metagRoot

F437735

General Info

Members	Datasets	Scaffolds	Average Seq Length
412	213	412	242

Family's Representative Sequence

Representative Sequence	3300005467\|Ga0070706_100323407\|Ga0070706_1003234072
Length	265
Sequence	MAMRRIDIAPPVRSTGEDLLLQLDLGRLPRHVAIIMDGNGRWAARRRFPRIAGHRAGADAVRRTVETAAKLGLECLTLYAFSTENWKRPKYEIRALMDLLVEYIRRELHSLKENNIQFRMLGRTDDLYLSVLEQIRKAELATLQSTGLRLNIALNYGSRAEIVDAVKRVARDVAAGRLEPEEISEETIHRNLYTRALPDPDLLIRTSGEMRISNFLLWQIAYTEIHITDTLWPDFDERDLFAALIDYQKRDRRYGRIMELEEVVV

Samples

	Sample ID	Description	Type	Environment
1	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
2	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
3	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
4	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
5	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
6	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
7	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
8	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
9	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
10	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
11	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
12	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
13	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
14	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
15	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
16	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
17	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
18	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
19	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
20	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
21	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
24	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
25	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
26	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
27	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
30	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
31	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
32	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
33	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
34	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
35	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
36	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
40	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
41	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
42	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
43	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
44	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
47	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
48	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
49	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
50	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
51	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
52	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
53	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
54	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
55	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
56	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
57	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
58	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
59	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
60	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
61	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
62	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
63	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
64	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
69	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
70	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
71	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
72	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
73	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
74	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
75	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
76	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
77	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
78	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
79	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
80	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
81	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
82	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
83	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
84	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
85	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
126	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
129	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
130	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
131	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
132	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
133	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
134	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
135	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
136	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
137	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
138	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
139	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
140	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
141	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
142	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
143	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
144	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
145	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
146	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
147	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
148	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
149	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
150	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
151	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
152	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
153	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
154	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
155	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
156	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
157	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
158	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
159	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
160	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
161	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
162	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
163	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
164	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
165	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
166	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
167	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
168	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
169	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
170	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
171	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
172	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
173	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
174	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
175	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
176	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
177	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
178	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
179	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
180	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
181	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
182	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
183	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
184	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
185	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
186	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
187	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
188	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
189	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
190	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
191	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
192	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
193	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
194	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
195	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
196	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
197	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
198	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
199	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
200	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
201	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
202	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
203	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
204	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
205	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
206	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
207	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
208	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
209	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
210	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
211	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
212	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
213	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	5.1
Rhizosphere	94.66
Stem	0
Stem Tuber	0
Unclassified	0.24

