F437706

General Info

Members Datasets Scaffolds Average Seq Length
412 199 412 51

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10124715|Ga0065704_101247152
Length 57
Sequence MPAKRTTHRSKSGTKLYAKRDAKGRFKDIQTFKRAHGQDIKRRSKAEGARKRAKKAR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 2.43
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3456523 2162886006 Bacteria 1883
2 JGI25405J52794_10137129 3300003911 Unclassified 555
3 Ga0065704_10124715 3300005289 Bacteria 1706
4 Ga0065715_10398038 3300005293 Bacteria 873
5 Ga0065715_10545963 3300005293 Bacteria 741
6 Ga0065707_10090428 3300005295 Bacteria 4140
7 Ga0070676_10081440 3300005328 Bacteria 1964
8 Ga0070666_10000422 3300005335 Bacteria 26218
9 Ga0070680_100419010 3300005336 Viruses 1142
10 Ga0070680_100847056 3300005336 Unclassified 788
11 Ga0070660_101707542 3300005339 Bacteria 536
12 Ga0070692_10196811 3300005345 Unclassified 1178
13 Ga0070668_100075295 3300005347 Bacteria 2635
14 Ga0070668_100088014 3300005347 Bacteria 2444
15 Ga0070669_100091320 3300005353 Bacteria 2283
16 Ga0070675_100940541 3300005354 Unclassified 793
17 Ga0070674_100232909 3300005356 Bacteria 1438
18 Ga0070673_100079370 3300005364 Bacteria 2657
19 Ga0070688_100381359 3300005365 Bacteria 1039
20 Ga0070659_100343899 3300005366 Bacteria 1250
21 Ga0070667_100005287 3300005367 Bacteria 10791
22 Ga0070703_10034026 3300005406 Bacteria 1553
23 Ga0070701_10150290 3300005438 Bacteria 1340
24 Ga0070705_100045018 3300005440 Bacteria 2537
25 Ga0070705_100594198 3300005440 Bacteria 855
26 Ga0070700_100387190 3300005441 Unclassified 1047
27 Ga0070694_100068850 3300005444 Bacteria 2433
28 Ga0070694_100372544 3300005444 Bacteria 1112
29 Ga0070694_100640353 3300005444 Unclassified 859
30 Ga0070694_100880140 3300005444 Unclassified 738
31 Ga0070708_100048488 3300005445 Bacteria 3754
32 Ga0070708_100215989 3300005445 Unclassified 1797
33 Ga0070708_101127097 3300005445 Bacteria 734
34 Ga0070708_101986767 3300005445 Bacteria 539
35 Ga0070663_100017778 3300005455 Bacteria 4649
36 Ga0070678_100127723 3300005456 Bacteria 2015
37 Ga0070662_100028302 3300005457 Bacteria 3898
38 Ga0070662_100860715 3300005457 Unclassified 772
39 Ga0070681_10035032 3300005458 Bacteria 5042
40 Ga0068867_100022645 3300005459 Bacteria 4493
41 Ga0068867_101100754 3300005459 Unclassified 725
42 Ga0070706_100078524 3300005467 Bacteria 3056
43 Ga0070706_100101202 3300005467 Bacteria 2678
44 Ga0070706_100406553 3300005467 Unclassified 1267
45 Ga0070707_100154798 3300005468 Unclassified 2233
46 Ga0070707_100337006 3300005468 Bacteria 1465
47 Ga0070707_100406639 3300005468 Bacteria 1321
48 Ga0070707_100455853 3300005468 Unclassified 1239
49 Ga0070698_100211577 3300005471 Unclassified 1873
50 Ga0070698_100717080 3300005471 Bacteria 943
51 Ga0070699_100262904 3300005518 Unclassified 1543
52 Ga0070699_100358444 3300005518 Bacteria 1314
53 Ga0070699_100994060 3300005518 Bacteria 769
54 Ga0070679_101536173 3300005530 Unclassified 613
55 Ga0070697_100027505 3300005536 Bacteria 4550
56 Ga0070697_100080094 3300005536 Bacteria 2690
57 Ga0070697_100164928 3300005536 Unclassified 1873
58 Ga0070697_100920036 3300005536 Bacteria 776
59 Ga0070697_101090480 3300005536 Bacteria 711
60 Ga0070672_100009282 3300005543 Bacteria 6776
61 Ga0070672_101844902 3300005543 Bacteria 544
62 Ga0070695_100216224 3300005545 Unclassified 1378
63 Ga0070695_100528308 3300005545 Bacteria 916
64 Ga0070696_100001928 3300005546 Bacteria 13672
65 Ga0070696_100564625 3300005546 Unclassified 913
66 Ga0070693_100078856 3300005547 Bacteria 1958
67 Ga0070665_100009691 3300005548 Bacteria 9733
68 Ga0070665_102509755 3300005548 Bacteria 517
69 Ga0070704_100016414 3300005549 Bacteria 4678
70 Ga0070704_100036858 3300005549 Bacteria 3335
71 Ga0070704_100104712 3300005549 Bacteria 2140
72 Ga0070704_101813762 3300005549 Bacteria 565
73 Ga0070704_102077462 3300005549 Bacteria 528
74 Ga0070704_102085711 3300005549 Bacteria 527
75 Ga0070664_100033959 3300005564 Bacteria 4277
76 Ga0068857_100216440 3300005577 Bacteria 1749
77 Ga0068854_100281679 3300005578 Unclassified 1339
78 Ga0068856_100007192 3300005614 Bacteria 10857
79 Ga0070702_100028173 3300005615 Bacteria 3042
80 Ga0070702_100210721 3300005615 Bacteria 1293
81 Ga0068852_100999460 3300005616 Bacteria 855
82 Ga0068859_100008604 3300005617 Bacteria 10318
83 Ga0068859_102674272 3300005617 Bacteria 548
84 Ga0068864_101635874 3300005618 Bacteria 648
85 Ga0068866_10597815 3300005718 Bacteria 744
86 Ga0068861_100008721 3300005719 Bacteria 6977
87 Ga0068870_10088916 3300005840 Bacteria 1723
88 Ga0068858_100001316 3300005842 Bacteria 25646
89 Ga0068860_100002581 3300005843 Bacteria 18960
90 Ga0068860_100700948 3300005843 Bacteria 1022
91 Ga0068862_100020732 3300005844 Bacteria 5490
92 Ga0081455_10217999 3300005937 Bacteria 1416
93 Ga0081538_10012506 3300005981 Bacteria 6800
94 Ga0081540_1046358 3300005983 Bacteria 2195
95 Ga0075365_10195053 3300006038 Bacteria 1418
96 Ga0075364_10635968 3300006051 Bacteria 729
97 Ga0070716_101300338 3300006173 Bacteria 588
98 Ga0075367_10952450 3300006178 Bacteria 548
99 Ga0097621_100030463 3300006237 Bacteria 4271
100 Ga0097621_100900151 3300006237 Unclassified 824
101 Ga0097621_101862744 3300006237 Unclassified 574
102 Ga0068871_100207541 3300006358 Bacteria 1693
103 Ga0068871_100611629 3300006358 Bacteria 992
104 Ga0068871_100785659 3300006358 Bacteria 877
105 Ga0075428_100036920 3300006844 Bacteria 5381
106 Ga0075428_100750107 3300006844 Viruses 1039
107 Ga0075428_101464009 3300006844 Bacteria 716
108 Ga0075431_100240754 3300006847 Bacteria 1841
109 Ga0075433_10095502 3300006852 Bacteria 2631
110 Ga0075433_11265435 3300006852 Bacteria 640
