteria 2287
64 Ga0068859_100105766 3300005617 Bacteria 2873
65 Ga0068864_100000003 3300005618 Bacteria 568775
66 Ga0068851_10053185 3300005834 Bacteria 2061
67 Ga0068858_100009903 3300005842 Bacteria 9054
68 Ga0068860_100000478 3300005843 Bacteria 49822
69 Ga0068862_100004046 3300005844 Bacteria 12427
70 Ga0075432_10023764 3300006058 Bacteria 2100
71 Ga0075367_10126890 3300006178 Bacteria 1575
72 Ga0075369_10107768 3300006186 Bacteria 1254
73 Ga0097620_100105760 3300006931 Bacteria 2873
74 Ga0105244_10001782 3300009036 Bacteria 16896
75 Ga0105244_10078245 3300009036 Bacteria 1640
76 Ga0105244_10287854 3300009036 Bacteria 762
77 Ga0105240_10000024 3300009093 Bacteria 375919
78 Ga0105247_11329428 3300009101 Bacteria 578
79 Ga0105243_10004361 3300009148 Bacteria 11207
80 Ga0105243_11532344 3300009148 Bacteria 691
81 Ga0105248_10060326 3300009177 Bacteria 4258
82 Ga0105248_10175417 3300009177 Bacteria 2416
83 Ga0105248_11562843 3300009177 Unclassified 747
84 Ga0105248_11604598 3300009177 Bacteria 737
85 Ga0105237_10000538 3300009545 Bacteria 53474
86 Ga0105249_10217722 3300009553 Unclassified 1877
87 Ga0105239_10001386 3300010375 Bacteria 32493
88 Ga0105239_12101208 3300010375 Bacteria 656
89 Ga0157373_10585713 3300013100 Bacteria 811
90 Ga0157371_10210149 3300013102 Bacteria 1396
91 Ga0157371_10761116 3300013102 Bacteria 728
92 Ga0157370_10000180 3300013104 Bacteria 79428
93 Ga0157370_10369649 3300013104 Bacteria 1321
94 Ga0157369_10578362 3300013105 Bacteria 1160
95 Ga0157369_11747898 3300013105 Bacteria 632
96 Ga0171463_1001 3300013249 Bacteria 1406070
97 Ga0163162_10290498 3300013306 Bacteria 1767
98 Ga0157375_10487482 3300013308 Bacteria 1397
99 Ga0163163_10042733 3300014325 Bacteria 4440
100 Ga0182008_10004043 3300014497 Bacteria 8657
101 Ga0182008_10032439 3300014497 Bacteria 2624
102 Ga0182008_10149246 3300014497 Bacteria 1172
103 Ga0182006_1000002 3300015261 Bacteria 887990
104 Ga0182007_10000045 3300015262 Bacteria 106028
105 Ga0182007_10046895 3300015262 Bacteria 1430
106 Ga0182005_1000002 3300015265 Bacteria 908499
107 Ga0182005_1006902 3300015265 Bacteria 3437
108 Ga0183363_1108 3300015690 Bacteria 23177
109 Ga0163161_10062393 3300017792 Bacteria 2715
110 Ga0163161_10123286 3300017792 Bacteria 1949
111 Ga0163161_10138399 3300017792 Bacteria 1842
112 Ga0214542_1000029 3300021321 Bacteria 174097
113 Ga0214543_1000040 3300021327 Bacteria 174142
114 Ga0213872_10018451 3300021361 Bacteria 3218
115 Ga0209435_100065 3300025206 Bacteria 74485
116 Ga0209436_101968 3300025208 Bacteria 6574
117 Ga0209784_100027 3300025224 Bacteria 363933
118 Ga0209566_100027 3300025225 Bacteria 363933
119 Ga0209566_101905 3300025225 Bacteria 4617
120 Ga0209674_100044 3300025226 Bacteria 363933
121 Ga0209674_102079 3300025226 Bacteria 4560
122 Ga0209672_100066 3300025228 Bacteria 189828
123 Ga0209147_100084 3300025229 Bacteria 189828
124 Ga0209147_100256 3300025229 Bacteria 49622
125 Ga0209563_100048 3300025230 Bacteria 363933
126 Ga0207427_101900 3300025231 Bacteria 6525
127 Ga0209437_100050 3300025233 Bacteria 394010
128 Ga0209437_100055 3300025233 Bacteria 363933
129 Ga0209437_100056 3300025233 Bacteria 363071
130 Ga0209437_115506 3300025233 Bacteria 1039
131 Ga0209258_100117 3300025242 Bacteria 189828
132 Ga0209646_1000036 3300025246 Bacteria 358864