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootL2_10047888	3300003322	Bacteria	2330
2	Ga0070676_10000437	3300005328	Bacteria	19793
3	Ga0070690_100032735	3300005330	Bacteria	3249
4	Ga0070690_100074390	3300005330	Bacteria	2213
5	Ga0068869_100014080	3300005334	Bacteria	5337
6	Ga0070666_10032479	3300005335	Bacteria	3448
7	Ga0070680_100013471	3300005336	Bacteria	6369
8	Ga0070680_100020481	3300005336	Bacteria	5249
9	Ga0070660_100040556	3300005339	Bacteria	3544
10	Ga0070689_100327985	3300005340	Bacteria	1280
11	Ga0070691_10010538	3300005341	Bacteria	4220
12	Ga0070687_100188850	3300005343	Bacteria	1240
13	Ga0070692_10028965	3300005345	Bacteria	2757
14	Ga0070668_100004574	3300005347	Bacteria	10254
15	Ga0070669_100019809	3300005353	Bacteria	4808
16	Ga0070669_100146614	3300005353	Bacteria	1824
17	Ga0070669_100414002	3300005353	Bacteria	1105
18	Ga0070669_100428340	3300005353	Bacteria	1087
19	Ga0070675_100044174	3300005354	Bacteria	3644
20	Ga0070675_100085204	3300005354	Bacteria	2640
21	Ga0070674_100001291	3300005356	Bacteria	13177
22	Ga0070673_100073126	3300005364	Bacteria	2759
23	Ga0070688_100017042	3300005365	Bacteria	4165
24	Ga0070703_10015467	3300005406	Bacteria	2183
25	Ga0070703_10047944	3300005406	Bacteria	1355
26	Ga0070709_10002860	3300005434	Bacteria	9330
27	Ga0070713_100120522	3300005436	Bacteria	2300
28	Ga0070701_10002715	3300005438	Bacteria	6862
29	Ga0070711_100000763	3300005439	Bacteria	16750
30	Ga0070705_100055997	3300005440	Bacteria	2320
31	Ga0070705_100093236	3300005440	Bacteria	1882
32	Ga0070705_100095738	3300005440	Bacteria	1862
33	Ga0070700_100012422	3300005441	Bacteria	4752
34	Ga0070700_100022934	3300005441	Bacteria	3648
35	Ga0070700_100063655	3300005441	Bacteria	2334
36	Ga0070700_100356232	3300005441	Bacteria	1086
37	Ga0070694_100001036	3300005444	Bacteria	15846
38	Ga0070694_100007601	3300005444	Bacteria	6614
39	Ga0070694_100215925	3300005444	Bacteria	1436
40	Ga0070708_100006777	3300005445	Bacteria	9125
41	Ga0070708_100021953	3300005445	Bacteria	5409
42	Ga0070708_100475299	3300005445	Bacteria	1179
43	Ga0070678_100004694	3300005456	Bacteria	7779
44	Ga0070662_100005405	3300005457	Bacteria	8162
45	Ga0070681_10269713	3300005458	Bacteria	1613
46	Ga0068867_100005955	3300005459	Bacteria	8648
47	Ga0068867_100280561	3300005459	Bacteria	1366
48	Ga0070706_100025904	3300005467	Bacteria	5397
49	Ga0070706_100323407	3300005467	Bacteria	1438
50	Ga0070706_100550070	3300005467	Bacteria	1074
51	Ga0070707_100009027	3300005468	Bacteria	9247
52	Ga0070707_100016656	3300005468	Bacteria	6899
53	Ga0070707_100209865	3300005468	Bacteria	1898
54	Ga0070707_100242541	3300005468	Bacteria	1754
55	Ga0070698_100004663	3300005471	Bacteria	15071
56	Ga0070698_100040069	3300005471	Bacteria	4817
57	Ga0070698_100063837	3300005471	Bacteria	3712
58	Ga0070698_100116514	3300005471	Bacteria	2634
59	Ga0070698_100174743	3300005471	Bacteria	2088
60	Ga0070699_100000006	3300005518	Bacteria	363492
61	Ga0070699_100000015	3300005518	Bacteria	211169
62	Ga0070699_100000036	3300005518	Bacteria	133816
63	Ga0070699_100009622	3300005518	Bacteria	8369
64	Ga0070699_100107885	3300005518	Bacteria	2443
65	Ga0070679_100012367	3300005530	Bacteria	8154
66	Ga0070697_100003808	3300005536	Bacteria	11589
67	Ga0070697_100161909	3300005536	Bacteria	1890
68	Ga0070697_100308751	3300005536	Bacteria	1361
69	Ga0070697_100409272	3300005536	Bacteria	1178
70	Ga0070697_100482269	3300005536	Bacteria	1083
71	Ga0068853_100247097	3300005539	Bacteria	1636
72	Ga0070672_100037573	3300005543	Bacteria	3696
73	Ga0070672_100734838	3300005543	Bacteria	865
74	Ga0070695_100000766	3300005545	Bacteria	17268
75	Ga0070695_100005738	3300005545	Bacteria	7313
76	Ga0070695_100021954	3300005545	Bacteria	3911
77	Ga0070695_100022573	3300005545	Bacteria	3860
78	Ga0070695_100027500	3300005545	Bacteria	3523
79	Ga0070695_100182427	3300005545	Bacteria	1488
80	Ga0070696_100000314	3300005546	Bacteria	29499
81	Ga0070696_100002916	3300005546	Bacteria	11368
82	Ga0070704_100002995	3300005549	Bacteria	9604
83	Ga0070704_100007933	3300005549	Bacteria	6336
84	Ga0070704_100008264	3300005549	Bacteria	6231
85	Ga0070704_100135997	3300005549	Bacteria	1912
86	Ga0068855_100449222	3300005563	Bacteria	1407
87	Ga0068857_100005725	3300005577	Bacteria	10629
88	Ga0068857_100124346	3300005577	Bacteria	2324
89	Ga0068857_100727477	3300005577	Bacteria	944
90	Ga0068854_100001678	3300005578	Bacteria	13488
91	Ga0070702_100004449	3300005615	Bacteria	6398
92	Ga0070702_100005374	3300005615	Bacteria	5956
93	Ga0068864_100000682	3300005618	Bacteria	28462
94	Ga0068864_100393884	3300005618	Bacteria	1315
95	Ga0068866_10000546	3300005718	Bacteria	17164
96	Ga0068866_10040563	3300005718	Bacteria	2305
97	Ga0068861_100074523	3300005719	Bacteria	2639
98	Ga0068861_100341746	3300005719	Bacteria	1310
99	Ga0068870_10072479	3300005840	Bacteria	1882
100	Ga0068863_100010948	3300005841	Bacteria	8796
101	Ga0068863_100235490	3300005841	Bacteria	1767
102	Ga0068860_100024599	3300005843	Bacteria	5815
103	Ga0068860_100232324	3300005843	Bacteria	1792
104	Ga0068860_100294779	3300005843	Bacteria	1588
105	Ga0068862_100061947	3300005844	Bacteria	3216
106	Ga0068862_100080212	3300005844	Bacteria	2830
107	Ga0070717_10000520	3300006028	Bacteria	24354
108	Ga0070716_100036586	3300006173	Bacteria	2707
109	Ga0070716_100111920	3300006173	Bacteria	1693
110	Ga0097621_100076256	3300006237	Bacteria	2781
111	Ga0075430_100009200	3300006846	Bacteria	8348
112	Ga0075430_100052785	3300006846	Bacteria	3424
113	Ga0075431_100002659	3300006847	Bacteria	17295
114	Ga0075431_100152825	3300006847	Bacteria	2376
115	Ga0075433_10129287	3300006852	Bacteria	2244
116	Ga0075433_10194173	3300006852	Bacteria	1806
117	Ga0075434_100009189	3300006871	Bacteria	9212
118	Ga0075434_100048918	3300006871	Bacteria	4196
119	Ga0075434_100153608	3300006871	Bacteria	2322
120	Ga0075434_100155083	3300006871	Bacteria	2310
121	Ga0075434_100797876	3300006871	Bacteria	960
122	Ga0075429_100010080	3300006880	Bacteria	8188
123	Ga0075429_100078624	3300006880	Bacteria	2875
124	Ga0068865_100014434	3300006881	Bacteria	5018
125	Ga0075436_100034721	3300006914	Bacteria	3478
126	Ga0075436_100145059	3300006914	Bacteria	1669
127	Ga0075436_100254147	3300006914	Bacteria	1252
128	Ga0075435_100005046	3300007076	Bacteria	9170
129	Ga0075435_100241018	3300007076	Bacteria	1538
130	Ga0105240_10089166	3300009093	Bacteria	3773
131	Ga0111539_10000756	3300009094	Bacteria	42020
132	Ga0111539_10014805	3300009094	Bacteria	9728
133	Ga0105245_10733594	3300009098	Bacteria	1023
134	Ga0114129_10095960	3300009147	Bacteria	4106
135	Ga0114129_10195926	3300009147	Bacteria	2740
136	Ga0114129_10496044	3300009147	Bacteria	1595
137	Ga0114129_10697917	3300009147	Bacteria	1305
138	Ga0105243_10034261	3300009148	Bacteria	3929
139	Ga0105243_10405602	3300009148	Bacteria	1267
140	Ga0105241_10019185	3300009174	Bacteria	5042
141	Ga0105241_10365138	3300009174	Bacteria	1257
142	Ga0105242_10000297	3300009176	Bacteria	39548
143	Ga0105248_10000630	3300009177	Bacteria	40000
144	Ga0105248_10184491	3300009177	Bacteria	2351
145	Ga0105249_10017461	3300009553	Bacteria	6370
146	Ga0105249_10509394	3300009553	Bacteria	1250
147	Ga0099796_10048065	3300010159	Bacteria	1470
148	Ga0105239_10157532	3300010375	Bacteria	2537
149	Ga0105246_10490457	3300011119	Bacteria	1041
150	Ga0157378_10019697	3300013297	Bacteria	5932
151	Ga0157378_10168495	3300013297	Bacteria	2052
152	Ga0163162_10811219	3300013306	Bacteria	1053
153	Ga0157372_10375240	3300013307	Bacteria	1657
154	Ga0157375_10243746	3300013308	Bacteria	1957
155	Ga0157375_10874327	3300013308	Bacteria	1044