111 Ga0075433_11525720 3300006852 Unclassified 577
112 Ga0075434_100005533 3300006871 Bacteria 11504
113 Ga0075429_100130272 3300006880 Bacteria 2200
114 Ga0068865_100329169 3300006881 Bacteria 1231
115 Ga0097620_100008604 3300006931 Bacteria 10318
116 Ga0097620_102674331 3300006931 Bacteria 548
117 Ga0111539_10020879 3300009094 Bacteria 8065
118 Ga0111539_11969749 3300009094 Bacteria 677
119 Ga0105245_11808295 3300009098 Bacteria 664
120 Ga0105247_10065029 3300009101 Bacteria 2268
121 Ga0114129_10009524 3300009147 Bacteria 13855
122 Ga0114129_10051075 3300009147 Bacteria 5806
123 Ga0114129_10067853 3300009147 Bacteria 4973
124 Ga0114129_10110770 3300009147 Bacteria 3789
125 Ga0114129_10124380 3300009147 Bacteria 3547
126 Ga0114129_10316011 3300009147 Bacteria 2077
127 Ga0114129_10608709 3300009147 Bacteria 1415
128 Ga0114129_11855522 3300009147 Unclassified 732
129 Ga0114129_13006647 3300009147 Unclassified 554
130 Ga0105243_10373331 3300009148 Bacteria 1317
131 Ga0105241_10119201 3300009174 Bacteria 2123
132 Ga0105241_10835579 3300009174 Bacteria 851
133 Ga0105241_11766341 3300009174 Bacteria 603
134 Ga0105242_10736599 3300009176 Bacteria 969
135 Ga0105248_10003736 3300009177 Bacteria 16889
136 Ga0105248_11163309 3300009177 Bacteria 872
137 Ga0105248_11441430 3300009177 Bacteria 779
138 Ga0105249_10025787 3300009553 Bacteria 5294
139 Ga0105249_10165955 3300009553 Bacteria 2137
140 Ga0105249_10998122 3300009553 Bacteria 906
141 Ga0105249_13131461 3300009553 Unclassified 531
142 Ga0105030_100199 3300009987 Bacteria 5109
143 Ga0105246_10352312 3300011119 Bacteria 1207
144 Ga0157373_10402801 3300013100 Unclassified 981
145 Ga0157374_11772298 3300013296 Bacteria 642
146 Ga0157378_10034526 3300013297 Bacteria 4473
147 Ga0157378_11562268 3300013297 Unclassified 705
148 Ga0157375_10014265 3300013308 Bacteria 7083
149 Ga0157375_13532019 3300013308 Bacteria 520
150 Ga0163163_10720286 3300014325 Bacteria 1061
151 Ga0157380_10054717 3300014326 Bacteria 3167
152 Ga0157380_10225881 3300014326 Unclassified 1678
153 Ga0157380_12315635 3300014326 Bacteria 602
154 Ga0157379_10000926 3300014968 Bacteria 23706
155 Ga0157376_10207887 3300014969 Bacteria 1805
156 Ga0157376_11135151 3300014969 Unclassified 808
157 Ga0163161_10970404 3300017792 Bacteria 724
158 Ga0207653_10002637 3300025885 Bacteria 5694
159 Ga0207710_10652542 3300025900 Bacteria 551
160 Ga0207680_10000632 3300025903 Bacteria 16599
161 Ga0207645_10039226 3300025907 Bacteria 3035
162 Ga0207643_10557555 3300025908 Bacteria 735
163 Ga0207684_10002138 3300025910 Bacteria 20242
164 Ga0207684_10048599 3300025910 Bacteria 3598
165 Ga0207654_10269441 3300025911 Bacteria 1148
166 Ga0207707_11426960 3300025912 Unclassified 551
167 Ga0207660_10603149 3300025917 Unclassified 894
168 Ga0207657_10907122 3300025919 Bacteria 679
169 Ga0207649_10491744 3300025920 Bacteria 932
170 Ga0207652_11500604 3300025921 Unclassified 578
171 Ga0207646_10019038 3300025922 Bacteria 6391
172 Ga0207646_10128122 3300025922 Unclassified 2283
173 Ga0207646_10501151 3300025922 Bacteria 1094
174 Ga0207646_10949987 3300025922 Bacteria 761
175 Ga0207681_10204712 3300025923 Unclassified 1517
176 Ga0207650_10675996 3300025925 Unclassified 871
177 Ga0207659_10944089 3300025926 Unclassified 742
178 Ga0207687_11709900 3300025927 Unclassified 539
179 Ga0207690_10996617 3300025932 Unclassified 697
180 Ga0207706_10018455 3300025933 Bacteria 6276
181 Ga0207706_10910241 3300025933 Unclassified 742
182 Ga0207709_10210903 3300025935 Bacteria 1394
183 Ga0207669_10327476 3300025937 Bacteria 1175
184 Ga0207704_10465125 3300025938 Unclassified 1012
185 Ga0207691_10003791 3300025940 Bacteria 14671
186 Ga0207711_10000505 3300025941 Bacteria 40314
187 Ga0207711_10602113 3300025941 Unclassified 1025
188 Ga0207689_10086666 3300025942 Bacteria 2574
189 Ga0207679_10040467 3300025945 Bacteria 3337
190 Ga0207651_10585267 3300025960 Bacteria 974
191 Ga0207712_11160173 3300025961 Unclassified 689
192 Ga0207668_10313453 3300025972 Unclassified 1299
193 Ga0207640_11230897 3300025981 Unclassified 666
194 Ga0207658_10020491 3300025986 Bacteria 4578
195 Ga0207703_10111455 3300026035 Bacteria 2336
196 Ga0207678_10155244 3300026067 Bacteria 1954
197 Ga0207678_10327338 3300026067 Bacteria 1319
198 Ga0207708_10376463 3300026075 Bacteria 1170
199 Ga0207708_10662248 3300026075 Bacteria 889
200 Ga0207702_10079027 3300026078 Bacteria 2850
201 Ga0207648_10005684 3300026089 Bacteria 12509
202 Ga0207648_11078752 3300026089 Unclassified 753
203 Ga0207676_10165406 3300026095 Bacteria 1921
204 Ga0207674_10470829 3300026116 Bacteria 1214
205 Ga0207675_100001189 3300026118 Bacteria 25928
206 Ga0207683_10159578 3300026121 Bacteria 2038
207 Ga0207683_12031837 3300026121 Unclassified 523
208 Ga0207698_12318360 3300026142 Bacteria 549
209 Ga0207428_10096497 3300027907 Bacteria 2289
210 Ga0268266_10022137 3300028379 Bacteria 5417
211 Ga0268265_10071742 3300028380 Bacteria 2698
212 Ga0268265_11929124 3300028380 Bacteria 598
213 Ga0268264_10006119 3300028381 Bacteria 10166
214 Ga0268264_10341865 3300028381 Unclassified 1422
215 Ga0268264_10348045 3300028381 Bacteria 1410
216 Ga0307405_11780052 3300031731 Unclassified 547
217 Ga0316577_10027570 3300031733 Bacteria 3167
218 Ga0307411_10887930 3300032005 Unclassified 791
219 Ga0451577_1541651 3300042876 Unclassified 587
220 Ga0451576_0140247 3300045051 Bacteria 2521
221 Ga0451576_1182670 3300045051 Unclassified 799
222 Ga0495582_0261791 3300046473 Unclassified 992
223 Ga0495668_0349177 3300046616 Bacteria 812
224 Ga0495647_0023451 3300046681 Bacteria 2237
225 Ga0495658_0191291 3300046683 Bacteria 1272
226 Ga0496101_0020412 3300048904 Bacteria 4535
