F437795

General Info

Members Datasets Scaffolds Average Seq Length
412 179 824 161

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10284539|Ga0105248_102845393
Length 178
Sequence MLEADISKRRGKCVIFHFSIAADDPKRTATMLAELWRGEAFYFPMVGEGSWVAHAGDDRRSTIEVYPRDLALYPADGQGEQRSEPVSRHSAFHAAVATPLGIEEVEEIGRRYGCHTVICQRGPFRVIEFWVDNCLMLEMLTPEMQAEYQRSVTPHGWRAMLANVWKMTPDGEPIEDAA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.8
Rhizosphere 93.2
Stem 0
Stem Tuber 0
Unclassified 8.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10284539 3300009177 Bacteria 1861
2 JGI24752J21851_1016986 3300001976 Bacteria 948
3 JGI24740J21852_10002306 3300001979 Bacteria 8681
4 JGI24739J22299_10058361 3300001989 Unclassified 1225
5 JGI24737J22298_10005893 3300001990 Bacteria 4219
6 JGI24737J22298_10015228 3300001990 Bacteria 2490
7 JGI24743J22301_10119299 3300001991 Bacteria 577
8 JGI24735J21928_10119160 3300002067 Unclassified 759
9 JGI24738J21930_10042307 3300002075 Unclassified 925
10 JGI24738J21930_10096253 3300002075 Unclassified 629
11 JGI24744J21845_10000222 3300002077 Bacteria 9013
12 Ga0070658_10078726 3300005327 Bacteria 2706
13 Ga0070658_10081278 3300005327 Bacteria 2662
14 Ga0070658_10452126 3300005327 Bacteria 1107
15 Ga0070658_10539861 3300005327 Bacteria 1009
16 Ga0070690_100006041 3300005330 Bacteria 6847
17 Ga0070670_100054947 3300005331 Bacteria 3418
18 Ga0070677_10093428 3300005333 Bacteria 1313
19 Ga0068869_100121584 3300005334 Bacteria 1997
20 Ga0068869_100455030 3300005334 Unclassified 1061
21 Ga0070666_10165085 3300005335 Bacteria 1549
22 Ga0070666_10207165 3300005335 Bacteria 1380
23 Ga0070680_100000707 3300005336 Bacteria 23165
24 Ga0070680_100037122 3300005336 Bacteria 3937
25 Ga0070682_100708658 3300005337 Bacteria 808
26 Ga0068868_100171436 3300005338 Bacteria 1796
27 Ga0068868_100294213 3300005338 Bacteria 1377
28 Ga0070660_100027318 3300005339 Bacteria 4258
29 Ga0070660_100066632 3300005339 Bacteria 2804
30 Ga0070660_100373378 3300005339 Bacteria 1177
31 Ga0070661_100108949 3300005344 Bacteria 2067
32 Ga0070661_100218401 3300005344 Bacteria 1461
33 Ga0070661_100289905 3300005344 Bacteria 1271
34 Ga0070661_100498915 3300005344 Bacteria 974
35 Ga0070661_100927850 3300005344 Unclassified 720
36 Ga0070668_100717615 3300005347 Bacteria 883
37 Ga0070675_100931662 3300005354 Bacteria 797
38 Ga0070671_100302961 3300005355 Bacteria 1361
39 Ga0070674_100009731 3300005356 Bacteria 5773
40 Ga0070674_100014920 3300005356 Bacteria 4838
41 Ga0070673_100114921 3300005364 Bacteria 2237
42 Ga0070673_100248513 3300005364 Bacteria 1549
43 Ga0070673_100838161 3300005364 Bacteria 850
44 Ga0070659_100052040 3300005366 Bacteria 3220
45 Ga0070659_100058250 3300005366 Bacteria 3048
46 Ga0070659_100114460 3300005366 Bacteria 2179
47 Ga0070659_100170905 3300005366 Bacteria 1780
48 Ga0070659_100175155 3300005366 Bacteria 1759
49 Ga0070659_100394502 3300005366 Bacteria 1167