133 Ga0209646_1000195 3300025246 Bacteria 74485
134 Ga0209646_1016189 3300025246 Bacteria 1108
135 Ga0209026_1000235 3300025250 Bacteria 74485
136 Ga0209026_1035525 3300025250 Bacteria 731
137 Ga0209677_100028 3300025253 Bacteria 363933
138 Ga0209677_100283 3300025253 Bacteria 33726
139 Ga0209148_1000644 3300025254 Bacteria 30313
140 Ga0209148_1017589 3300025254 Bacteria 1211
141 Ga0209759_1000268 3300025256 Bacteria 74485
142 Ga0209759_1037498 3300025256 Bacteria 870
143 Ga0209233_1000037 3300025261 Bacteria 554620
144 Ga0209233_1000070 3300025261 Bacteria 363933
145 Ga0209233_1000071 3300025261 Bacteria 363290
146 Ga0209233_1000236 3300025261 Bacteria 92446
147 Ga0209565_1004857 3300025263 Bacteria 4014
148 Ga0209455_1000110 3300025272 Bacteria 189828
149 Ga0209455_1014461 3300025272 Bacteria 1785
150 Ga0209673_1000057 3300025273 Bacteria 270150
151 Ga0209130_1000005 3300025284 Bacteria 599620
152 Ga0209675_1033012 3300025291 Bacteria 1205
153 Ga0209676_1001480 3300025292 Bacteria 21721
154 Ga0209676_1001977 3300025292 Bacteria 16327
155 Ga0209676_1016834 3300025292 Bacteria 2618
156 Ga0209025_1000105 3300025294 Bacteria 224157
157 Ga0209564_1000113 3300025295 Bacteria 211564
158 Ga0209564_1004813 3300025295 Bacteria 8038
159 Ga0209050_1000773 3300025298 Bacteria 45942
160 Ga0209050_1090755 3300025298 Bacteria 626
161 Ga0209256_1006943 3300025299 Bacteria 5780
162 Ga0207426_1000015 3300025302 Bacteria 599316
163 Ga0209051_1001504 3300025303 Bacteria 19477
164 Ga0209051_1028966 3300025303 Bacteria 2176
165 Ga0209257_1006923 3300025304 Bacteria 7087
166 Ga0207656_10026297 3300025321 Bacteria 2372
167 Ga0207655_1004311 3300025728 Bacteria 10163
168 Ga0207655_1068655 3300025728 Bacteria 1328
169 Ga0207710_10011301 3300025900 Bacteria 3759
170 Ga0207680_10024891 3300025903 Unclassified 3293
171 Ga0207647_10001649 3300025904 Bacteria 17170
172 Ga0207705_10029995 3300025909 Bacteria 3880
173 Ga0207695_10000036 3300025913 Bacteria 477897
174 Ga0207671_10000191 3300025914 Bacteria 95004
175 Ga0207681_10030613 3300025923 Bacteria 3509
176 Ga0207650_10000003 3300025925 Bacteria 1123235
177 Ga0207644_10000013 3300025931 Bacteria 185370
178 Ga0207709_10001032 3300025935 Bacteria 20578
179 Ga0207709_11101455 3300025935 Bacteria 652
180 Ga0207711_10002046 3300025941 Bacteria 18240
181 Ga0207661_10652964 3300025944 Bacteria 967
182 Ga0207667_10246416 3300025949 Bacteria 1828
183 Ga0207640_10059422 3300025981 Bacteria 2523
184 Ga0207658_10000004 3300025986 Bacteria 569357
185 Ga0207658_10035113 3300025986 Bacteria 3589
186 Ga0207703_10346609 3300026035 Bacteria 1366
187 Ga0207641_10021753 3300026088 Bacteria 5271
188 Ga0207676_10000003 3300026095 Bacteria 1123235
189 Ga0207698_10141318 3300026142 Bacteria 2075
190 Ga0209371_1000255 3300027312 Bacteria 64538
191 Ga0209371_1003365 3300027312 Bacteria 7854
192 Ga0268266_10003788 3300028379 Bacteria 14805
193 Ga0268266_10103617 3300028379 Bacteria 2511
194 Ga0268265_10000515 3300028380 Bacteria 39605
195 Ga0268264_10000009 3300028381 Bacteria 724972
196 Ga0307515_10006976 3300028794 Bacteria 22436
197 Ga0307515_10020644 3300028794 Bacteria 11734
198 Ga0268256_1000210 3300030500 Bacteria 65841
199 Ga0268256_1005480 3300030500 Bacteria 4966
200 Ga0314311_1117052 3300030733 Bacteria 1777
201 Ga0316181_1101065 3300030744 Bacteria 1932