227 Ga0496102_0023383 3300048905 Bacteria 5488
228 Ga0496103_0024106 3300048906 Bacteria 3670
229 Ga0496106_0000918 3300048909 Bacteria 21419
230 Ga0496107_0014998 3300048910 Bacteria 5427
231 Ga0496108_0808255 3300048911 Unclassified 809
232 Ga0496109_0189002 3300048912 Bacteria 1935
233 Ga0496110_0124898 3300048913 Bacteria 2321
234 Ga0496113_0198549 3300048916 Bacteria 1594
235 Ga0496115_0168718 3300048918 Bacteria 1810
236 Ga0501291_073977 3300049514 Bacteria 666
237 Ga0501031_0485746 3300049568 Unclassified 797
238 Ga0501032_0033391 3300049569 Bacteria 3525
239 Ga0501032_0107800 3300049569 Bacteria 1844
240 Ga0501033_0125820 3300049570 Bacteria 1858
241 Ga0501033_0198296 3300049570 Bacteria 1434
242 Ga0501034_0044742 3300049571 Bacteria 4475
243 Ga0501034_0342949 3300049571 Bacteria 1423
244 Ga0501036_0025332 3300049572 Bacteria 5005
245 Ga0501036_0052708 3300049572 Bacteria 3446
246 Ga0501036_0055446 3300049572 Bacteria 3357
247 Ga0501036_0072308 3300049572 Bacteria 2915
248 Ga0501036_0371708 3300049572 Bacteria 1193
249 Ga0501036_0456116 3300049572 Unclassified 1065
250 Ga0501037_0007115 3300049573 Bacteria 8176
251 Ga0501037_0320427 3300049573 Bacteria 1073
252 Ga0501037_0351629 3300049573 Unclassified 1017
253 Ga0501037_0623411 3300049573 Bacteria 723
254 Ga0501038_0002894 3300049574 Bacteria 16007
255 Ga0501038_0055328 3300049574 Bacteria 3409
256 Ga0501038_0162954 3300049574 Bacteria 1810
257 Ga0501038_0785276 3300049574 Bacteria 708
258 Ga0501038_0931664 3300049574 Bacteria 640
259 Ga0501039_0010832 3300049575 Bacteria 6949
260 Ga0501039_0013012 3300049575 Bacteria 6360
261 Ga0501039_0377599 3300049575 Bacteria 1113
262 Ga0501040_0073440 3300049576 Bacteria 2363
263 Ga0501040_0122261 3300049576 Bacteria 1827
264 Ga0501040_0134845 3300049576 Bacteria 1738
265 Ga0501040_0847658 3300049576 Bacteria 662
266 Ga0501041_0043014 3300049577 Bacteria 2746
267 Ga0501041_0044095 3300049577 Unclassified 2711
268 Ga0501041_0350153 3300049577 Bacteria 933
269 Ga0501041_1066651 3300049577 Bacteria 520
270 Ga0501042_0053978 3300049578 Bacteria 2867
271 Ga0501042_0063322 3300049578 Bacteria 2643
272 Ga0501042_0091938 3300049578 Bacteria 2178
273 Ga0501042_0871728 3300049578 Unclassified 655
274 Ga0501043_0054934 3300049579 Bacteria 3128
275 Ga0501043_0088848 3300049579 Bacteria 2428
276 Ga0501043_0355255 3300049579 Bacteria 1113
277 Ga0501046_0020043 3300049580 Bacteria 5537
278 Ga0501046_0035630 3300049580 Bacteria 4009
279 Ga0501046_0061262 3300049580 Bacteria 2943
280 Ga0501047_0195534 3300049581 Bacteria 1885
281 Ga0501047_0196953 3300049581 Bacteria 1876
282 Ga0501047_0259000 3300049581 Bacteria 1587
283 Ga0501048_0017597 3300049582 Bacteria 5262
284 Ga0501048_0131238 3300049582 Bacteria 1771
285 Ga0501048_0207331 3300049582 Bacteria 1390
286 Ga0501048_0532907 3300049582 Unclassified 842
287 Ga0501048_0910506 3300049582 Bacteria 632
288 Ga0501067_0009022 3300049583 Bacteria 5526
289 Ga0501067_0044751 3300049583 Bacteria 2459
290 Ga0501067_0154313 3300049583 Bacteria 1279
291 Ga0501068_0054971 3300049584 Bacteria 2412
292 Ga0501068_0074286 3300049584 Bacteria 2078
293 Ga0501068_0140053 3300049584 Bacteria 1516
294 Ga0501068_0263073 3300049584 Unclassified 1100
295 Ga0501068_0274971 3300049584 Bacteria 1076
296 Ga0501069_0005260 3300049585 Bacteria 6721
297 Ga0501069_0068117 3300049585 Bacteria 1992
298 Ga0501069_0462105 3300049585 Bacteria 755
299 Ga0501069_0688102 3300049585 Unclassified 616
300 Ga0501070_0079666 3300049586 Bacteria 2710
301 Ga0501070_0278243 3300049586 Bacteria 1366
302 Ga0501070_0495663 3300049586 Bacteria 982
303 Ga0501070_0500282 3300049586 Bacteria 976
304 Ga0501070_0504837 3300049586 Bacteria 971
305 Ga0501071_0020633 3300049587 Bacteria 4582
306 Ga0501071_0155149 3300049587 Bacteria 1709
307 Ga0501071_0193372 3300049587 Bacteria 1526
308 Ga0501071_0873934 3300049587 Unclassified 693
309 Ga0501071_1409878 3300049587 Bacteria 538
310 Ga0501072_0003706 3300049588 Bacteria 11527
311 Ga0501072_0007046 3300049588 Bacteria 8534
312 Ga0501072_0327424 3300049588 Bacteria 1217
313 Ga0501072_0603267 3300049588 Bacteria 865
314 Ga0501072_0772614 3300049588 Unclassified 753
315 Ga0501072_0882565 3300049588 Bacteria 699
316 Ga0501073_0003363 3300049589 Bacteria 12015
317 Ga0501073_0011803 3300049589 Bacteria 6377
318 Ga0501073_0279670 3300049589 Bacteria 1151
319 Ga0501073_1030255 3300049589 Bacteria 566
320 Ga0501074_0002382 3300049590 Bacteria 13107
321 Ga0501074_0032525 3300049590 Bacteria 3779
322 Ga0501074_0060634 3300049590 Bacteria 2726
323 Ga0501074_0135610 3300049590 Unclassified 1761
324 Ga0501074_0896402 3300049590 Bacteria 624
325 Ga0501075_0000078 3300049591 Bacteria 43796
326 Ga0501075_0223430 3300049591 Bacteria 1436
327 Ga0501075_0303985 3300049591 Bacteria 1215
328 Ga0501075_0471249 3300049591 Unclassified 958
329 Ga0501075_0485350 3300049591 Bacteria 943
330 Ga0501075_0607487 3300049591 Bacteria 834
331 Ga0501075_1099586 3300049591 Bacteria 604
332 Ga0501076_0000002 3300049592 Bacteria 165396
333 Ga0501076_0000332 3300049592 Bacteria 29226
334 Ga0501076_0126242 3300049592 Bacteria 2073
335 Ga0501076_0148880 3300049592 Bacteria 1904
336 Ga0501076_0319998 3300049592 Unclassified 1272
337 Ga0501076_0518688 3300049592 Bacteria 982
338 Ga0501076_1728355 3300049592 Unclassified 513
339 Ga0501077_0013261 3300049593 Bacteria 5165
340 Ga0501077_0086152 3300049593 Bacteria 1991
341 Ga0501077_0100455 3300049593 Bacteria 1833
342 Ga0501077_1122609 3300049593 Bacteria 506
343 Ga0501079_0023367 3300049741 Bacteria 4745
344 Ga0501079_0112791 3300049741 Unclassified 2113
345 Ga0501079_0142504 3300049741 Bacteria 1867