50 Ga0070659_100500677 3300005366 Bacteria 1035
51 Ga0070667_100029816 3300005367 Bacteria 4548
52 Ga0070667_101016810 3300005367 Unclassified 773
53 Ga0070714_100023725 3300005435 Bacteria 5044
54 Ga0070701_10641521 3300005438 Unclassified 708
55 Ga0070663_100134040 3300005455 Bacteria 1884
56 Ga0070663_101465251 3300005455 Unclassified 606
57 Ga0070678_100131598 3300005456 Bacteria 1988
58 Ga0070662_100061324 3300005457 Bacteria 2745
59 Ga0070662_100287888 3300005457 Bacteria 1331
60 Ga0070662_100376066 3300005457 Bacteria 1168
61 Ga0070662_100421555 3300005457 Bacteria 1104
62 Ga0070662_100433067 3300005457 Unclassified 1089
63 Ga0070662_100548365 3300005457 Unclassified 969
64 Ga0070681_10002173 3300005458 Bacteria 17844
65 Ga0070681_10073884 3300005458 Bacteria 3371
66 Ga0070681_10632631 3300005458 Bacteria 985
67 Ga0068867_100077582 3300005459 Bacteria 2497
68 Ga0068867_100085275 3300005459 Bacteria 2388
69 Ga0068867_100107706 3300005459 Bacteria 2136
70 Ga0070679_100204911 3300005530 Bacteria 1937
71 Ga0070679_100514003 3300005530 Bacteria 1141
72 Ga0068853_100016257 3300005539 Bacteria 6123
73 Ga0068853_100828295 3300005539 Bacteria 887
74 Ga0068853_100933463 3300005539 Unclassified 834
75 Ga0070672_100002875 3300005543 Bacteria 11069
76 Ga0070672_100046929 3300005543 Bacteria 3349
77 Ga0070686_100416308 3300005544 Bacteria 1025
78 Ga0070693_100031831 3300005547 Bacteria 2895
79 Ga0070693_100093802 3300005547 Bacteria 1815
80 Ga0070665_100160375 3300005548 Bacteria 2251
81 Ga0070665_100239255 3300005548 Bacteria 1816
82 Ga0070665_100468317 3300005548 Bacteria 1270
83 Ga0070664_100082732 3300005564 Bacteria 2769
84 Ga0070664_100098404 3300005564 Bacteria 2541
85 Ga0070664_100116836 3300005564 Bacteria 2333
86 Ga0070664_100397159 3300005564 Bacteria 1260
87 Ga0070664_100479478 3300005564 Bacteria 1144
88 Ga0070664_100579316 3300005564 Bacteria 1039
89 Ga0070664_100755026 3300005564 Unclassified 908
90 Ga0068857_100327016 3300005577 Bacteria 1416
91 Ga0068857_100363023 3300005577 Bacteria 1343
92 Ga0068857_100392935 3300005577 Bacteria 1290
93 Ga0068857_100873078 3300005577 Bacteria 862
94 Ga0068857_101159181 3300005577 Unclassified 747
95 Ga0068854_100125427 3300005578 Bacteria 1954
96 Ga0068854_100204230 3300005578 Bacteria 1555
97 Ga0068854_100229562 3300005578 Bacteria 1472
98 Ga0068856_100370804 3300005614 Bacteria 1450
99 Ga0068856_100377575 3300005614 Bacteria 1436
100 Ga0068852_100013358 3300005616 Bacteria 6285
101 Ga0068852_100050939 3300005616 Bacteria 3551
102 Ga0068852_100669960 3300005616 Bacteria 1046
103 Ga0068859_100115028 3300005617 Bacteria 2754
104 Ga0068864_100005969 3300005618 Bacteria 9993
105 Ga0068864_100836980 3300005618 Bacteria 906
106 Ga0068866_10013908 3300005718 Bacteria 3541
107 Ga0068866_10097339 3300005718 Bacteria 1616
108 Ga0068851_10010542 3300005834 Bacteria 4315
109 Ga0068870_10411998 3300005840 Bacteria 882