156	Ga0163163_10024179	3300014325	Bacteria	5780
157	Ga0163163_10096077	3300014325	Bacteria	2983
158	Ga0157380_10077205	3300014326	Bacteria	2714
159	Ga0157380_10089068	3300014326	Bacteria	2541
160	Ga0157380_10639433	3300014326	Bacteria	1059
161	Ga0157379_10032261	3300014968	Bacteria	4669
162	Ga0157379_10121621	3300014968	Bacteria	2348
163	Ga0157379_10335171	3300014968	Bacteria	1383
164	Ga0157376_10036484	3300014969	Bacteria	3983
165	Ga0157376_10459703	3300014969	Bacteria	1243
166	Ga0163161_10042697	3300017792	Bacteria	3262
167	Ga0207653_10037087	3300025885	Bacteria	1589
168	Ga0207642_10000820	3300025899	Bacteria	9679
169	Ga0207680_10021439	3300025903	Bacteria	3496
170	Ga0207699_10004506	3300025906	Bacteria	6656
171	Ga0207645_10001002	3300025907	Bacteria	23327
172	Ga0207643_10011659	3300025908	Bacteria	4747
173	Ga0207643_10037332	3300025908	Bacteria	2726
174	Ga0207684_10012758	3300025910	Bacteria	7288
175	Ga0207684_10471593	3300025910	Bacteria	1077
176	Ga0207654_10075326	3300025911	Bacteria	2016
177	Ga0207663_10000529	3300025916	Bacteria	16741
178	Ga0207663_10189362	3300025916	Bacteria	1476
179	Ga0207660_10005299	3300025917	Bacteria	8388
180	Ga0207660_10007084	3300025917	Bacteria	7262
181	Ga0207660_10053829	3300025917	Bacteria	2870
182	Ga0207660_10076678	3300025917	Bacteria	2445
183	Ga0207662_10115853	3300025918	Bacteria	1675
184	Ga0207646_10003953	3300025922	Bacteria	16440
185	Ga0207646_10015549	3300025922	Bacteria	7184
186	Ga0207646_10512283	3300025922	Bacteria	1080
187	Ga0207681_10400323	3300025923	Bacteria	1109
188	Ga0207681_10415611	3300025923	Bacteria	1089
189	Ga0207659_10037367	3300025926	Bacteria	3371
190	Ga0207659_10126715	3300025926	Bacteria	1964
191	Ga0207687_10439866	3300025927	Bacteria	1080
192	Ga0207700_10182208	3300025928	Bacteria	1759
193	Ga0207700_10571816	3300025928	Bacteria	1004
194	Ga0207690_10046833	3300025932	Bacteria	2866
195	Ga0207706_10000065	3300025933	Bacteria	109080
196	Ga0207686_10000382	3300025934	Bacteria	30919
197	Ga0207709_10006411	3300025935	Bacteria	6605
198	Ga0207669_10000606	3300025937	Bacteria	15569
199	Ga0207669_10032456	3300025937	Bacteria	2933
200	Ga0207665_10002787	3300025939	Bacteria	11713
201	Ga0207665_10020492	3300025939	Bacteria	4345
202	Ga0207691_10021131	3300025940	Bacteria	6150
203	Ga0207691_10188995	3300025940	Bacteria	1797
204	Ga0207711_10001822	3300025941	Bacteria	19440
205	Ga0207711_10925684	3300025941	Bacteria	810
206	Ga0207689_10010381	3300025942	Bacteria	8021
207	Ga0207667_10388646	3300025949	Bacteria	1421
208	Ga0207651_10072970	3300025960	Bacteria	2439
209	Ga0207712_10003413	3300025961	Bacteria	10038
210	Ga0207668_10019675	3300025972	Bacteria	4272
211	Ga0207640_10004504	3300025981	Bacteria	7559
212	Ga0207658_10040597	3300025986	Bacteria	3365
213	Ga0207658_10068570	3300025986	Bacteria	2677
214	Ga0207703_10248379	3300026035	Bacteria	1602
215	Ga0207678_10252862	3300026067	Bacteria	1509
216	Ga0207708_10022116	3300026075	Bacteria	4802
217	Ga0207708_10026227	3300026075	Bacteria	4408
218	Ga0207708_10061988	3300026075	Bacteria	2856
219	Ga0207708_10083365	3300026075	Bacteria	2457
220	Ga0207708_10397424	3300026075	Bacteria	1139
221	Ga0207641_10032086	3300026088	Bacteria	4361
222	Ga0207641_10186510	3300026088	Bacteria	1903
223	Ga0207648_10000211	3300026089	Bacteria	62641
224	Ga0207648_10336404	3300026089	Bacteria	1359
225	Ga0207648_10399268	3300026089	Bacteria	1245
226	Ga0207676_10006219	3300026095	Bacteria	8432
227	Ga0207676_10493005	3300026095	Bacteria	1162
228	Ga0207674_10003334	3300026116	Bacteria	19745
229	Ga0207674_10062056	3300026116	Bacteria	3775
230	Ga0207674_10197315	3300026116	Bacteria	1962
231	Ga0207675_100030043	3300026118	Bacteria	5059
232	Ga0207675_100066906	3300026118	Bacteria	3359
233	Ga0207675_100243279	3300026118	Bacteria	1739
234	Ga0207683_10040457	3300026121	Bacteria	4068
235	Ga0207428_10000945	3300027907	Bacteria	32297
236	Ga0207428_10056053	3300027907	Bacteria	3132
237	Ga0268265_10040917	3300028380	Bacteria	3425
238	Ga0268265_10056593	3300028380	Bacteria	2984
239	Ga0268265_10069313	3300028380	Bacteria	2738
240	Ga0268265_10215570	3300028380	Bacteria	1676
241	Ga0268265_10613570	3300028380	Bacteria	1041
242	Ga0268264_10011521	3300028381	Bacteria	7304
243	Ga0268264_10244271	3300028381	Bacteria	1664
244	Ga0307408_100008964	3300031548	Bacteria	6609
245	Ga0307405_10020179	3300031731	Bacteria	3719
246	Ga0307405_10032524	3300031731	Bacteria	3084
247	Ga0307413_10085677	3300031824	Bacteria	2035
248	Ga0307413_10106764	3300031824	Bacteria	1864
249	Ga0307413_10184126	3300031824	Bacteria	1492
250	Ga0307413_10354681	3300031824	Bacteria	1133
251	Ga0307410_10011991	3300031852	Bacteria	4987
252	Ga0307410_10016721	3300031852	Bacteria	4385
253	Ga0307410_10077806	3300031852	Bacteria	2320
254	Ga0307410_10084015	3300031852	Bacteria	2243
255	Ga0307410_10111806	3300031852	Bacteria	1977
256	Ga0307410_10206885	3300031852	Bacteria	1501
257	Ga0307410_10269239	3300031852	Bacteria	1332
258	Ga0307406_10070049	3300031901	Bacteria	2295
259	Ga0307406_10079051	3300031901	Bacteria	2180
260	Ga0307406_10099049	3300031901	Bacteria	1981
261	Ga0307406_10099111	3300031901	Bacteria	1980
262	Ga0307407_10195937	3300031903	Bacteria	1350
263	Ga0307412_10015145	3300031911	Bacteria	4563
264	Ga0307412_10047820	3300031911	Bacteria	2811
265	Ga0307412_10062205	3300031911	Bacteria	2512
266	Ga0307409_100013492	3300031995	Bacteria	5262
267	Ga0307409_100169460	3300031995	Bacteria	1920
268	Ga0307409_100330540	3300031995	Bacteria	1430
269	Ga0307416_100000944	3300032002	Bacteria	15391
270	Ga0307416_100026248	3300032002	Bacteria	4288
271	Ga0307416_100047921	3300032002	Bacteria	3386
272	Ga0307416_100139543	3300032002	Bacteria	2200
273	Ga0307416_100172598	3300032002	Bacteria	2015
274	Ga0307416_100186254	3300032002	Bacteria	1951
275	Ga0307416_100197225	3300032002	Bacteria	1906
276	Ga0307416_100363063	3300032002	Bacteria	1471
277	Ga0307414_10009437	3300032004	Bacteria	5606
278	Ga0307414_10040476	3300032004	Bacteria	3148
279	Ga0307414_10070923	3300032004	Bacteria	2511
280	Ga0307411_10031629	3300032005	Bacteria	3259
281	Ga0307411_10033907	3300032005	Bacteria	3171
282	Ga0307411_10083172	3300032005	Bacteria	2210
283	Ga0307415_100034291	3300032126	Bacteria	3303
284	Ga0373929_0007328	3300035085	Bacteria	2012
285	Ga0373940_0020810	3300035088	Bacteria	1670
286	Ga0373940_0060690	3300035088	Bacteria	1081
287	Ga0373932_0007017	3300035112	Bacteria	2676
288	Ga0373941_0010778	3300035115	Bacteria	2345
289	Ga0373960_0037940	3300035121	Bacteria	1379
290	Ga0373942_0010223	3300035207	Bacteria	2205
291	Ga0373961_0045076	3300035241	Bacteria	1289
292	Ga0373962_0045774	3300035242	Bacteria	1247
293	Ga0373931_0290836	3300035691	Bacteria	1006
294	Ga0373925_0454877	3300037068	Bacteria	1049
295	Ga0395901_0155994	3300038443	Bacteria	2398
296	Ga0242420_012001	3300038996	Bacteria	1461
297	Ga0439433_0008648	3300041999	Bacteria	2211
298	Ga0439445_0054873	3300042004	Bacteria	1081
299	Ga0450897_009273	3300042128	Bacteria	929
300	Ga0439446_0041493	3300042156	Bacteria	1357
301	Ga0439435_0029190	3300042436	Bacteria	1487
302	Ga0451577_0015704	3300042876	Bacteria	7032
303	Ga0453684_0110516	3300044712	Bacteria	3340
304	Ga0451576_0005609	3300045051	Bacteria	15677
305	Ga0451576_0014051	3300045051	Bacteria	8921
306	Ga0451576_0022460	3300045051	Bacteria	6841
307	Ga0451576_0286223	3300045051	Bacteria	1723
308	Ga0495603_0005284	3300046455	Bacteria	7698
309	Ga0495621_0095205	3300046539	Bacteria	1127
310	Ga0495656_0032053	3300046615	Bacteria	2136
311	Ga0495670_0079425	3300046691	Bacteria	1670
312	Ga0495636_0282447	3300047318	Bacteria	773