346 Ga0501079_0190457 3300049741 Bacteria 1601
347 Ga0501079_0726271 3300049741 Bacteria 782
348 Ga0501080_0001882 3300049742 Bacteria 18048
349 Ga0501080_0101707 3300049742 Bacteria 2666
350 Ga0501080_0223006 3300049742 Bacteria 1724
351 Ga0501080_0324805 3300049742 Bacteria 1392
352 Ga0501080_0509183 3300049742 Bacteria 1075
353 Ga0501080_0671721 3300049742 Bacteria 915
354 Ga0501080_0873315 3300049742 Bacteria 785
355 Ga0501081_0079309 3300049743 Bacteria 2296
356 Ga0501081_0154264 3300049743 Bacteria 1651
357 Ga0501081_0253956 3300049743 Bacteria 1284
358 Ga0501081_0406281 3300049743 Unclassified 1008
359 Ga0501083_0043815 3300049744 Bacteria 3031
360 Ga0501083_0129064 3300049744 Bacteria 1657
361 Ga0501083_0526877 3300049744 Bacteria 769
362 Ga0501083_0681334 3300049744 Bacteria 669
363 Ga0501035_0169367 3300049822 Bacteria 1887
364 Ga0501035_0262816 3300049822 Bacteria 1463
365 Ga0501044_0000458 3300049823 Bacteria 49695
366 Ga0501044_0071769 3300049823 Bacteria 3520
367 Ga0501044_0331451 3300049823 Bacteria 1444
368 Ga0501044_1005197 3300049823 Unclassified 706
369 Ga0501045_0061694 3300049824 Bacteria 2751
370 Ga0501045_0064781 3300049824 Bacteria 2683
371 Ga0501045_0332623 3300049824 Unclassified 1130
372 Ga0501045_0619913 3300049824 Unclassified 800
373 Ga0501045_1195426 3300049824 Bacteria 555
374 Ga0501045_1318834 3300049824 Bacteria 525
375 nmdc:mga0yw44_153910_c1 3300050492 Bacteria 1501
376 nmdc:mga05p37_1520001_c1 3300050507 Unclassified 665
377 nmdc:mga05p37_1586283_c1 3300050507 Unclassified 646
378 nmdc:mga05p37_2222_c1 3300050507 Bacteria 22625
379 nmdc:mga05p37_272993_c1 3300050507 Bacteria 1687
380 nmdc:mga05p37_389706_c1 3300050507 Bacteria 1630
381 nmdc:mga05p37_400506_c1 3300050507 Bacteria 1603
382 nmdc:mga05p37_58172_c1 3300050507 Bacteria 4761
383 nmdc:mga05p37_7633_c1 3300050507 Bacteria 12764
384 nmdc:mga09592_1687694_c1 3300050508 Unclassified 511
385 nmdc:mga08y16_119053_c1 3300050511 Bacteria 2749
386 nmdc:mga0n895_23812_c1 3300050512 Bacteria 5761
387 nmdc:mga0a205_80696_c1 3300050515 Bacteria 3143
388 Ga0501084_0007063 3300054114 Bacteria 9253
389 Ga0501084_0014260 3300054114 Bacteria 6583
390 Ga0501084_0129063 3300054114 Unclassified 2128
391 Ga0501084_0312337 3300054114 Bacteria 1327
392 Ga0501084_0354557 3300054114 Bacteria 1239
393 Ga0501084_0434172 3300054114 Unclassified 1110
394 Ga0501084_0587778 3300054114 Bacteria 941
395 Ga0501084_1010467 3300054114 Bacteria 699
396 Ga0590077_006229 3300059426 Bacteria 2446
397 Ga0501082_0000079 3300060353 Bacteria 71956
398 Ga0501082_0002441 3300060353 Bacteria 16312
399 Ga0501082_0027010 3300060353 Bacteria 4946
400 Ga0501082_0096895 3300060353 Unclassified 2550
401 Ga0501082_0284452 3300060353 Bacteria 1439
402 Ga0501082_0389806 3300060353 Bacteria 1215
403 Ga0501082_1177612 3300060353 Bacteria 670
404 Ga0501082_1251750 3300060353 Unclassified 648
405 Ga0501082_1446511 3300060353 Bacteria 600
406 Ga0530510_0000024 3300061734 Bacteria 68684
407 Ga0530510_0001411 3300061734 Bacteria 16097
408 Ga0530510_0029514 3300061734 Bacteria 3937
409 Ga0530510_0153981 3300061734 Bacteria 1698
410 Ga0530510_0545071 3300061734 Unclassified 881
411 Ga0530510_0742675 3300061734 Unclassified 748
412 Ga0530510_1123331 3300061734 Bacteria 602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_100079370 Ga0070673_1000793704 46
2 3300006051 Ga0075364_10635968 Ga0075364_106359682 46
3 3300006178 Ga0075367_10952450 Ga0075367_109524502 46
4 3300006880 Ga0075429_100130272 Ga0075429_1001302723 46
5 3300009094 Ga0111539_11969749 Ga0111539_119697492 46
6 3300009174 Ga0105241_11766341 Ga0105241_117663411 46
7 3300009177 Ga0105248_11441430 Ga0105248_114414302 46
8 3300009553 Ga0105249_10998122 Ga0105249_109981221 46
9 3300003911 JGI25405J52794_10137129 JGI25405J52794_101371292 47
10 3300005937 Ga0081455_10217999 Ga0081455_102179992 47
11 3300005981 Ga0081538_10012506 Ga0081538_100125066 47
12 3300005983 Ga0081540_1046358 Ga0081540_10463583 47
13 3300006038 Ga0075365_10195053 Ga0075365_101950531 47
14 3300006173 Ga0070716_101300338 Ga0070716_1013003382 47
15 3300006358 Ga0068871_100611629 Ga0068871_1006116292 47
16 3300006844 Ga0075428_101464009 Ga0075428_1014640091 47
17 3300006852 Ga0075433_10095502 Ga0075433_100955028 47
18 3300006871 Ga0075434_100005533 Ga0075434_10000553316 47
19 3300009147 Ga0114129_13006647 Ga0114129_130066471 47
20 3300025941 Ga0207711_10602113 Ga0207711_106021132 47
21 3300046616 Ga0495668_0349177 Ga0495668_0349177_515_658 47
22 3300048911 Ga0496108_0808255 Ga0496108_0808255_92_235 47
23 3300049514 Ga0501291_073977 Ga0501291_073977_102_245 47
24 3300049569 Ga0501032_0033391 Ga0501032_0033391_368_511 47
25 3300049569 Ga0501032_0107800 Ga0501032_0107800_1573_1716 47
26 3300049570 Ga0501033_0125820 Ga0501033_0125820_1252_1395 47
27 3300049570 Ga0501033_0198296 Ga0501033_0198296_462_605 47
28 3300049571 Ga0501034_0044742 Ga0501034_0044742_3501_3644 47
29 3300049571 Ga0501034_0342949 Ga0501034_0342949_450_593 47
30 3300049572 Ga0501036_0055446 Ga0501036_0055446_1979_2122 47
31 3300049573 Ga0501037_0007115 Ga0501037_0007115_720_863 47
32 3300049573 Ga0501037_0320427 Ga0501037_0320427_112_255 47
33 3300049573 Ga0501037_0623411 Ga0501037_0623411_22_165 47
34 3300049574 Ga0501038_0162954 Ga0501038_0162954_433_576 47
35 3300049574 Ga0501038_0785276 Ga0501038_0785276_447_590 47
36 3300049575 Ga0501039_0010832 Ga0501039_0010832_3005_3148 47
37 3300049578 Ga0501042_0063322 Ga0501042_0063322_1095_1238 47
38 3300049579 Ga0501043_0054934 Ga0501043_0054934_1831_1974 47
39 3300049579 Ga0501043_0088848 Ga0501043_0088848_1779_1922 47
40 3300049580 Ga0501046_0035630 Ga0501046_0035630_831_974 47