110 Ga0068863_100046956 3300005841 Bacteria 4098
111 Ga0068863_100098295 3300005841 Bacteria 2780
112 Ga0068858_101016730 3300005842 Unclassified 812
113 Ga0068860_100285870 3300005843 Bacteria 1613
114 Ga0068862_101345873 3300005844 Bacteria 716
115 Ga0097621_100038120 3300006237 Bacteria 3856
116 Ga0097621_100210687 3300006237 Bacteria 1691
117 Ga0068871_100013320 3300006358 Bacteria 6101
118 Ga0068865_100096821 3300006881 Bacteria 2152
119 Ga0097620_100115034 3300006931 Bacteria 2754
120 Ga0105240_10448523 3300009093 Bacteria 1444
121 Ga0105240_11653036 3300009093 Bacteria 669
122 Ga0105245_10076536 3300009098 Bacteria 3048
123 Ga0105245_10163649 3300009098 Bacteria 2113
124 Ga0105247_11029781 3300009101 Archaea 645
125 Ga0105243_10649807 3300009148 Bacteria 1022
126 Ga0105243_10943956 3300009148 Bacteria 861
127 Ga0105241_10557120 3300009174 Bacteria 1030
128 Ga0105242_10726657 3300009176 Bacteria 975
129 Ga0105242_11239699 3300009176 Bacteria 767
130 Ga0105248_10081585 3300009177 Bacteria 3635
131 Ga0105248_11332916 3300009177 Archaea 812
132 Ga0105238_10564648 3300009551 Bacteria 1143
133 Ga0105239_10333063 3300010375 Bacteria 1712
134 Ga0105246_10667434 3300011119 Bacteria 907
135 Ga0157373_10003364 3300013100 Bacteria 12090
136 Ga0157373_10107037 3300013100 Bacteria 1966
137 Ga0157373_10186788 3300013100 Bacteria 1460
138 Ga0157373_10675454 3300013100 Bacteria 756
139 Ga0157371_10079041 3300013102 Bacteria 2330
140 Ga0157371_10126550 3300013102 Bacteria 1817
141 Ga0157371_10131769 3300013102 Bacteria 1779
142 Ga0157371_10146891 3300013102 Bacteria 1680
143 Ga0157371_11027364 3300013102 Unclassified 630
144 Ga0157370_10035182 3300013104 Bacteria 4871
145 Ga0157370_10075851 3300013104 Bacteria 3169
146 Ga0157370_10206120 3300013104 Bacteria 1823
147 Ga0157369_10017175 3300013105 Bacteria 8130
148 Ga0157369_10346587 3300013105 Bacteria 1543
149 Ga0157369_11036215 3300013105 Bacteria 840
150 Ga0157374_10365365 3300013296 Bacteria 1436
151 Ga0157378_10010589 3300013297 Bacteria 8059
152 Ga0157378_10390717 3300013297 Unclassified 1368
153 Ga0163162_10177152 3300013306 Bacteria 2258
154 Ga0163162_10677376 3300013306 Bacteria 1154
155 Ga0157372_10120441 3300013307 Bacteria 3013
156 Ga0157375_10367709 3300013308 Bacteria 1604
157 Ga0157376_10330709 3300014969 Bacteria 1452
158 Ga0207697_10031299 3300025315 Bacteria 2176
159 Ga0207697_10091591 3300025315 Bacteria 1288
160 Ga0207656_10016776 3300025321 Bacteria 2856
161 Ga0207682_10016933 3300025893 Bacteria 2845
162 Ga0207682_10205013 3300025893 Bacteria 908
163 Ga0207642_10650266 3300025899 Archaea 660
164 Ga0207688_10191240 3300025901 Bacteria 1224
165 Ga0207688_10193272 3300025901 Bacteria 1218
166 Ga0207680_10046664 3300025903 Bacteria 2562
167 Ga0207680_10375993 3300025903 Bacteria 1001
168 Ga0207647_10055626 3300025904 Bacteria 2431
169 Ga0207647_10073717 3300025904 Unclassified 2057