202 Ga0307516_10000058 3300031730 Bacteria 121424
203 Ga0307405_10002949 3300031731 Bacteria 7680
204 Ga0307413_10001112 3300031824 Bacteria 9834
205 Ga0307412_10000613 3300031911 Bacteria 21003
206 Ga0307412_10081251 3300031911 Bacteria 2241
207 Ga0307416_100509469 3300032002 Bacteria 1269
208 Ga0307414_10004754 3300032004 Bacteria 7412
209 Ga0307415_101385845 3300032126 Bacteria 669
210 Ga0373937_0215254 3300036401 Bacteria 1808
211 Ga0395899_0000792 3300037312 Bacteria 30931
212 Ga0395900_0052626 3300037418 Bacteria 4191
213 Ga0395898_0126951 3300037466 Bacteria 2444
214 Ga0395901_1255139 3300038443 Bacteria 704
215 Ga0400489_89984 3300039093 Bacteria 1114
216 Ga0436361_0164465 3300039447 Bacteria 858
217 Ga0436361_1212993 3300039447 Bacteria 28758
218 Ga0439436_0000790 3300041404 Bacteria 8556
219 Ga0439436_0013000 3300041404 Bacteria 2521
220 Ga0439436_0037555 3300041404 Bacteria 1395
221 Ga0439438_060122 3300041405 Bacteria 952
222 Ga0439438_174621 3300041405 Bacteria 511
223 Ga0439439_0025242 3300041406 Bacteria 1495
224 Ga0439439_0125711 3300041406 Bacteria 717
225 Ga0439461_0011309 3300041410 Bacteria 1654
226 Ga0439466_0014083 3300041411 Bacteria 2917
227 Ga0439466_0082833 3300041411 Bacteria 1011
228 Ga0439465_0000667 3300041413 Bacteria 10503
229 Ga0439465_0014543 3300041413 Bacteria 2453
230 Ga0439465_0205893 3300041413 Bacteria 718
231 Ga0451833_0161875 3300041491 Bacteria 526
232 Ga0451843_0914714 3300041509 Bacteria 575
233 Ga0439431_0000492 3300041997 Bacteria 8361
234 Ga0439431_0145958 3300041997 Bacteria 670
235 Ga0439433_0000544 3300041999 Bacteria 7112
236 Ga0439442_002780 3300042002 Bacteria 3437
237 Ga0439445_0009225 3300042004 Bacteria 2321
238 Ga0439445_0010873 3300042004 Bacteria 2162
239 Ga0439432_000899 3300042006 Bacteria 11161
240 Ga0439449_0000666 3300042007 Bacteria 13010
241 Ga0439449_0000801 3300042007 Bacteria 12129
242 Ga0439449_0095220 3300042007 Bacteria 1100
243 Ga0439452_004610 3300042010 Bacteria 4580
244 Ga0439457_006863 3300042014 Bacteria 2756
245 Ga0439457_017337 3300042014 Bacteria 1600
246 Ga0439457_093456 3300042014 Bacteria 697
247 Ga0439462_0010096 3300042015 Bacteria 2390
248 Ga0439462_0013800 3300042015 Bacteria 2073
249 Ga0439462_0207315 3300042015 Bacteria 559
250 Ga0450920_009882 3300042122 Bacteria 1762
251 Ga0439446_0000516 3300042156 Bacteria 7747
252 Ga0450909_005272 3300042185 Bacteria 1860
253 Ga0450909_070165 3300042185 Bacteria 560
254 Ga0439434_0004219 3300042435 Bacteria 4198
255 Ga0439434_0114410 3300042435 Bacteria 876
256 Ga0439434_0193561 3300042435 Bacteria 684
257 Ga0450918_006437 3300042531 Bacteria 2096
258 Ga0453684_0053107 3300044712 Bacteria 5292
259 Ga0451576_0089602 3300045051 Bacteria 3199
260 Ga0495638_0045736 3300046460 Bacteria 2752
261 Ga0495610_0009023 3300046512 Bacteria 6363
262 Ga0495610_0018274 3300046512 Bacteria 3965
263 Ga0495637_0295641 3300046520 Bacteria 575
264 Ga0495648_0011195 3300046524 Bacteria 6774
265 Ga0495663_0004110 3300046525 Bacteria 4120
266 Ga0495654_0007848 3300046530 Bacteria 5935
267 Ga0495654_0036904 3300046530 Bacteria 2454
268 Ga0495665_0480071 3300046531 Bacteria 627
269 Ga0495622_0036676 3300046557 Bacteria 2285
270 Ga0495633_0001564 3300046558 Bacteria 17548
271 Ga0495646_0596064 3300046680 Bacteria 561
272 Ga0495674_0025084 3300047319 Bacteria 5472