41 3300049581 Ga0501047_0195534 Ga0501047_0195534_1479_1622 47
42 3300049581 Ga0501047_0196953 Ga0501047_0196953_126_269 47
43 3300049581 Ga0501047_0259000 Ga0501047_0259000_831_974 47
44 3300049582 Ga0501048_0017597 Ga0501048_0017597_3913_4056 47
45 3300049583 Ga0501067_0154313 Ga0501067_0154313_1001_1144 47
46 3300049584 Ga0501068_0263073 Ga0501068_0263073_436_579 47
47 3300049585 Ga0501069_0005260 Ga0501069_0005260_4809_4952 47
48 3300049586 Ga0501070_0079666 Ga0501070_0079666_1207_1350 47
49 3300049586 Ga0501070_0500282 Ga0501070_0500282_400_543 47
50 3300049586 Ga0501070_0504837 Ga0501070_0504837_628_771 47
51 3300049587 Ga0501071_0193372 Ga0501071_0193372_592_735 47
52 3300049588 Ga0501072_0772614 Ga0501072_0772614_70_213 47
53 3300049589 Ga0501073_0011803 Ga0501073_0011803_3662_3805 47
54 3300049589 Ga0501073_0279670 Ga0501073_0279670_638_805 47
55 3300049589 Ga0501073_1030255 Ga0501073_1030255_383_550 47
56 3300049590 Ga0501074_0002382 Ga0501074_0002382_2573_2716 47
57 3300049592 Ga0501076_0148880 Ga0501076_0148880_303_446 47
58 3300049593 Ga0501077_1122609 Ga0501077_1122609_97_240 47
59 3300049741 Ga0501079_0142504 Ga0501079_0142504_1371_1514 47
60 3300049741 Ga0501079_0726271 Ga0501079_0726271_422_589 47
61 3300049742 Ga0501080_0223006 Ga0501080_0223006_523_666 47
62 3300049742 Ga0501080_0324805 Ga0501080_0324805_913_1056 47
63 3300049742 Ga0501080_0873315 Ga0501080_0873315_443_610 47
64 3300049744 Ga0501083_0043815 Ga0501083_0043815_1801_1944 47
65 3300049744 Ga0501083_0129064 Ga0501083_0129064_143_286 47
66 3300049822 Ga0501035_0169367 Ga0501035_0169367_254_397 47
67 3300049823 Ga0501044_0000458 Ga0501044_0000458_21882_22025 47
68 3300049823 Ga0501044_0071769 Ga0501044_0071769_807_950 47
69 3300049823 Ga0501044_0331451 Ga0501044_0331451_838_981 47
70 3300049824 Ga0501045_0619913 Ga0501045_0619913_143_286 47
71 3300050492 nmdc:mga0yw44_153910_c1 nmdc:mga0yw44_153910_c1_1232_1375 47
72 3300050507 nmdc:mga05p37_1520001_c1 nmdc:mga05p37_1520001_c1_172_315 47
73 3300050512 nmdc:mga0n895_23812_c1 nmdc:mga0n895_23812_c1_4544_4687 47
74 3300050515 nmdc:mga0a205_80696_c1 nmdc:mga0a205_80696_c1_1740_1883 47
75 3300054114 Ga0501084_0354557 Ga0501084_0354557_955_1098 47
76 3300054114 Ga0501084_0587778 Ga0501084_0587778_479_622 47
77 3300054114 Ga0501084_1010467 Ga0501084_1010467_527_670 47
78 3300060353 Ga0501082_0000079 Ga0501082_0000079_59869_60012 47
79 3300060353 Ga0501082_0284452 Ga0501082_0284452_321_464 47
80 3300060353 Ga0501082_1177612 Ga0501082_1177612_266_409 47
81 3300061734 Ga0530510_0545071 Ga0530510_0545071_466_609 47
82 3300005293 Ga0065715_10398038 Ga0065715_103980381 48
83 3300005293 Ga0065715_10545963 Ga0065715_105459632 48
84 3300005336 Ga0070680_100419010 Ga0070680_1004190102 48
85 3300005347 Ga0070668_100088014 Ga0070668_1000880143 48
86 3300005406 Ga0070703_10034026 Ga0070703_100340262 48
87 3300005444 Ga0070694_100372544 Ga0070694_1003725444 48
88 3300005444 Ga0070694_100880140 Ga0070694_1008801401 48
89 3300005445 Ga0070708_100215989 Ga0070708_1002159892 48
90 3300005445 Ga0070708_101127097 Ga0070708_1011270971 48
91 3300005445 Ga0070708_101986767 Ga0070708_1019867671 48
92 3300005467 Ga0070706_100078524 Ga0070706_1000785241 48
93 3300005467 Ga0070706_100406553 Ga0070706_1004065532 48
94 3300005468 Ga0070707_100337006 Ga0070707_1003370062 48
95 3300005468 Ga0070707_100406639 Ga0070707_1004066391 48
96 3300005468 Ga0070707_100455853 Ga0070707_1004558531 48
97 3300005471 Ga0070698_100211577 Ga0070698_1002115773 48
98 3300005471 Ga0070698_100717080 Ga0070698_1007170802 48
99 3300005518 Ga0070699_100262904 Ga0070699_1002629041 48
100 3300005518 Ga0070699_100358444 Ga0070699_1003584442 48
101 3300005536 Ga0070697_100027505 Ga0070697_1000275053 48
102 3300005536 Ga0070697_100080094 Ga0070697_1000800945 48
103 3300005536 Ga0070697_101090480 Ga0070697_1010904801 48
104 3300005545 Ga0070695_100216224 Ga0070695_1002162244 48
105 3300005545 Ga0070695_100528308 Ga0070695_1005283082 48
106 3300005548 Ga0070665_102509755 Ga0070665_1025097551 48
107 3300005549 Ga0070704_100036858 Ga0070704_1000368585 48
108 3300005549 Ga0070704_100104712 Ga0070704_1001047122 48
109 3300005549 Ga0070704_101813762 Ga0070704_1018137622 48
110 3300005549 Ga0070704_102077462 Ga0070704_1020774622 48
111 3300005617 Ga0068859_102674272 Ga0068859_1026742722 48
112 3300006237 Ga0097621_101862744 Ga0097621_1018627441 48
113 3300006358 Ga0068871_100785659 Ga0068871_1007856592 48
114 3300006852 Ga0075433_11265435 Ga0075433_112654352 48
115 3300006852 Ga0075433_11525720 Ga0075433_115257202 48
116 3300006931 Ga0097620_102674331 Ga0097620_1026743312 48
117 3300009147 Ga0114129_10009524 Ga0114129_1000952411 48
118 3300009147 Ga0114129_10051075 Ga0114129_100510756 48
119 3300009147 Ga0114129_10110770 Ga0114129_101107702 48
120 3300009147 Ga0114129_10124380 Ga0114129_101243804 48
121 3300009147 Ga0114129_10316011 Ga0114129_103160113 48
122 3300009147 Ga0114129_10608709 Ga0114129_106087091 48
123 3300009177 Ga0105248_11163309 Ga0105248_111633092 48
124 3300009553 Ga0105249_13131461 Ga0105249_131314611 48
125 3300013297 Ga0157378_11562268 Ga0157378_115622681 48
126 3300014326 Ga0157380_10225881 Ga0157380_102258814 48
127 3300014969 Ga0157376_11135151 Ga0157376_111351511 48
128 3300017792 Ga0163161_10970404 Ga0163161_109704042 48
129 3300025885 Ga0207653_10002637 Ga0207653_100026372 48
130 3300025910 Ga0207684_10002138 Ga0207684_1000213817 48
131 3300025922 Ga0207646_10019038 Ga0207646_100190387 48
132 3300025922 Ga0207646_10501151 Ga0207646_105011512 48
133 3300025922 Ga0207646_10949987 Ga0207646_109499871 48
134 3300025926 Ga0207659_10944089 Ga0207659_109440892 48