313	Ga0496100_0123206	3300048903	Bacteria	1817
314	Ga0496101_0131677	3300048904	Bacteria	1899
315	Ga0496102_0115729	3300048905	Bacteria	2502
316	Ga0496102_0392157	3300048905	Bacteria	1306
317	Ga0496103_0214151	3300048906	Bacteria	1239
318	Ga0496104_0105726	3300048907	Bacteria	2697
319	Ga0496104_0165655	3300048907	Bacteria	2119
320	Ga0496104_0675434	3300048907	Bacteria	941
321	Ga0496106_0262653	3300048909	Bacteria	1381
322	Ga0496107_0270424	3300048910	Bacteria	1265
323	Ga0496107_0554143	3300048910	Bacteria	851
324	Ga0496108_0002642	3300048911	Bacteria	14363
325	Ga0496109_0014730	3300048912	Bacteria	6804
326	Ga0496109_0597136	3300048912	Bacteria	1040
327	Ga0496110_0062286	3300048913	Bacteria	3294
328	Ga0496111_0114817	3300048914	Bacteria	1985
329	Ga0496112_0009314	3300048915	Bacteria	8834
330	Ga0496112_0015928	3300048915	Bacteria	7026
331	Ga0496113_0000737	3300048916	Bacteria	16807
332	Ga0496113_0014592	3300048916	Bacteria	5365
333	Ga0496114_0065220	3300048917	Bacteria	3051
334	Ga0501290_016313	3300049513	Bacteria	989
335	Ga0501034_0001355	3300049571	Bacteria	33121
336	Ga0501034_0179559	3300049571	Bacteria	2082
337	Ga0501034_0482600	3300049571	Bacteria	1155
338	Ga0501036_0716187	3300049572	Bacteria	827
339	Ga0501038_0254192	3300049574	Bacteria	1391
340	Ga0501042_0077515	3300049578	Bacteria	2380
341	Ga0501048_0281601	3300049582	Bacteria	1182
342	Ga0501067_0001052	3300049583	Bacteria	14855
343	Ga0501067_0002587	3300049583	Bacteria	9997
344	Ga0501067_0007341	3300049583	Bacteria	6124
345	Ga0501067_0009590	3300049583	Bacteria	5362
346	Ga0501067_0156769	3300049583	Bacteria	1268
347	Ga0501068_0009565	3300049584	Bacteria	5428
348	Ga0501068_0020965	3300049584	Bacteria	3813
349	Ga0501069_0000098	3300049585	Bacteria	40879
350	Ga0501069_0020236	3300049585	Bacteria	3604
351	Ga0501069_0068679	3300049585	Bacteria	1983
352	Ga0501070_0005766	3300049586	Bacteria	10562
353	Ga0501070_0018920	3300049586	Bacteria	5777
354	Ga0501070_0027735	3300049586	Bacteria	4751
355	Ga0501071_0000601	3300049587	Bacteria	18620
356	Ga0501071_0369089	3300049587	Bacteria	1093
357	Ga0501071_0398313	3300049587	Bacteria	1051
358	Ga0501071_0551106	3300049587	Bacteria	886
359	Ga0501072_0000081	3300049588	Bacteria	70723
360	Ga0501072_0106320	3300049588	Bacteria	2232
361	Ga0501072_0135845	3300049588	Bacteria	1961
362	Ga0501072_0186208	3300049588	Bacteria	1656
363	Ga0501073_0000699	3300049589	Bacteria	23637
364	Ga0501074_0001663	3300049590	Bacteria	15116
365	Ga0501074_0018819	3300049590	Bacteria	5016
366	Ga0501074_0049880	3300049590	Bacteria	3022
367	Ga0501075_0101514	3300049591	Bacteria	2185
368	Ga0501076_0022678	3300049592	Bacteria	4827
369	Ga0501079_0012441	3300049741	Bacteria	6494
370	Ga0501079_0584706	3300049741	Bacteria	878
371	Ga0501080_0000060	3300049742	Bacteria	71292
372	Ga0501080_0017347	3300049742	Bacteria	6656
373	Ga0501080_0035643	3300049742	Bacteria	4643
374	Ga0501081_0076137	3300049743	Bacteria	2343
375	Ga0501083_0006130	3300049744	Bacteria	8524
376	Ga0501083_0031851	3300049744	Bacteria	3618
377	Ga0501268_010052	3300049765	Bacteria	1465
378	nmdc:mga05p37_122316_c1	3300050507	Bacteria	3196
379	nmdc:mga05p37_210846_c1	3300050507	Bacteria	2348
380	nmdc:mga05p37_393928_c2	3300050507	Bacteria	1311
381	nmdc:mga05p37_460981_c1	3300050507	Bacteria	1469
382	nmdc:mga09592_71793_c1	3300050508	Bacteria	2939
383	nmdc:mga0qj67_106787_c1	3300050509	Bacteria	2259
384	nmdc:mga0qj67_14971_c1	3300050509	Bacteria	5867
385	nmdc:mga06r32_393_c1	3300050510	Bacteria	36896
386	nmdc:mga0n895_1574_c1	3300050512	Bacteria	17176
387	nmdc:mga0n895_160166_c1	3300050512	Bacteria	2282
388	nmdc:mga0n895_190521_c1	3300050512	Bacteria	2082
389	nmdc:mga0n895_34472_c1	3300050512	Bacteria	4873
390	nmdc:mga0rr50_289076_c1	3300050513	Bacteria	1369
391	nmdc:mga0rr50_342828_c1	3300050513	Bacteria	1256
392	nmdc:mga0rr50_55370_c1	3300050513	Bacteria	2959
393	nmdc:mga08x19_273352_c1	3300050514	Bacteria	1170
394	nmdc:mga08x19_2911_c1	3300050514	Bacteria	10296
395	nmdc:mga08x19_374204_c1	3300050514	Bacteria	997
396	nmdc:mga08x19_578864_c1	3300050514	Bacteria	795
397	nmdc:mga0a205_1598_c1	3300050515	Bacteria	19463
398	nmdc:mga0a205_1893_c2	3300050515	Bacteria	9217
399	nmdc:mga0a205_459172_c1	3300050515	Bacteria	1133
400	nmdc:mga0a205_46322_c1	3300050515	Bacteria	4194
401	nmdc:mga0a205_6276_c1	3300050515	Bacteria	7893
402	nmdc:mga0a205_86013_c1	3300050515	Bacteria	3036
403	Ga0501084_0005867	3300054114	Bacteria	10106
404	Ga0501084_0008141	3300054114	Bacteria	8641
405	Ga0501084_0082690	3300054114	Bacteria	2695
406	Ga0590071_001041	3300059421	Bacteria	7529
407	Ga0590074_000469	3300059423	Bacteria	5917
408	Ga0590075_007720	3300059424	Bacteria	2562
409	Ga0590075_011628	3300059424	Bacteria	2130
410	Ga0501082_0019326	3300060353	Bacteria	5871
411	Ga0501082_0035130	3300060353	Bacteria	4320
412	Ga0530510_0467911	3300061734	Bacteria	954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009098	Ga0105245_10733594	Ga0105245_107335942	202
2	3300025932	Ga0207690_10046833	Ga0207690_100468334	202
3	3300031548	Ga0307408_100008964	Ga0307408_1000089642	202
4	3300031731	Ga0307405_10032524	Ga0307405_100325243	202
5	3300031901	Ga0307406_10079051	Ga0307406_100790514	202
6	3300032002	Ga0307416_100000944	Ga0307416_1000009449	202
7	3300035088	Ga0373940_0060690	Ga0373940_0060690_30_638	202
8	3300047318	Ga0495636_0282447	Ga0495636_0282447_35_643	202
9	3300048907	Ga0496104_0165655	Ga0496104_0165655_1461_2069	202
10	3300005471	Ga0070698_100116514	Ga0070698_1001165143	203
11	3300049571	Ga0501034_0482600	Ga0501034_0482600_467_1078	203
12	3300050514	nmdc:mga08x19_578864_c1	nmdc:mga08x19_578864_c1_35_646	203
13	3300006852	Ga0075433_10129287	Ga0075433_101292872	211
14	3300005471	Ga0070698_100004663	Ga0070698_10000466312	212
15	3300006880	Ga0075429_100010080	Ga0075429_1000100803	212
16	3300009147	Ga0114129_10697917	Ga0114129_106979172	212
17	3300050507	nmdc:mga05p37_393928_c2	nmdc:mga05p37_393928_c2_125_880	212
18	3300050508	nmdc:mga09592_71793_c1	nmdc:mga09592_71793_c1_948_1703	212
19	3300006847	Ga0075431_100002659	Ga0075431_1000026595	216
20	3300050510	nmdc:mga06r32_393_c1	nmdc:mga06r32_393_c1_9906_10688	216
21	3300005330	Ga0070690_100032735	Ga0070690_1000327354	220
22	3300005441	Ga0070700_100012422	Ga0070700_1000124226	220
23	3300005615	Ga0070702_100005374	Ga0070702_1000053745	220
24	3300013297	Ga0157378_10168495	Ga0157378_101684952	220
25	3300026075	Ga0207708_10022116	Ga0207708_100221166	220
26	3300045051	Ga0451576_0005609	Ga0451576_0005609_12158_12874	220
27	3300005518	Ga0070699_100000006	Ga0070699_100000006206	221
28	3300006871	Ga0075434_100009189	Ga0075434_10000918911	221
29	3300006914	Ga0075436_100145059	Ga0075436_1001450592	221
30	3300007076	Ga0075435_100005046	Ga0075435_1000050466	221
31	3300045051	Ga0451576_0014051	Ga0451576_0014051_2262_2966	221
32	3300050512	nmdc:mga0n895_1574_c1	nmdc:mga0n895_1574_c1_9508_10212	221
33	3300050513	nmdc:mga0rr50_55370_c1	nmdc:mga0rr50_55370_c1_1077_1781	221
34	3300005545	Ga0070695_100182427	Ga0070695_1001824272	223
35	3300009147	Ga0114129_10095960	Ga0114129_100959604	223
36	3300050507	nmdc:mga05p37_122316_c1	nmdc:mga05p37_122316_c1_1151_1942	223
37	3300050514	nmdc:mga08x19_273352_c1	nmdc:mga08x19_273352_c1_334_1074	223
38	3300050515	nmdc:mga0a205_86013_c1	nmdc:mga0a205_86013_c1_1081_1872	223
39	3300005468	Ga0070707_100209865	Ga0070707_1002098652	224
40	3300005518	Ga0070699_100000036	Ga0070699_100000036129	224
41	3300005536	Ga0070697_100161909	Ga0070697_1001619092	224
42	3300009094	Ga0111539_10014805	Ga0111539_1001480511	224