273 Ga0495674_0839685 3300047319 Bacteria 712
274 Ga0495676_0198819 3300047321 Bacteria 1394
275 Ga0495684_0652632 3300047471 Bacteria 703
276 Ga0496100_0011688 3300048903 Bacteria 5004
277 Ga0496102_0026573 3300048905 Bacteria 5165
278 Ga0496103_0003406 3300048906 Bacteria 9722
279 Ga0496103_0013502 3300048906 Bacteria 4846
280 Ga0496105_0590274 3300048908 Bacteria 863
281 Ga0496106_0267055 3300048909 Bacteria 1370
282 Ga0496106_1045470 3300048909 Bacteria 641
283 Ga0496111_0425921 3300048914 Bacteria 980
284 Ga0496114_0066597 3300048917 Bacteria 3020
285 Ga0496116_0032575 3300048919 Bacteria 3712
286 Ga0496116_0072032 3300048919 Bacteria 2186
287 Ga0496116_0074414 3300048919 Bacteria 2136
288 Ga0496116_0175550 3300048919 Bacteria 1154
289 Ga0496117_0000001 3300048920 Bacteria 2526244
290 Ga0496117_0023872 3300048920 Bacteria 4854
291 Ga0496117_0260932 3300048920 Bacteria 939
292 Ga0496118_0000078 3300048921 Bacteria 190946
293 Ga0496118_0004994 3300048921 Bacteria 15330
294 Ga0496118_0014680 3300048921 Bacteria 7319
295 Ga0496118_0181917 3300048921 Bacteria 1269
296 Ga0496119_0004513 3300048922 Bacteria 13813
297 Ga0496119_0021049 3300048922 Bacteria 4729
298 Ga0496119_0023833 3300048922 Bacteria 4326
299 Ga0496120_0011390 3300048923 Bacteria 6117
300 Ga0496120_0013653 3300048923 Bacteria 5457
301 Ga0496121_0000211 3300048924 Bacteria 127602
302 Ga0496121_0004875 3300048924 Bacteria 17620
303 Ga0496121_0015096 3300048924 Bacteria 8125
304 Ga0496121_0031754 3300048924 Bacteria 4817
305 Ga0496122_0002104 3300048925 Bacteria 29499
306 Ga0496122_0022090 3300048925 Bacteria 5668
307 Ga0496122_0061818 3300048925 Bacteria 2746
308 Ga0496123_0020376 3300048926 Bacteria 5188
309 Ga0496123_0027190 3300048926 Bacteria 4266
310 Ga0496123_0027489 3300048926 Bacteria 4236
311 Ga0496123_0032054 3300048926 Bacteria 3813
312 Ga0496124_0023609 3300048927 Bacteria 5611
313 Ga0496124_0025085 3300048927 Bacteria 5405
314 Ga0496124_0061685 3300048927 Bacteria 3141
315 Ga0496124_0062827 3300048927 Bacteria 3106
316 Ga0496125_0000005 3300048928 Bacteria 827598
317 Ga0496125_0010500 3300048928 Bacteria 9365
318 Ga0496125_0033078 3300048928 Bacteria 4582
319 Ga0496125_0060882 3300048928 Bacteria 3031
320 Ga0496125_0235081 3300048928 Bacteria 1168
321 Ga0496125_0254821 3300048928 Bacteria 1104
322 Ga0496126_0025209 3300048929 Bacteria 5726
323 Ga0496126_0027482 3300048929 Bacteria 5432
324 Ga0496126_0295946 3300048929 Bacteria 1337
325 Ga0495682_0003307 3300049460 Bacteria 7206
326 Ga0501292_097654 3300049515 Bacteria 578
327 Ga0501208_077206 3300049655 Bacteria 679
328 Ga0501249_024399 3300049679 Bacteria 1332
329 Ga0501225_0001671 3300049705 Bacteria 6935
330 Ga0501263_021163 3300049760 Bacteria 876
331 Ga0501269_000022 3300049766 Bacteria 53264
332 nmdc:mga03n38_82298_c1 3300050490 Bacteria 1515
333 nmdc:mga00v17_713439_c1 3300050491 Bacteria 642
334 nmdc:mga00v17_720287_c1 3300050491 Bacteria 639
335 nmdc:mga07m45_276543_c1 3300050496 Bacteria 977
336 nmdc:mga0n895_928790_c1 3300050512 Unclassified 854
337 nmdc:mga0sz30_578475_c1 3300050516 Bacteria 508
338 Ga0500610_0075758 3300053079 Bacteria 1754
339 Ga0500643_226360 3300053087 Bacteria 502
340 Ga0500646_0062409 3300053090 Unclassified 1100
341 Ga0500646_0117470 3300053090 Bacteria 852
342 Ga0500593_000174 3300053117 Bacteria 25873