135 3300026075 Ga0207708_10662248 Ga0207708_106622481 48
136 3300026142 Ga0207698_12318360 Ga0207698_123183601 48
137 3300028381 Ga0268264_10341865 Ga0268264_103418652 48
138 3300031733 Ga0316577_10027570 Ga0316577_100275703 48
139 3300032005 Ga0307411_10887930 Ga0307411_108879302 48
140 3300042876 Ga0451577_1541651 Ga0451577_1541651_256_408 48
141 3300045051 Ga0451576_0140247 Ga0451576_0140247_1759_1911 48
142 3300045051 Ga0451576_1182670 Ga0451576_1182670_349_501 48
143 3300049568 Ga0501031_0485746 Ga0501031_0485746_259_426 48
144 3300049572 Ga0501036_0072308 Ga0501036_0072308_558_725 48
145 3300049572 Ga0501036_0371708 Ga0501036_0371708_793_942 48
146 3300049573 Ga0501037_0351629 Ga0501037_0351629_296_463 48
147 3300049574 Ga0501038_0002894 Ga0501038_0002894_15333_15500 48
148 3300049574 Ga0501038_0931664 Ga0501038_0931664_441_590 48
149 3300049575 Ga0501039_0013012 Ga0501039_0013012_317_484 48
150 3300049576 Ga0501040_0122261 Ga0501040_0122261_233_400 48
151 3300049576 Ga0501040_0847658 Ga0501040_0847658_216_365 48
152 3300049577 Ga0501041_0044095 Ga0501041_0044095_590_757 48
153 3300049577 Ga0501041_0350153 Ga0501041_0350153_341_490 48
154 3300049577 Ga0501041_1066651 Ga0501041_1066651_203_352 48
155 3300049578 Ga0501042_0091938 Ga0501042_0091938_1393_1542 48
156 3300049578 Ga0501042_0871728 Ga0501042_0871728_236_403 48
157 3300049579 Ga0501043_0355255 Ga0501043_0355255_517_666 48
158 3300049580 Ga0501046_0020043 Ga0501046_0020043_400_567 48
159 3300049582 Ga0501048_0207331 Ga0501048_0207331_1104_1253 48
160 3300049582 Ga0501048_0532907 Ga0501048_0532907_125_292 48
161 3300049584 Ga0501068_0140053 Ga0501068_0140053_593_760 48
162 3300049584 Ga0501068_0274971 Ga0501068_0274971_432_581 48
163 3300049585 Ga0501069_0462105 Ga0501069_0462105_110_259 48
164 3300049587 Ga0501071_0873934 Ga0501071_0873934_88_255 48
165 3300049588 Ga0501072_0003706 Ga0501072_0003706_7107_7274 48
166 3300049588 Ga0501072_0603267 Ga0501072_0603267_550_699 48
167 3300049588 Ga0501072_0882565 Ga0501072_0882565_438_587 48
168 3300049590 Ga0501074_0135610 Ga0501074_0135610_1146_1313 48
169 3300049590 Ga0501074_0896402 Ga0501074_0896402_86_235 48
170 3300049591 Ga0501075_0000078 Ga0501075_0000078_26755_26922 48
171 3300049591 Ga0501075_0223430 Ga0501075_0223430_1199_1348 48
172 3300049591 Ga0501075_0471249 Ga0501075_0471249_77_226 48
173 3300049591 Ga0501075_0485350 Ga0501075_0485350_358_510 48
174 3300049592 Ga0501076_0000002 Ga0501076_0000002_149946_150113 48
175 3300049592 Ga0501076_1728355 Ga0501076_1728355_77_226 48
176 3300049593 Ga0501077_0086152 Ga0501077_0086152_335_484 48
177 3300049741 Ga0501079_0112791 Ga0501079_0112791_892_1059 48
178 3300049742 Ga0501080_0509183 Ga0501080_0509183_466_615 48
179 3300049743 Ga0501081_0079309 Ga0501081_0079309_1354_1503 48
180 3300049744 Ga0501083_0681334 Ga0501083_0681334_187_336 48
181 3300049822 Ga0501035_0262816 Ga0501035_0262816_254_403 48
182 3300049824 Ga0501045_0064781 Ga0501045_0064781_1943_2092 48
183 3300049824 Ga0501045_0332623 Ga0501045_0332623_803_970 48
184 3300050507 nmdc:mga05p37_272993_c1 nmdc:mga05p37_272993_c1_173_325 48
185 3300050507 nmdc:mga05p37_389706_c1 nmdc:mga05p37_389706_c1_637_786 48
186 3300050507 nmdc:mga05p37_400506_c1 nmdc:mga05p37_400506_c1_808_960 48
187 3300050507 nmdc:mga05p37_58172_c1 nmdc:mga05p37_58172_c1_745_897 48
188 3300050507 nmdc:mga05p37_7633_c1 nmdc:mga05p37_7633_c1_6751_6897 48
189 3300054114 Ga0501084_0312337 Ga0501084_0312337_1140_1289 48
190 3300059426 Ga0590077_006229 Ga0590077_006229_694_843 48
191 3300060353 Ga0501082_0002441 Ga0501082_0002441_4896_5063 48
192 3300060353 Ga0501082_1251750 Ga0501082_1251750_136_285 48
193 3300061734 Ga0530510_0000024 Ga0530510_0000024_26477_26644 48
194 3300061734 Ga0530510_0029514 Ga0530510_0029514_2255_2404 48
195 3300028380 Ga0268265_11929124 Ga0268265_119291241 49
196 3300049572 Ga0501036_0025332 Ga0501036_0025332_2970_3119 49
197 3300049574 Ga0501038_0055328 Ga0501038_0055328_476_625 49
198 3300049575 Ga0501039_0377599 Ga0501039_0377599_859_1008 49
199 3300049576 Ga0501040_0073440 Ga0501040_0073440_1488_1637 49
200 3300049577 Ga0501041_0043014 Ga0501041_0043014_858_1007 49
201 3300049580 Ga0501046_0061262 Ga0501046_0061262_2776_2925 49
202 3300049582 Ga0501048_0131238 Ga0501048_0131238_607_756 49
203 3300049584 Ga0501068_0054971 Ga0501068_0054971_1382_1531 49
204 3300049587 Ga0501071_0155149 Ga0501071_0155149_784_933 49
205 3300049588 Ga0501072_0007046 Ga0501072_0007046_6374_6523 49
206 3300049591 Ga0501075_0303985 Ga0501075_0303985_1000_1149 49
207 3300049592 Ga0501076_0000332 Ga0501076_0000332_1889_2038 49
208 3300049593 Ga0501077_0100455 Ga0501077_0100455_1462_1611 49
209 3300049741 Ga0501079_0023367 Ga0501079_0023367_3085_3234 49
210 3300049823 Ga0501044_1005197 Ga0501044_1005197_419_568 49
211 3300060353 Ga0501082_0027010 Ga0501082_0027010_2957_3106 49
212 3300061734 Ga0530510_0001411 Ga0530510_0001411_3707_3856 49
213 3300005335 Ga0070666_10000422 Ga0070666_1000042216 50
214 3300005365 Ga0070688_100381359 Ga0070688_1003813591 50
215 3300005367 Ga0070667_100005287 Ga0070667_1000052874 50
216 3300005438 Ga0070701_10150290 Ga0070701_101502903 50
217 3300005440 Ga0070705_100045018 Ga0070705_1000450183 50
218 3300005445 Ga0070708_100048488 Ga0070708_1000484884 50
219 3300005455 Ga0070663_100017778 Ga0070663_1000177783 50
220 3300005456 Ga0070678_100127723 Ga0070678_1001277232 50
221 3300005459 Ga0068867_100022645 Ga0068867_1000226453 50
222 3300005467 Ga0070706_100101202 Ga0070706_1001012022 50
223 3300005468 Ga0070707_100154798 Ga0070707_1001547983 50
224 3300005518 Ga0070699_100994060 Ga0070699_1009940602 50