43	3300037068	Ga0373925_0454877	Ga0373925_0454877_220_894	224
44	3300048903	Ga0496100_0123206	Ga0496100_0123206_684_1358	224
45	3300048912	Ga0496109_0597136	Ga0496109_0597136_318_992	224
46	3300006914	Ga0075436_100254147	Ga0075436_1002541472	225
47	3300026116	Ga0207674_10062056	Ga0207674_100620565	225
48	3300005539	Ga0068853_100247097	Ga0068853_1002470973	226
49	3300025926	Ga0207659_10037367	Ga0207659_100373674	226
50	3300025927	Ga0207687_10439866	Ga0207687_104398662	226
51	3300031901	Ga0307406_10070049	Ga0307406_100700494	226
52	3300031911	Ga0307412_10015145	Ga0307412_100151455	226
53	3300032002	Ga0307416_100139543	Ga0307416_1001395433	226
54	3300046455	Ga0495603_0005284	Ga0495603_0005284_6101_6841	226
55	3300046691	Ga0495670_0079425	Ga0495670_0079425_256_996	226
56	3300005353	Ga0070669_100414002	Ga0070669_1004140022	227
57	3300005440	Ga0070705_100095738	Ga0070705_1000957382	227
58	3300005468	Ga0070707_100009027	Ga0070707_1000090272	227
59	3300005471	Ga0070698_100040069	Ga0070698_1000400693	227
60	3300005549	Ga0070704_100008264	Ga0070704_1000082644	227
61	3300005844	Ga0068862_100080212	Ga0068862_1000802122	227
62	3300025922	Ga0207646_10015549	Ga0207646_100155494	227
63	3300025923	Ga0207681_10400323	Ga0207681_104003232	227
64	3300005577	Ga0068857_100005725	Ga0068857_1000057258	228
65	3300005618	Ga0068864_100000682	Ga0068864_10000068223	228
66	3300011119	Ga0105246_10490457	Ga0105246_104904572	228
67	3300025908	Ga0207643_10011659	Ga0207643_100116593	228
68	3300026095	Ga0207676_10006219	Ga0207676_100062198	228
69	3300026116	Ga0207674_10003334	Ga0207674_1000333412	228
70	3300050514	nmdc:mga08x19_374204_c1	nmdc:mga08x19_374204_c1_292_987	229
71	3300014969	Ga0157376_10459703	Ga0157376_104597031	232
72	3300059424	Ga0590075_007720	Ga0590075_007720_735_1475	233
73	3300005328	Ga0070676_10000437	Ga0070676_1000043711	235
74	3300005330	Ga0070690_100074390	Ga0070690_1000743902	235
75	3300005334	Ga0068869_100014080	Ga0068869_1000140805	235
76	3300005335	Ga0070666_10032479	Ga0070666_100324794	235
77	3300005339	Ga0070660_100040556	Ga0070660_1000405562	235
78	3300005343	Ga0070687_100188850	Ga0070687_1001888501	235
79	3300005353	Ga0070669_100019809	Ga0070669_1000198091	235
80	3300005353	Ga0070669_100146614	Ga0070669_1001466141	235
81	3300005356	Ga0070674_100001291	Ga0070674_10000129112	235
82	3300005364	Ga0070673_100073126	Ga0070673_1000731262	235
83	3300005406	Ga0070703_10015467	Ga0070703_100154672	235
84	3300005441	Ga0070700_100356232	Ga0070700_1003562322	235
85	3300005444	Ga0070694_100215925	Ga0070694_1002159251	235
86	3300005445	Ga0070708_100475299	Ga0070708_1004752992	235
87	3300005456	Ga0070678_100004694	Ga0070678_1000046945	235
88	3300005457	Ga0070662_100005405	Ga0070662_1000054056	235
89	3300005459	Ga0068867_100005955	Ga0068867_1000059555	235
90	3300005467	Ga0070706_100550070	Ga0070706_1005500701	235
91	3300005545	Ga0070695_100005738	Ga0070695_1000057386	235
92	3300005563	Ga0068855_100449222	Ga0068855_1004492222	235
93	3300005578	Ga0068854_100001678	Ga0068854_1000016789	235
94	3300005615	Ga0070702_100004449	Ga0070702_1000044492	235
95	3300005718	Ga0068866_10000546	Ga0068866_1000054612	235
96	3300005719	Ga0068861_100074523	Ga0068861_1000745232	235
97	3300005843	Ga0068860_100024599	Ga0068860_1000245993	235
98	3300005843	Ga0068860_100232324	Ga0068860_1002323242	235
99	3300006237	Ga0097621_100076256	Ga0097621_1000762563	235
100	3300006871	Ga0075434_100155083	Ga0075434_1001550832	235
101	3300006881	Ga0068865_100014434	Ga0068865_1000144343	235
102	3300009093	Ga0105240_10089166	Ga0105240_100891662	235
103	3300009148	Ga0105243_10034261	Ga0105243_100342614	235
104	3300009174	Ga0105241_10019185	Ga0105241_100191856	235
105	3300009176	Ga0105242_10000297	Ga0105242_100002975	235
106	3300009177	Ga0105248_10000630	Ga0105248_1000063011	235
107	3300009553	Ga0105249_10017461	Ga0105249_100174612	235
108	3300010375	Ga0105239_10157532	Ga0105239_101575322	235
109	3300013297	Ga0157378_10019697	Ga0157378_100196974	235
110	3300013306	Ga0163162_10811219	Ga0163162_108112192	235
111	3300013308	Ga0157375_10243746	Ga0157375_102437462	235
112	3300013308	Ga0157375_10874327	Ga0157375_108743272	235
113	3300014326	Ga0157380_10077205	Ga0157380_100772053	235
114	3300014326	Ga0157380_10089068	Ga0157380_100890683	235
115	3300014968	Ga0157379_10121621	Ga0157379_101216213	235
116	3300017792	Ga0163161_10042697	Ga0163161_100426973	235
117	3300025899	Ga0207642_10000820	Ga0207642_100008209	235
118	3300025903	Ga0207680_10021439	Ga0207680_100214392	235
119	3300025907	Ga0207645_10001002	Ga0207645_100010026	235
120	3300025910	Ga0207684_10471593	Ga0207684_104715932	235
121	3300025911	Ga0207654_10075326	Ga0207654_100753262	235
122	3300025917	Ga0207660_10076678	Ga0207660_100766782	235
123	3300025918	Ga0207662_10115853	Ga0207662_101158532	235
124	3300025933	Ga0207706_10000065	Ga0207706_1000006587	235
125	3300025934	Ga0207686_10000382	Ga0207686_1000038221	235
126	3300025935	Ga0207709_10006411	Ga0207709_100064112	235
127	3300025937	Ga0207669_10000606	Ga0207669_100006064	235
128	3300025941	Ga0207711_10001822	Ga0207711_100018225	235
129	3300025942	Ga0207689_10010381	Ga0207689_100103819	235
130	3300025949	Ga0207667_10388646	Ga0207667_103886462	235
131	3300025961	Ga0207712_10003413	Ga0207712_100034138	235
132	3300025981	Ga0207640_10004504	Ga0207640_1000450410	235
133	3300025986	Ga0207658_10040597	Ga0207658_100405973	235
134	3300026035	Ga0207703_10248379	Ga0207703_102483793	235
135	3300026067	Ga0207678_10252862	Ga0207678_102528622	235
136	3300026075	Ga0207708_10061988	Ga0207708_100619884	235
137	3300026089	Ga0207648_10000211	Ga0207648_1000021123	235
138	3300026118	Ga0207675_100030043	Ga0207675_1000300433	235
139	3300026121	Ga0207683_10040457	Ga0207683_100404573	235
140	3300028380	Ga0268265_10056593	Ga0268265_100565932	235
141	3300028380	Ga0268265_10613570	Ga0268265_106135702	235
142	3300028381	Ga0268264_10011521	Ga0268264_100115215	235
143	3300048905	Ga0496102_0115729	Ga0496102_0115729_488_1228	235
144	3300048906	Ga0496103_0214151	Ga0496103_0214151_459_1199	235
145	3300048909	Ga0496106_0262653	Ga0496106_0262653_557_1297	235
146	3300048910	Ga0496107_0270424	Ga0496107_0270424_372_1112	235
147	3300048910	Ga0496107_0554143	Ga0496107_0554143_62_802	235
148	3300048917	Ga0496114_0065220	Ga0496114_0065220_2116_2856	235
149	3300005440	Ga0070705_100093236	Ga0070705_1000932362	238
150	3300005444	Ga0070694_100007601	Ga0070694_1000076015	238
151	3300005468	Ga0070707_100242541	Ga0070707_1002425412	238
152	3300005536	Ga0070697_100003808	Ga0070697_1000038084	238
153	3300005545	Ga0070695_100022573	Ga0070695_1000225734	238
154	3300005545	Ga0070695_100027500	Ga0070695_1000275003	238
155	3300005546	Ga0070696_100002916	Ga0070696_1000029166	238
156	3300005549	Ga0070704_100002995	Ga0070704_1000029955	238
157	3300006871	Ga0075434_100797876	Ga0075434_1007978762	238
158	3300009147	Ga0114129_10496044	Ga0114129_104960442	238
159	3300010159	Ga0099796_10048065	Ga0099796_100480652	238
160	3300025917	Ga0207660_10053829	Ga0207660_100538292	238
161	3300046539	Ga0495621_0095205	Ga0495621_0095205_25_741	238
162	3300046615	Ga0495656_0032053	Ga0495656_0032053_190_906	238
163	3300050507	nmdc:mga05p37_460981_c1	nmdc:mga05p37_460981_c1_309_1025	238
164	3300050512	nmdc:mga0n895_190521_c1	nmdc:mga0n895_190521_c1_953_1690	238
165	3300050515	nmdc:mga0a205_46322_c1	nmdc:mga0a205_46322_c1_257_973	238
166	3300005340	Ga0070689_100327985	Ga0070689_1003279851	240
167	3300005365	Ga0070688_100017042	Ga0070688_1000170424	240
168	3300005459	Ga0068867_100280561	Ga0068867_1002805612	240