343 Ga0500618_010499 3300053125 Bacteria 2484
344 Ga0500658_0099935 3300053134 Bacteria 1265
345 Ga0500622_0000101 3300053156 Bacteria 86856
346 Ga0500636_0155924 3300053177 Bacteria 1250
347 2904422798 2904419702 Bacteria 5166287
348 2512636137 2512564013 Bacteria 6286191
349 2513996323 2513237159 Bacteria 6810126
350 2585164493 2582581283 Bacteria 6030556
351 2585279930 2582581308 Bacteria 7413247
352 2585326295 2582581315 Bacteria 7318924
353 2585330462 2582581316 Bacteria 7774528
354 2585533816 2585427527 Bacteria 7273426
355 2585553409 2585427530 Bacteria 7383882
356 2599741433 2599185239 Bacteria 8686614
357 2600194937 2599185352 Bacteria 7228948
358 2601667406 2600255292 Bacteria 6300551
359 2616309432 2615840626 Bacteria 7921970
360 2616556235 2615840698 Bacteria 7319877
361 2644103663 2643221618 Bacteria 7717186
362 2644144542 2643221626 Bacteria 8069654
363 2644213587 2643221638 Bacteria 6579467
364 2644306593 2643221655 Bacteria 7722067
365 2644330783 2643221659 Bacteria 7890716
366 2644468668 2643221683 Bacteria 5749203
367 2644542411 2643221698 Bacteria 7756764
368 2644612204 2643221712 Bacteria 7729434
369 2644671595 2643221723 Bacteria 7095460
370 2671113980 2667528174 Bacteria 6435400
371 2739248908 2738543013 Bacteria 5618633
372 2753459841 2751185821 Bacteria 6189929
373 2778173854 2775507266 Bacteria 7392367
374 2819635102 2818991452 Bacteria 8442785
375 2819640829 2818991453 Bacteria 7181617
376 2838029611 2838029111 Bacteria 6603031
377 2842475959 2842475841 Bacteria 6603183
378 2842486042 2842482326 Bacteria 7212537
379 2842503139 2842502639 Bacteria 6604161
380 2842521281 2842521101 Bacteria 6569494
381 2844170061 2844163670 Bacteria 7266046
382 2852388097 2852387548 Bacteria 8025568
383 2857551869 2857547612 Bacteria 6179999
384 2857596731 2857591370 Bacteria 6569758
385 2857618662 2857618242 Bacteria 5635925
386 2863427158 2863421361 Bacteria 7300805
387 2885080700 2885080285 Bacteria 6355622
388 2904427722 2904424332 Bacteria 7633521
389 2909046680 2909042592 Bacteria 6499737
390 2915599963 2915597211 Bacteria 6475886
391 2919408479 2919408235 Bacteria 6149349
392 2920822948 2920822456 Bacteria 6897201
393 2928071059 2928070936 Bacteria 8062541
394 2928158290 2928157003 Bacteria 7522202
395 2928167495 2928163908 Bacteria 7561269
396 2928178350 2928170801 Bacteria 8785406
397 2932411025 2932410948 Bacteria 6312192
398 2932419408 2932416698 Bacteria 6315112
399 2941483315
400 2941501087 2941499720 Bacteria 7599444
401 2989352871 2989349275 Bacteria 6349068
402 3005423135 3005416602 Bacteria 7064308
403 642414575 641736154 Bacteria 7689995
404 8005315462 8005314921 Bacteria 7072929
405 8005484631 8005484373 Bacteria 6297373
406 8018850083 8018845410 Bacteria 8933938
407 8020943378 8020938398 Bacteria 7472757
408 8020954569 8020953355 Bacteria 7439080
409 8021123774 8021120328 Bacteria 8782274
410 8055880997 8055878733 Bacteria 5907058
411 8057580354 8057575449 Bacteria 7367519
412 JGI24740J21852_10042844
413 JGI24740J21852_10069469
414 JGI24739J22299_10125816
415 JGI24751J29686_10113517
416 JGI25155J39150_1000054
417 JGI25156J39149_1000238
418 JGI25162J39368_1000026
419 JGI25162J39368_1000244
420 JGI25154J39366_1000104
421 JGI25157J39369_1000270
422 JGI25164J39214_1003077
423 JGI25159J45721_1000015
424 JGI25151J46595_10030552