225 3300005536 Ga0070697_100164928 Ga0070697_1001649282 50
226 3300005543 Ga0070672_100009282 Ga0070672_1000092824 50
227 3300005548 Ga0070665_100009691 Ga0070665_1000096913 50
228 3300005549 Ga0070704_100016414 Ga0070704_1000164145 50
229 3300005564 Ga0070664_100033959 Ga0070664_1000339594 50
230 3300005615 Ga0070702_100028173 Ga0070702_1000281734 50
231 3300005617 Ga0068859_100008604 Ga0068859_1000086044 50
232 3300005718 Ga0068866_10597815 Ga0068866_105978152 50
233 3300005842 Ga0068858_100001316 Ga0068858_10000131618 50
234 3300005843 Ga0068860_100002581 Ga0068860_1000025816 50
235 3300006237 Ga0097621_100030463 Ga0097621_1000304633 50
236 3300006931 Ga0097620_100008604 Ga0097620_1000086044 50
237 3300009101 Ga0105247_10065029 Ga0105247_100650294 50
238 3300009174 Ga0105241_10119201 Ga0105241_101192012 50
239 3300009176 Ga0105242_10736599 Ga0105242_107365992 50
240 3300009177 Ga0105248_10003736 Ga0105248_100037364 50
241 3300009987 Ga0105030_100199 Ga0105030_1001995 50
242 3300013296 Ga0157374_11772298 Ga0157374_117722982 50
243 3300013297 Ga0157378_10034526 Ga0157378_100345264 50
244 3300014326 Ga0157380_12315635 Ga0157380_123156351 50
245 3300014968 Ga0157379_10000926 Ga0157379_100009264 50
246 3300014969 Ga0157376_10207887 Ga0157376_102078873 50
247 3300025900 Ga0207710_10652542 Ga0207710_106525422 50
248 3300025903 Ga0207680_10000632 Ga0207680_1000063210 50
249 3300025910 Ga0207684_10048599 Ga0207684_100485991 50
250 3300025911 Ga0207654_10269441 Ga0207654_102694412 50
251 3300025922 Ga0207646_10128122 Ga0207646_101281222 50
252 3300025935 Ga0207709_10210903 Ga0207709_102109033 50
253 3300025940 Ga0207691_10003791 Ga0207691_100037918 50
254 3300025941 Ga0207711_10000505 Ga0207711_1000050513 50
255 3300025945 Ga0207679_10040467 Ga0207679_100404673 50
256 3300025960 Ga0207651_10585267 Ga0207651_105852672 50
257 3300025986 Ga0207658_10020491 Ga0207658_100204915 50
258 3300026035 Ga0207703_10111455 Ga0207703_101114553 50
259 3300026089 Ga0207648_10005684 Ga0207648_100056846 50
260 3300026121 Ga0207683_10159578 Ga0207683_101595782 50
261 3300028379 Ga0268266_10022137 Ga0268266_100221375 50
262 3300028381 Ga0268264_10006119 Ga0268264_100061193 50
263 3300048904 Ga0496101_0020412 Ga0496101_0020412_1351_1524 50
264 3300048905 Ga0496102_0023383 Ga0496102_0023383_1312_1485 50
265 3300048906 Ga0496103_0024106 Ga0496103_0024106_1493_1666 50
266 3300048909 Ga0496106_0000918 Ga0496106_0000918_11134_11307 50
267 3300048910 Ga0496107_0014998 Ga0496107_0014998_3744_3917 50
268 3300048912 Ga0496109_0189002 Ga0496109_0189002_502_675 50
269 3300048913 Ga0496110_0124898 Ga0496110_0124898_742_915 50
270 3300048916 Ga0496113_0198549 Ga0496113_0198549_1394_1567 50
271 3300049572 Ga0501036_0456116 Ga0501036_0456116_498_653 50
272 3300049583 Ga0501067_0009022 Ga0501067_0009022_1180_1335 50
273 3300049583 Ga0501067_0044751 Ga0501067_0044751_1021_1194 50
274 3300049584 Ga0501068_0074286 Ga0501068_0074286_955_1110 50
275 3300049585 Ga0501069_0068117 Ga0501069_0068117_361_534 50
276 3300049585 Ga0501069_0688102 Ga0501069_0688102_109_264 50
277 3300049586 Ga0501070_0495663 Ga0501070_0495663_206_361 50
278 3300049589 Ga0501073_0003363 Ga0501073_0003363_9752_9907 50
279 3300049590 Ga0501074_0032525 Ga0501074_0032525_2799_2954 50
280 3300049592 Ga0501076_0518688 Ga0501076_0518688_150_305 50
281 3300049593 Ga0501077_0013261 Ga0501077_0013261_3726_3881 50
282 3300049741 Ga0501079_0190457 Ga0501079_0190457_768_923 50
283 3300049742 Ga0501080_0001882 Ga0501080_0001882_8335_8490 50
284 3300049744 Ga0501083_0526877 Ga0501083_0526877_145_300 50
285 3300054114 Ga0501084_0007063 Ga0501084_0007063_4914_5069 50
286 3300054114 Ga0501084_0434172 Ga0501084_0434172_203_358 50
287 3300060353 Ga0501082_0389806 Ga0501082_0389806_814_969 50
288 3300061734 Ga0530510_0742675 Ga0530510_0742675_480_653 50
289 3300061734 Ga0530510_1123331 Ga0530510_1123331_324_479 50
290 3300006844 Ga0075428_100750107 Ga0075428_1007501071 51
291 3300009147 Ga0114129_10067853 Ga0114129_100678535 51
292 3300049743 Ga0501081_0253956 Ga0501081_0253956_934_1089 51
293 3300049824 Ga0501045_1195426 Ga0501045_1195426_59_214 51
294 3300050507 nmdc:mga05p37_2222_c1 nmdc:mga05p37_2222_c1_4566_4727 51
295 3300060353 Ga0501082_1446511 Ga0501082_1446511_435_590 51
296 3300005328 Ga0070676_10081440 Ga0070676_100814402 52
297 3300005336 Ga0070680_100847056 Ga0070680_1008470562 52
298 3300005339 Ga0070660_101707542 Ga0070660_1017075422 52
299 3300005345 Ga0070692_10196811 Ga0070692_101968112 52
300 3300005347 Ga0070668_100075295 Ga0070668_1000752951 52
301 3300005353 Ga0070669_100091320 Ga0070669_1000913203 52
302 3300005356 Ga0070674_100232909 Ga0070674_1002329093 52
303 3300005366 Ga0070659_100343899 Ga0070659_1003438992 52
304 3300005440 Ga0070705_100594198 Ga0070705_1005941982 52
305 3300005441 Ga0070700_100387190 Ga0070700_1003871901 52
306 3300005444 Ga0070694_100068850 Ga0070694_1000688503 52
307 3300005444 Ga0070694_100640353 Ga0070694_1006403532 52
308 3300005457 Ga0070662_100028302 Ga0070662_1000283024 52
309 3300005458 Ga0070681_10035032 Ga0070681_100350325 52
310 3300005459 Ga0068867_101100754 Ga0068867_1011007542 52
311 3300005530 Ga0070679_101536173 Ga0070679_1015361732 52
312 3300005536 Ga0070697_100920036 Ga0070697_1009200361 52
313 3300005543 Ga0070672_101844902 Ga0070672_1018449021 52
314 3300005546 Ga0070696_100001928 Ga0070696_1000019282 52
315 3300005546 Ga0070696_100564625 Ga0070696_1005646252 52
316 3300005549 Ga0070704_102085711 Ga0070704_1020857111 52
317 3300005577 Ga0068857_100216440 Ga0068857_1002164405 52
318 3300005578 Ga0068854_100281679 Ga0068854_1002816792 52
319 3300005615 Ga0070702_100210721 Ga0070702_1002107212 52