169	3300005577	Ga0068857_100727477	Ga0068857_1007274771	240
170	3300005719	Ga0068861_100341746	Ga0068861_1003417462	240
171	3300026089	Ga0207648_10336404	Ga0207648_103364041	240
172	3300026116	Ga0207674_10197315	Ga0207674_101973152	240
173	3300026118	Ga0207675_100066906	Ga0207675_1000669062	240
174	3300042128	Ga0450897_009273	Ga0450897_009273_61_786	240
175	3300005336	Ga0070680_100020481	Ga0070680_1000204815	242
176	3300005341	Ga0070691_10010538	Ga0070691_100105386	242
177	3300005345	Ga0070692_10028965	Ga0070692_100289653	242
178	3300005438	Ga0070701_10002715	Ga0070701_100027158	242
179	3300005440	Ga0070705_100055997	Ga0070705_1000559972	242
180	3300005441	Ga0070700_100022934	Ga0070700_1000229344	242
181	3300005518	Ga0070699_100009622	Ga0070699_1000096226	242
182	3300005545	Ga0070695_100021954	Ga0070695_1000219544	242
183	3300005718	Ga0068866_10040563	Ga0068866_100405632	242
184	3300005840	Ga0068870_10072479	Ga0068870_100724791	242
185	3300005843	Ga0068860_100294779	Ga0068860_1002947792	242
186	3300006028	Ga0070717_10000520	Ga0070717_1000052012	242
187	3300006852	Ga0075433_10194173	Ga0075433_101941733	242
188	3300006871	Ga0075434_100048918	Ga0075434_1000489182	242
189	3300006871	Ga0075434_100153608	Ga0075434_1001536082	242
190	3300007076	Ga0075435_100241018	Ga0075435_1002410182	242
191	3300009094	Ga0111539_10000756	Ga0111539_1000075635	242
192	3300009147	Ga0114129_10195926	Ga0114129_101959263	242
193	3300009148	Ga0105243_10405602	Ga0105243_104056022	242
194	3300009174	Ga0105241_10365138	Ga0105241_103651382	242
195	3300009553	Ga0105249_10509394	Ga0105249_105093942	242
196	3300013307	Ga0157372_10375240	Ga0157372_103752402	242
197	3300014326	Ga0157380_10639433	Ga0157380_106394331	242
198	3300025908	Ga0207643_10037332	Ga0207643_100373322	242
199	3300025917	Ga0207660_10005299	Ga0207660_100052994	242
200	3300025928	Ga0207700_10182208	Ga0207700_101822083	242
201	3300026075	Ga0207708_10026227	Ga0207708_100262274	242
202	3300026089	Ga0207648_10399268	Ga0207648_103992682	242
203	3300027907	Ga0207428_10000945	Ga0207428_1000094518	242
204	3300028380	Ga0268265_10040917	Ga0268265_100409173	242
205	3300028380	Ga0268265_10215570	Ga0268265_102155702	242
206	3300028381	Ga0268264_10244271	Ga0268264_102442712	242
207	3300042876	Ga0451577_0015704	Ga0451577_0015704_1375_2157	242
208	3300044712	Ga0453684_0110516	Ga0453684_0110516_1363_2145	242
209	3300045051	Ga0451576_0022460	Ga0451576_0022460_4685_5467	242
210	3300050507	nmdc:mga05p37_210846_c1	nmdc:mga05p37_210846_c1_773_1555	242
211	3300050512	nmdc:mga0n895_160166_c1	nmdc:mga0n895_160166_c1_712_1494	242
212	3300050512	nmdc:mga0n895_34472_c1	nmdc:mga0n895_34472_c1_2337_3119	242
213	3300050513	nmdc:mga0rr50_342828_c1	nmdc:mga0rr50_342828_c1_145_927	242
214	3300050515	nmdc:mga0a205_1598_c1	nmdc:mga0a205_1598_c1_15780_16562	242
215	3300050515	nmdc:mga0a205_1893_c2	nmdc:mga0a205_1893_c2_5581_6363	242
216	3300050515	nmdc:mga0a205_6276_c1	nmdc:mga0a205_6276_c1_6120_6902	242
217	3300005518	Ga0070699_100000015	Ga0070699_10000001590	244
218	3300005546	Ga0070696_100000314	Ga0070696_1000003146	244
219	3300049572	Ga0501036_0716187	Ga0501036_0716187_37_783	244
220	3300005336	Ga0070680_100013471	Ga0070680_1000134712	245
221	3300005347	Ga0070668_100004574	Ga0070668_1000045744	245
222	3300005353	Ga0070669_100428340	Ga0070669_1004283401	245
223	3300005354	Ga0070675_100044174	Ga0070675_1000441744	245
224	3300005354	Ga0070675_100085204	Ga0070675_1000852043	245
225	3300005406	Ga0070703_10047944	Ga0070703_100479442	245
226	3300005434	Ga0070709_10002860	Ga0070709_100028605	245
227	3300005436	Ga0070713_100120522	Ga0070713_1001205223	245
228	3300005439	Ga0070711_100000763	Ga0070711_1000007639	245
229	3300005441	Ga0070700_100063655	Ga0070700_1000636553	245
230	3300005444	Ga0070694_100001036	Ga0070694_1000010362	245
231	3300005445	Ga0070708_100006777	Ga0070708_1000067779	245
232	3300005445	Ga0070708_100021953	Ga0070708_1000219532	245
233	3300005458	Ga0070681_10269713	Ga0070681_102697132	245
234	3300005467	Ga0070706_100025904	Ga0070706_1000259044	245
235	3300005467	Ga0070706_100323407	Ga0070706_1003234072	245
236	3300005468	Ga0070707_100016656	Ga0070707_1000166563	245
237	3300005471	Ga0070698_100063837	Ga0070698_1000638374	245
238	3300005518	Ga0070699_100107885	Ga0070699_1001078853	245
239	3300005530	Ga0070679_100012367	Ga0070679_1000123676	245
240	3300005536	Ga0070697_100308751	Ga0070697_1003087512	245
241	3300005536	Ga0070697_100409272	Ga0070697_1004092722	245
242	3300005543	Ga0070672_100037573	Ga0070672_1000375733	245
243	3300005543	Ga0070672_100734838	Ga0070672_1007348381	245
244	3300005545	Ga0070695_100000766	Ga0070695_10000076615	245
245	3300005549	Ga0070704_100007933	Ga0070704_1000079334	245
246	3300005549	Ga0070704_100135997	Ga0070704_1001359973	245
247	3300005577	Ga0068857_100124346	Ga0068857_1001243464	245
248	3300005618	Ga0068864_100393884	Ga0068864_1003938842	245
249	3300005841	Ga0068863_100235490	Ga0068863_1002354902	245
250	3300005844	Ga0068862_100061947	Ga0068862_1000619474	245
251	3300006173	Ga0070716_100036586	Ga0070716_1000365863	245
252	3300006173	Ga0070716_100111920	Ga0070716_1001119203	245
253	3300006846	Ga0075430_100052785	Ga0075430_1000527854	245
254	3300006914	Ga0075436_100034721	Ga0075436_1000347214	245
255	3300009177	Ga0105248_10184491	Ga0105248_101844912	245
256	3300014325	Ga0163163_10096077	Ga0163163_100960772	245
257	3300014968	Ga0157379_10032261	Ga0157379_100322614	245
258	3300014969	Ga0157376_10036484	Ga0157376_100364843	245
259	3300025885	Ga0207653_10037087	Ga0207653_100370872	245
260	3300025906	Ga0207699_10004506	Ga0207699_100045062	245
261	3300025910	Ga0207684_10012758	Ga0207684_100127584	245
262	3300025916	Ga0207663_10000529	Ga0207663_100005299	245
263	3300025916	Ga0207663_10189362	Ga0207663_101893623	245
264	3300025917	Ga0207660_10007084	Ga0207660_100070844	245
265	3300025922	Ga0207646_10003953	Ga0207646_1000395312	245
266	3300025922	Ga0207646_10512283	Ga0207646_105122832	245
267	3300025923	Ga0207681_10415611	Ga0207681_104156111	245
268	3300025926	Ga0207659_10126715	Ga0207659_101267152	245
269	3300025928	Ga0207700_10571816	Ga0207700_105718162	245
270	3300025937	Ga0207669_10032456	Ga0207669_100324562	245
271	3300025939	Ga0207665_10002787	Ga0207665_1000278713	245
272	3300025939	Ga0207665_10020492	Ga0207665_100204924	245
273	3300025940	Ga0207691_10021131	Ga0207691_100211314	245
274	3300025940	Ga0207691_10188995	Ga0207691_101889952	245
275	3300025941	Ga0207711_10925684	Ga0207711_109256841	245
276	3300025960	Ga0207651_10072970	Ga0207651_100729702	245
277	3300025972	Ga0207668_10019675	Ga0207668_100196752	245
278	3300026075	Ga0207708_10083365	Ga0207708_100833653	245
279	3300026075	Ga0207708_10397424	Ga0207708_103974242	245
280	3300026088	Ga0207641_10186510	Ga0207641_101865103	245
281	3300026095	Ga0207676_10493005	Ga0207676_104930052	245
282	3300026118	Ga0207675_100243279	Ga0207675_1002432792	245
283	3300027907	Ga0207428_10056053	Ga0207428_100560532	245
284	3300028380	Ga0268265_10069313	Ga0268265_100693132	245
285	3300031731	Ga0307405_10020179	Ga0307405_100201794	245
286	3300031824	Ga0307413_10085677	Ga0307413_100856773	245
287	3300031824	Ga0307413_10106764	Ga0307413_101067642	245
288	3300031824	Ga0307413_10184126	Ga0307413_101841262	245
289	3300031824	Ga0307413_10354681	Ga0307413_103546812	245
290	3300031852	Ga0307410_10011991	Ga0307410_100119913	245
291	3300031852	Ga0307410_10016721	Ga0307410_100167214	245
292	3300031852	Ga0307410_10077806	Ga0307410_100778062	245
293	3300031852	Ga0307410_10084015	Ga0307410_100840151	245
294	3300031852	Ga0307410_10111806	Ga0307410_101118062	245