425 JGI25165J46597_1000031
426 JGI25165J46597_1000553
427 JGI25165J46597_1000796
428 rootL2_10013126
429 rootH1_10123448
430 JGI25160J50197_1000003
431 JGI25161J50226_1000219
432 Ga0055538_1000018
433 Ga0055539_1000023
434 Ga0055533_1000031
435 Ga0055532_1000631
436 Ga0055532_1000856
437 Ga0055525_1000039
438 Ga0055527_1000288
439 Ga0055535_1000604
440 Ga0055542_1000633
441 Ga0055529_1000568
442 Ga0055526_1002811
443 Ga0055524_1017379
444 Ga0055536_1001135
445 Ga0055536_1004549
446 Ga0055528_1002882
447 Ga0055528_1050514
448 Ga0055530_10017692
449 Ga0055540_1003629
450 Ga0055531_10045691
451 Ga0055541_1000016
452 Ga0055541_1010685
453 Ga0058692_1003605
454 Ga0058692_1037160
455 Ga0055543_1001874
456 Ga0065165_1000025
457 Ga0065707_10140535
458 Ga0070658_10056291
459 Ga0070670_100000002
460 Ga0070666_10005140
461 Ga0070669_100038582
462 Ga0070671_100000024
463 Ga0070688_100000799
464 Ga0070667_100000018
465 Ga0070667_100022429
466 Ga0070705_100594147
467 Ga0070708_100559750
468 Ga0070685_10000001
469 Ga0070706_101657307
470 Ga0070684_101677047
471 Ga0070665_100007404
472 Ga0070665_100130990
473 Ga0068854_100016147
474 Ga0068852_100133718
475 Ga0068859_100105766
476 Ga0068864_100000003
477 Ga0068851_10053185
478 Ga0068858_100009903
479 Ga0068860_100000478
480 Ga0068862_100004046
481 Ga0075432_10023764
482 Ga0075367_10126890
483 Ga0075369_10107768
484 Ga0097620_100105760
485 Ga0105244_10001782
486 Ga0105244_10078245
487 Ga0105244_10287854
488 Ga0105240_10000024
489 Ga0105247_11329428
490 Ga0105243_10004361
491 Ga0105243_11532344
492 Ga0105248_10060326
493 Ga0105248_10175417
494 Ga0105248_11562843
495 Ga0105248_11604598
496 Ga0105237_10000538
497 Ga0105249_10217722
498 Ga0105239_10001386
499 Ga0105239_12101208
500 Ga0157373_10585713
501 Ga0157371_10210149
502 Ga0157371_10761116
503 Ga0157370_10000180
504 Ga0157370_10369649
505 Ga0157369_10578362
506 Ga0157369_11747898
507 Ga0171463_1001
508 Ga0163162_10290498
509 Ga0157375_10487482
510 Ga0163163_10042733
511 Ga0182008_10004043
512 Ga0182008_10032439
513 Ga0182008_10149246
514 Ga0182006_1000002
515 Ga0182007_10000045
516 Ga0182007_10046895
517 Ga0182005_1000002
518 Ga0182005_1006902
519 Ga0183363_1108
520 Ga0163161_10062393
521 Ga0163161_10123286
522 Ga0163161_10138399
523 Ga0214542_1000029
524 Ga0214543_1000040
525 Ga0213872_10018451
526 Ga0209435_100065
527 Ga0209436_101968
528 Ga0209784_100027
529 Ga0209566_100027
530 Ga0209566_101905
531 Ga0209674_100044
532 Ga0209674_102079
533 Ga0209672_100066
534 Ga0209147_100084
535 Ga0209147_100256
536 Ga0209563_100048
537 Ga0207427_101900
538 Ga0209437_100050
539 Ga0209437_100055
540 Ga0209437_100056
541 Ga0209437_115506
542 Ga0209258_100117
543 Ga0209646_1000036
544 Ga0209646_1000195
545 Ga0209646_1016189
546 Ga0209026_1000235
547 Ga0209026_1035525
548 Ga0209677_100028
549 Ga0209677_100283
550 Ga0209148_1000644
551 Ga0209148_1017589
552 Ga0209759_1000268
553 Ga0209759_1037498
554 Ga0209233_1000037
555 Ga0209233_1000070
556 Ga0209233_1000071
557 Ga0209233_1000236
558 Ga0209565_1004857
559 Ga0209455_1000110
560 Ga0209455_1014461
561 Ga0209673_1000057
562 Ga0209130_1000005
563 Ga0209675_1033012
564 Ga0209676_1001480
565 Ga0209676_1001977
566 Ga0209676_1016834
567 Ga0209025_1000105
568 Ga0209564_1000113
569 Ga0209564_1004813
570 Ga0209050_1000773
571 Ga0209050_1090755