320 3300005616 Ga0068852_100999460 Ga0068852_1009994602 52
321 3300005719 Ga0068861_100008721 Ga0068861_1000087218 52
322 3300005840 Ga0068870_10088916 Ga0068870_100889163 52
323 3300005843 Ga0068860_100700948 Ga0068860_1007009483 52
324 3300005844 Ga0068862_100020732 Ga0068862_10002073210 52
325 3300006237 Ga0097621_100900151 Ga0097621_1009001512 52
326 3300006844 Ga0075428_100036920 Ga0075428_1000369208 52
327 3300006847 Ga0075431_100240754 Ga0075431_1002407542 52
328 3300006881 Ga0068865_100329169 Ga0068865_1003291693 52
329 3300009094 Ga0111539_10020879 Ga0111539_100208797 52
330 3300009098 Ga0105245_11808295 Ga0105245_118082952 52
331 3300009147 Ga0114129_11855522 Ga0114129_118555222 52
332 3300009174 Ga0105241_10835579 Ga0105241_108355792 52
333 3300009553 Ga0105249_10025787 Ga0105249_100257876 52
334 3300011119 Ga0105246_10352312 Ga0105246_103523122 52
335 3300013100 Ga0157373_10402801 Ga0157373_104028012 52
336 3300025907 Ga0207645_10039226 Ga0207645_100392263 52
337 3300025908 Ga0207643_10557555 Ga0207643_105575552 52
338 3300025912 Ga0207707_11426960 Ga0207707_114269602 52
339 3300025917 Ga0207660_10603149 Ga0207660_106031491 52
340 3300025919 Ga0207657_10907122 Ga0207657_109071222 52
341 3300025920 Ga0207649_10491744 Ga0207649_104917443 52
342 3300025921 Ga0207652_11500604 Ga0207652_115006041 52
343 3300025923 Ga0207681_10204712 Ga0207681_102047121 52
344 3300025925 Ga0207650_10675996 Ga0207650_106759962 52
345 3300025927 Ga0207687_11709900 Ga0207687_117099001 52
346 3300025932 Ga0207690_10996617 Ga0207690_109966172 52
347 3300025933 Ga0207706_10018455 Ga0207706_100184555 52
348 3300025937 Ga0207669_10327476 Ga0207669_103274762 52
349 3300025938 Ga0207704_10465125 Ga0207704_104651251 52
350 3300025942 Ga0207689_10086666 Ga0207689_100866663 52
351 3300025972 Ga0207668_10313453 Ga0207668_103134532 52
352 3300025981 Ga0207640_11230897 Ga0207640_112308972 52
353 3300026067 Ga0207678_10327338 Ga0207678_103273383 52
354 3300026075 Ga0207708_10376463 Ga0207708_103764632 52
355 3300026089 Ga0207648_11078752 Ga0207648_110787522 52
356 3300026116 Ga0207674_10470829 Ga0207674_104708293 52
357 3300026118 Ga0207675_100001189 Ga0207675_1000011895 52
358 3300026121 Ga0207683_12031837 Ga0207683_120318371 52
359 3300027907 Ga0207428_10096497 Ga0207428_100964972 52
360 3300028380 Ga0268265_10071742 Ga0268265_100717426 52
361 3300028381 Ga0268264_10348045 Ga0268264_103480453 52
362 3300046473 Ga0495582_0261791 Ga0495582_0261791_523_681 52
363 3300046681 Ga0495647_0023451 Ga0495647_0023451_1798_1956 52
364 3300046683 Ga0495658_0191291 Ga0495658_0191291_736_894 52
365 3300049572 Ga0501036_0052708 Ga0501036_0052708_1506_1664 52
366 3300049576 Ga0501040_0134845 Ga0501040_0134845_1195_1353 52
367 3300049578 Ga0501042_0053978 Ga0501042_0053978_959_1117 52
368 3300049582 Ga0501048_0910506 Ga0501048_0910506_58_216 52
369 3300049586 Ga0501070_0278243 Ga0501070_0278243_1087_1245 52
370 3300049587 Ga0501071_0020633 Ga0501071_0020633_358_516 52
371 3300049588 Ga0501072_0327424 Ga0501072_0327424_416_574 52
372 3300049590 Ga0501074_0060634 Ga0501074_0060634_1162_1320 52
373 3300049592 Ga0501076_0126242 Ga0501076_0126242_1608_1766 52
374 3300049742 Ga0501080_0101707 Ga0501080_0101707_2496_2654 52
375 3300049743 Ga0501081_0154264 Ga0501081_0154264_1042_1200 52
376 3300049824 Ga0501045_0061694 Ga0501045_0061694_809_967 52
377 3300050507 nmdc:mga05p37_1586283_c1 nmdc:mga05p37_1586283_c1_89_250 52
378 3300050508 nmdc:mga09592_1687694_c1 nmdc:mga09592_1687694_c1_143_307 52
379 3300050511 nmdc:mga08y16_119053_c1 nmdc:mga08y16_119053_c1_1260_1424 52
380 3300054114 Ga0501084_0014260 Ga0501084_0014260_6312_6470 52
381 3300061734 Ga0530510_0153981 Ga0530510_0153981_452_610 52
382 3300031731 Ga0307405_11780052 Ga0307405_117800522 53
383 3300049591 Ga0501075_1099586 Ga0501075_1099586_194_358 54
384 3300049824 Ga0501045_1318834 Ga0501045_1318834_19_183 54
385 3300005547 Ga0070693_100078856 Ga0070693_1000788563 56
386 3300005614 Ga0068856_100007192 Ga0068856_10000719211 56
387 3300005618 Ga0068864_101635874 Ga0068864_1016358742 56
388 3300006358 Ga0068871_100207541 Ga0068871_1002075412 56
389 3300009148 Ga0105243_10373331 Ga0105243_103733312 56
390 3300013308 Ga0157375_10014265 Ga0157375_100142657 56
391 3300013308 Ga0157375_13532019 Ga0157375_135320191 56
392 3300014325 Ga0163163_10720286 Ga0163163_107202862 56
393 3300026067 Ga0207678_10155244 Ga0207678_101552442 56
394 3300026078 Ga0207702_10079027 Ga0207702_100790274 56
395 3300026095 Ga0207676_10165406 Ga0207676_101654062 56
396 3300048918 Ga0496115_0168718 Ga0496115_0168718_894_1067 56
397 3300049587 Ga0501071_1409878 Ga0501071_1409878_232_402 56
398 3300049591 Ga0501075_0607487 Ga0501075_0607487_10_180 56
399 3300049592 Ga0501076_0319998 Ga0501076_0319998_143_313 56
400 3300049742 Ga0501080_0671721 Ga0501080_0671721_470_640 56
401 3300049743 Ga0501081_0406281 Ga0501081_0406281_788_958 56
402 3300054114 Ga0501084_0129063 Ga0501084_0129063_202_372 56
403 3300060353 Ga0501082_0096895 Ga0501082_0096895_2000_2170 56
404 2162886006 SwRhRL3b_contig_3456523 SwRhRL3b_0437.00001200 57
405 3300005289 Ga0065704_10124715 Ga0065704_101247152 57
406 3300005295 Ga0065707_10090428 Ga0065707_100904286 57
407 3300005354 Ga0070675_100940541 Ga0070675_1009405412 57
408 3300005457 Ga0070662_100860715 Ga0070662_1008607151 57
409 3300009553 Ga0105249_10165955 Ga0105249_101659552 57
410 3300014326 Ga0157380_10054717 Ga0157380_100547172 57
411 3300025933 Ga0207706_10910241 Ga0207706_109102411 57
412 3300025961 Ga0207712_11160173 Ga0207712_111601732 57

Feature Viewer

pLDDT pTM Quality
69.52 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map