295	3300031852	Ga0307410_10206885	Ga0307410_102068853	245
296	3300031852	Ga0307410_10269239	Ga0307410_102692392	245
297	3300031901	Ga0307406_10099049	Ga0307406_100990493	245
298	3300031901	Ga0307406_10099111	Ga0307406_100991113	245
299	3300031903	Ga0307407_10195937	Ga0307407_101959372	245
300	3300031911	Ga0307412_10047820	Ga0307412_100478203	245
301	3300031911	Ga0307412_10062205	Ga0307412_100622052	245
302	3300031995	Ga0307409_100013492	Ga0307409_1000134924	245
303	3300031995	Ga0307409_100169460	Ga0307409_1001694602	245
304	3300031995	Ga0307409_100330540	Ga0307409_1003305402	245
305	3300032002	Ga0307416_100026248	Ga0307416_1000262483	245
306	3300032002	Ga0307416_100047921	Ga0307416_1000479212	245
307	3300032002	Ga0307416_100172598	Ga0307416_1001725982	245
308	3300032002	Ga0307416_100186254	Ga0307416_1001862543	245
309	3300032002	Ga0307416_100197225	Ga0307416_1001972252	245
310	3300032002	Ga0307416_100363063	Ga0307416_1003630632	245
311	3300032004	Ga0307414_10009437	Ga0307414_100094373	245
312	3300032004	Ga0307414_10040476	Ga0307414_100404763	245
313	3300032004	Ga0307414_10070923	Ga0307414_100709233	245
314	3300032005	Ga0307411_10031629	Ga0307411_100316292	245
315	3300032005	Ga0307411_10033907	Ga0307411_100339073	245
316	3300032005	Ga0307411_10083172	Ga0307411_100831723	245
317	3300032126	Ga0307415_100034291	Ga0307415_1000342913	245
318	3300035085	Ga0373929_0007328	Ga0373929_0007328_843_1583	245
319	3300035088	Ga0373940_0020810	Ga0373940_0020810_144_884	245
320	3300035112	Ga0373932_0007017	Ga0373932_0007017_570_1310	245
321	3300035115	Ga0373941_0010778	Ga0373941_0010778_342_1082	245
322	3300035121	Ga0373960_0037940	Ga0373960_0037940_71_811	245
323	3300035207	Ga0373942_0010223	Ga0373942_0010223_256_996	245
324	3300035241	Ga0373961_0045076	Ga0373961_0045076_21_761	245
325	3300035242	Ga0373962_0045774	Ga0373962_0045774_56_796	245
326	3300035691	Ga0373931_0290836	Ga0373931_0290836_165_905	245
327	3300038443	Ga0395901_0155994	Ga0395901_0155994_555_1295	245
328	3300038996	Ga0242420_012001	Ga0242420_012001_681_1421	245
329	3300041999	Ga0439433_0008648	Ga0439433_0008648_1398_2144	245
330	3300042004	Ga0439445_0054873	Ga0439445_0054873_194_934	245
331	3300042156	Ga0439446_0041493	Ga0439446_0041493_409_1155	245
332	3300042436	Ga0439435_0029190	Ga0439435_0029190_726_1466	245
333	3300045051	Ga0451576_0286223	Ga0451576_0286223_196_936	245
334	3300048904	Ga0496101_0131677	Ga0496101_0131677_502_1242	245
335	3300048905	Ga0496102_0392157	Ga0496102_0392157_186_926	245
336	3300048907	Ga0496104_0105726	Ga0496104_0105726_312_1052	245
337	3300048907	Ga0496104_0675434	Ga0496104_0675434_49_789	245
338	3300048911	Ga0496108_0002642	Ga0496108_0002642_10044_10784	245
339	3300048912	Ga0496109_0014730	Ga0496109_0014730_3504_4244	245
340	3300048913	Ga0496110_0062286	Ga0496110_0062286_1759_2499	245
341	3300048914	Ga0496111_0114817	Ga0496111_0114817_1066_1806	245
342	3300048915	Ga0496112_0009314	Ga0496112_0009314_1172_1912	245
343	3300048915	Ga0496112_0015928	Ga0496112_0015928_3726_4466	245
344	3300048916	Ga0496113_0000737	Ga0496113_0000737_15894_16634	245
345	3300048916	Ga0496113_0014592	Ga0496113_0014592_1553_2293	245
346	3300049513	Ga0501290_016313	Ga0501290_016313_135_875	245
347	3300049571	Ga0501034_0001355	Ga0501034_0001355_10138_10878	245
348	3300049571	Ga0501034_0179559	Ga0501034_0179559_1002_1742	245
349	3300049574	Ga0501038_0254192	Ga0501038_0254192_89_829	245
350	3300049578	Ga0501042_0077515	Ga0501042_0077515_312_1055	245
351	3300049582	Ga0501048_0281601	Ga0501048_0281601_94_837	245
352	3300049583	Ga0501067_0001052	Ga0501067_0001052_12709_13449	245
353	3300049583	Ga0501067_0002587	Ga0501067_0002587_3531_4271	245
354	3300049583	Ga0501067_0007341	Ga0501067_0007341_1323_2063	245
355	3300049583	Ga0501067_0009590	Ga0501067_0009590_1818_2558	245
356	3300049583	Ga0501067_0156769	Ga0501067_0156769_120_860	245
357	3300049584	Ga0501068_0009565	Ga0501068_0009565_3079_3819	245
358	3300049584	Ga0501068_0020965	Ga0501068_0020965_638_1378	245
359	3300049585	Ga0501069_0000098	Ga0501069_0000098_3320_4060	245
360	3300049585	Ga0501069_0020236	Ga0501069_0020236_2781_3521	245
361	3300049585	Ga0501069_0068679	Ga0501069_0068679_536_1276	245
362	3300049586	Ga0501070_0005766	Ga0501070_0005766_6715_7455	245
363	3300049586	Ga0501070_0018920	Ga0501070_0018920_3075_3815	245
364	3300049586	Ga0501070_0027735	Ga0501070_0027735_3670_4410	245
365	3300049587	Ga0501071_0000601	Ga0501071_0000601_3074_3814	245
366	3300049587	Ga0501071_0369089	Ga0501071_0369089_93_833	245
367	3300049587	Ga0501071_0398313	Ga0501071_0398313_270_1010	245
368	3300049587	Ga0501071_0551106	Ga0501071_0551106_132_872	245
369	3300049588	Ga0501072_0000081	Ga0501072_0000081_41468_42208	245
370	3300049588	Ga0501072_0106320	Ga0501072_0106320_1393_2145	245
371	3300049588	Ga0501072_0135845	Ga0501072_0135845_307_1047	245
372	3300049588	Ga0501072_0186208	Ga0501072_0186208_656_1396	245
373	3300049589	Ga0501073_0000699	Ga0501073_0000699_21746_22486	245
374	3300049590	Ga0501074_0001663	Ga0501074_0001663_13896_14636	245
375	3300049590	Ga0501074_0018819	Ga0501074_0018819_1199_1939	245
376	3300049590	Ga0501074_0049880	Ga0501074_0049880_155_898	245
377	3300049591	Ga0501075_0101514	Ga0501075_0101514_594_1337	245
378	3300049592	Ga0501076_0022678	Ga0501076_0022678_4017_4757	245
379	3300049741	Ga0501079_0012441	Ga0501079_0012441_1639_2379	245
380	3300049741	Ga0501079_0584706	Ga0501079_0584706_19_765	245
381	3300049742	Ga0501080_0000060	Ga0501080_0000060_58900_59640	245
382	3300049742	Ga0501080_0017347	Ga0501080_0017347_3615_4355	245
383	3300049742	Ga0501080_0035643	Ga0501080_0035643_1446_2186	245
384	3300049743	Ga0501081_0076137	Ga0501081_0076137_1257_1997	245
385	3300049744	Ga0501083_0006130	Ga0501083_0006130_3455_4195	245
386	3300049744	Ga0501083_0031851	Ga0501083_0031851_2755_3495	245
387	3300049765	Ga0501268_010052	Ga0501268_010052_434_1174	245
388	3300050509	nmdc:mga0qj67_106787_c1	nmdc:mga0qj67_106787_c1_1217_1966	245
389	3300050513	nmdc:mga0rr50_289076_c1	nmdc:mga0rr50_289076_c1_354_1094	245
390	3300050514	nmdc:mga08x19_2911_c1	nmdc:mga08x19_2911_c1_5006_5746	245
391	3300050515	nmdc:mga0a205_459172_c1	nmdc:mga0a205_459172_c1_158_898	245
392	3300054114	Ga0501084_0005867	Ga0501084_0005867_6096_6836	245
393	3300054114	Ga0501084_0008141	Ga0501084_0008141_4808_5548	245
394	3300054114	Ga0501084_0082690	Ga0501084_0082690_1894_2634	245
395	3300059421	Ga0590071_001041	Ga0590071_001041_3989_4729	245
396	3300059423	Ga0590074_000469	Ga0590074_000469_2795_3535	245
397	3300059424	Ga0590075_011628	Ga0590075_011628_1137_1877	245
398	3300060353	Ga0501082_0019326	Ga0501082_0019326_3072_3812	245
399	3300060353	Ga0501082_0035130	Ga0501082_0035130_1784_2524	245
400	3300061734	Ga0530510_0467911	Ga0530510_0467911_201_941	245
401	3300003322	rootL2_10047888	rootL2_100478882	246
402	3300005471	Ga0070698_100174743	Ga0070698_1001747433	246
403	3300005536	Ga0070697_100482269	Ga0070697_1004822692	246
404	3300005841	Ga0068863_100010948	Ga0068863_1000109485	246
405	3300006846	Ga0075430_100009200	Ga0075430_1000092007	246
406	3300006847	Ga0075431_100152825	Ga0075431_1001528252	246
407	3300006880	Ga0075429_100078624	Ga0075429_1000786242	246
408	3300014325	Ga0163163_10024179	Ga0163163_100241799	246
409	3300014968	Ga0157379_10335171	Ga0157379_103351712	246
410	3300025986	Ga0207658_10068570	Ga0207658_100685702	246
411	3300026088	Ga0207641_10032086	Ga0207641_100320863	246
412	3300050509	nmdc:mga0qj67_14971_c1	nmdc:mga0qj67_14971_c1_2275_3018	246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