572 Ga0209256_1006943
573 Ga0207426_1000015
574 Ga0209051_1001504
575 Ga0209051_1028966
576 Ga0209257_1006923
577 Ga0207656_10026297
578 Ga0207655_1004311
579 Ga0207655_1068655
580 Ga0207710_10011301
581 Ga0207680_10024891
582 Ga0207647_10001649
583 Ga0207705_10029995
584 Ga0207695_10000036
585 Ga0207671_10000191
586 Ga0207681_10030613
587 Ga0207650_10000003
588 Ga0207644_10000013
589 Ga0207709_10001032
590 Ga0207709_11101455
591 Ga0207711_10002046
592 Ga0207661_10652964
593 Ga0207667_10246416
594 Ga0207640_10059422
595 Ga0207658_10000004
596 Ga0207658_10035113
597 Ga0207703_10346609
598 Ga0207641_10021753
599 Ga0207676_10000003
600 Ga0207698_10141318
601 Ga0209371_1000255
602 Ga0209371_1003365
603 Ga0268266_10003788
604 Ga0268266_10103617
605 Ga0268265_10000515
606 Ga0268264_10000009
607 Ga0307515_10006976
608 Ga0307515_10020644
609 Ga0268256_1000210
610 Ga0268256_1005480
611 Ga0314311_1117052
612 Ga0316181_1101065
613 Ga0307516_10000058
614 Ga0307405_10002949
615 Ga0307413_10001112
616 Ga0307412_10000613
617 Ga0307412_10081251
618 Ga0307416_100509469
619 Ga0307414_10004754
620 Ga0307415_101385845
621 Ga0373937_0215254
622 Ga0395899_0000792
623 Ga0395900_0052626
624 Ga0395898_0126951
625 Ga0395901_1255139
626 Ga0400489_89984
627 Ga0436361_0164465
628 Ga0436361_1212993
629 Ga0439436_0000790
630 Ga0439436_0013000
631 Ga0439436_0037555
632 Ga0439438_060122
633 Ga0439438_174621
634 Ga0439439_0025242
635 Ga0439439_0125711
636 Ga0439461_0011309
637 Ga0439466_0014083
638 Ga0439466_0082833
639 Ga0439465_0000667
640 Ga0439465_0014543
641 Ga0439465_0205893
642 Ga0451833_0161875
643 Ga0451843_0914714
644 Ga0439431_0000492
645 Ga0439431_0145958
646 Ga0439433_0000544
647 Ga0439442_002780
648 Ga0439445_0009225
649 Ga0439445_0010873
650 Ga0439432_000899
651 Ga0439449_0000666
652 Ga0439449_0000801
653 Ga0439449_0095220
654 Ga0439452_004610
655 Ga0439457_006863
656 Ga0439457_017337
657 Ga0439457_093456
658 Ga0439462_0010096
659 Ga0439462_0013800
660 Ga0439462_0207315
661 Ga0450920_009882
662 Ga0439446_0000516
663 Ga0450909_005272
664 Ga0450909_070165
665 Ga0439434_0004219
666 Ga0439434_0114410
667 Ga0439434_0193561
668 Ga0450918_006437
669 Ga0453684_0053107
670 Ga0451576_0089602
671 Ga0495638_0045736
672 Ga0495610_0009023
673 Ga0495610_0018274
674 Ga0495637_0295641
675 Ga0495648_0011195
676 Ga0495663_0004110
677 Ga0495654_0007848
678 Ga0495654_0036904
679 Ga0495665_0480071
680 Ga0495622_0036676
681 Ga0495633_0001564
682 Ga0495646_0596064
683 Ga0495674_0025084
684 Ga0495674_0839685
685 Ga0495676_0198819
686 Ga0495684_0652632
687 Ga0496100_0011688
688 Ga0496102_0026573
689 Ga0496103_0003406
690 Ga0496103_0013502
691 Ga0496105_0590274
692 Ga0496106_0267055
693 Ga0496106_1045470
694 Ga0496111_0425921
695 Ga0496114_0066597
696 Ga0496116_0032575
697 Ga0496116_0072032
698 Ga0496116_0074414
699 Ga0496116_0175550
700 Ga0496117_0000001
701 Ga0496117_0023872
702 Ga0496117_0260932
703 Ga0496118_0000078
704 Ga0496118_0004994
705 Ga0496118_0014680
706 Ga0496118_0181917
707 Ga0496119_0004513
708 Ga0496119_0021049
709 Ga0496119_0023833
710 Ga0496120_0011390
711 Ga0496120_0013653
712 Ga0496121_0000211
713 Ga0496121_0004875
714 Ga0496121_0015096
715 Ga0496121_0031754
716 Ga0496122_0002104
717 Ga0496122_0022090
718 Ga0496122_0061818
719 Ga0496123_0020376
720 Ga0496123_0027190
721 Ga0496123_0027489
722 Ga0496123_0032054
723 Ga0496124_0023609
724 Ga0496124_0025085
725 Ga0496124_0061685
726 Ga0496124_0062827
727 Ga0496125_0000005
728 Ga0496125_0010500
729 Ga0496125_0033078
730 Ga0496125_0060882
731 Ga0496125_0235081
732 Ga0496125_0254821
733 Ga0496126_0025209
734 Ga0496126_0027482
735 Ga0496126_0295946
736 Ga0495682_0003307
737 Ga0501292_097654
738 Ga0501208_077206
739 Ga0501249_024399
740 Ga0501225_0001671
741 Ga0501263_021163
742 Ga0501269_000022
743 nmdc:mga03n38_82298_c1
744 nmdc:mga00v17_713439_c1
745 nmdc:mga00v17_720287_c1
746 nmdc:mga07m45_276543_c1
747 nmdc:mga0n895_928790_c1
748 nmdc:mga0sz30_578475_c1
749 Ga0500610_0075758
750 Ga0500643_226360
751 Ga0500646_0062409
752 Ga0500646_0117470
753 Ga0500593_000174
754 Ga0500618_010499
755 Ga0500658_0099935
756 Ga0500622_0000101
757 Ga0500636_0155924
758 2904422798
759 2512636137
760 2513996323
761 2585164493
762 2585279930
763 2585326295
764 2585330462
765 2585533816
766 2585553409
767 2599741433
768 2600194937
769 2601667406
770 2616309432
771 2616556235
772 2644103663
773 2644144542
774 2644213587
775 2644306593
776 2644330783
777 2644468668
778 2644542411
779 2644612204
780 2644671595
781 2671113980
782 2739248908
783 2753459841
784 2778173854
785 2819635102
786 2819640829
787 2838029611
788 2842475959
789 2842486042
790 2842503139
791 2842521281
792 2844170061
793 2852388097
794 2857551869
795 2857596731
796 2857618662
797 2863427158
798 2885080700
799 2904427722
800 2909046680
801 2915599963
802 2919408479
803 2920822948
804 2928071059
805 2928158290
806 2928167495
807 2928178350
808 2932411025
809 2932419408
810 2941483315
811 2941501087
812 2989352871
813 3005423135
814 642414575
815 8005315462
816 8005484631
817 8018850083
818 8020943378
819 8020954569
820 8021123774
821 8055880997
822 8057580354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07978

NIPSNAP

NIPSNAP

2

98

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ap6-assembly1.cif.gz_A x-ray crystal structure of protein atu4242 from agrobacterium tumefaciens. northeast strucutral genomics consortium target atr43. 0.8443 1 100
1vqs-assembly1.cif.gz_B crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 a resolution 0.844 2 98
2ap6-assembly1.cif.gz_A x-ray crystal structure of protein atu4242 from agrobacterium tumefaciens. northeast strucutral genomics consortium target atr43. 0.8221 1 100
5kak-assembly1.cif.gz_E crystal structure of an uncharacterized nipsnap-like domain protein from burkholderia xenovorans 0.8208 2 100
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.8171 1 100
ID Description Score Start End Superfamily
af_Q9VXK0_45_165_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.864 2 96 3.30.70.100
af_O75323_65_182_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8257 2 101 3.30.70.100
5kakE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8208 2 100 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8171 1 100 3.30.70.100
af_O75323_65_182_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8111 2 101 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1M7Q8K2-F1-model_v4 NIPSNAP protein 0.983 1 90
AF-A0A1M7Q8K2-F1-model_v4 NIPSNAP protein 0.9723 1 90
AF-A0A7Y4NAI5-F1-model_v4 deleted 0.971 1 68
AF-A0A353XGG6-F1-model_v4 deleted 0.9686 1 74
AF-A0A6I5DV86-F1-model_v4 deleted 0.9581 1 99

Map