35

255

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4onc-assembly1.cif.gz_A	crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640	0.9422	14	234
1x07-assembly1.cif.gz_A	crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp	0.9411	15	237
2vg3-assembly1.cif.gz_A	rv2361 with citronellyl pyrophosphate	0.9392	14	240
6szg-assembly1.cif.gz_A	acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513	0.9383	13	233
1x09-assembly1.cif.gz_A	crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate	0.9374	14	236

ID	Description	Score	Start	End	Superfamily
2vg2A01	Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like	0.9376	14	236	3.40.1180.10
af_K7KA63_68_310_3.40.1180.10	Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like	0.9362	14	241	3.40.1180.10
2dtnB00	Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like	0.936	17	241	3.40.1180.10
af_O14171_12_259_3.40.1180.10	Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like	0.9309	2	234	3.40.1180.10
af_Q54EN3_89_346_3.40.1180.10	Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like	0.9298	2	234	3.40.1180.10

ID	Description	Score	Start	End	GO Terms
AF-A0A660X6L6-F1-model_v4	deleted	0.9777	2	145
AF-A0A2E0GQ45-F1-model_v4	Di-trans,poly-cis-decaprenylcistransferase	0.9754	14	151	GO:0016094 GO:0045547
AF-A0A1B2ZBN4-F1-model_v4	UDP pyrophosphate synthase	0.9754	12	129	GO:0016094 GO:0045547
AF-A0A2S9REF4-F1-model_v4	deleted	0.9736	14	143
AF-A0A3C0PPZ8-F1-model_v4	Di-trans,poly-cis-decaprenylcistransferase	0.9674	12	128	GO:0016094 GO:0045547

Feature Viewer

pLDDT	pTM	Quality
87.8	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F437735

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

35

255

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map