170 Ga0207647_10111444 3300025904 Bacteria 1617
171 Ga0207647_10510617 3300025904 Bacteria 669
172 Ga0207645_10305385 3300025907 Bacteria 1060
173 Ga0207645_10319197 3300025907 Unclassified 1036
174 Ga0207645_10639111 3300025907 Bacteria 723
175 Ga0207705_10004738 3300025909 Bacteria 10245
176 Ga0207705_10029237 3300025909 Bacteria 3928
177 Ga0207705_10045610 3300025909 Bacteria 3150
178 Ga0207705_10063287 3300025909 Bacteria 2673
179 Ga0207705_10095440 3300025909 Bacteria 2182
180 Ga0207705_10567015 3300025909 Bacteria 883
181 Ga0207654_10675103 3300025911 Bacteria 741
182 Ga0207707_10273356 3300025912 Bacteria 1464
183 Ga0207695_10742767 3300025913 Unclassified 862
184 Ga0207660_10003425 3300025917 Bacteria 10344
185 Ga0207660_10614150 3300025917 Bacteria 886
186 Ga0207657_10000576 3300025919 Bacteria 38985
187 Ga0207657_10011758 3300025919 Bacteria 8670
188 Ga0207657_10038469 3300025919 Bacteria 4258
189 Ga0207657_10057919 3300025919 Bacteria 3337
190 Ga0207657_10085686 3300025919 Bacteria 2638
191 Ga0207657_10107237 3300025919 Bacteria 2311
192 Ga0207657_10229627 3300025919 Bacteria 1484
193 Ga0207657_10433756 3300025919 Bacteria 1032
194 Ga0207649_10077718 3300025920 Bacteria 2139
195 Ga0207649_10114875 3300025920 Bacteria 1805
196 Ga0207649_10169915 3300025920 Bacteria 1518
197 Ga0207652_10126263 3300025921 Bacteria 2279
198 Ga0207652_10154425 3300025921 Bacteria 2056
199 Ga0207652_10269983 3300025921 Bacteria 1534
200 Ga0207652_10400978 3300025921 Bacteria 1238
201 Ga0207681_10101435 3300025923 Bacteria 2076
202 Ga0207681_10136743 3300025923 Bacteria 1820
203 Ga0207681_10872921 3300025923 Bacteria 753
204 Ga0207694_10024367 3300025924 Bacteria 4595
205 Ga0207650_10043156 3300025925 Bacteria 3309
206 Ga0207659_10150238 3300025926 Bacteria 1818
207 Ga0207659_10982830 3300025926 Bacteria 726
208 Ga0207687_10445021 3300025927 Unclassified 1074
209 Ga0207664_10193157 3300025929 Bacteria 1753
210 Ga0207644_10002273 3300025931 Bacteria 12456
211 Ga0207644_10223582 3300025931 Bacteria 1493
212 Ga0207644_10246326 3300025931 Bacteria 1424
213 Ga0207644_10291826 3300025931 Bacteria 1312
214 Ga0207690_10001625 3300025932 Bacteria 13970
215 Ga0207690_10016520 3300025932 Bacteria 4492
216 Ga0207690_10037062 3300025932 Bacteria 3164
217 Ga0207690_10080488 3300025932 Bacteria 2273
218 Ga0207690_10255187 3300025932 Bacteria 1356
219 Ga0207690_10458203 3300025932 Bacteria 1026
220 Ga0207690_10479409 3300025932 Bacteria 1004
221 Ga0207690_10534377 3300025932 Bacteria 952
222 Ga0207706_10005821 3300025933 Bacteria 11466
223 Ga0207706_10008262 3300025933 Bacteria 9605
224 Ga0207706_10008548 3300025933 Bacteria 9434
225 Ga0207706_10156017 3300025933 Bacteria 2007
226 Ga0207706_10183358 3300025933 Bacteria 1838
227 Ga0207706_10426894 3300025933 Bacteria 1148
228 Ga0207706_11096006 3300025933 Bacteria 665
229 Ga0207686_10556653 3300025934 Archaea 897
230 Ga0207709_10101095 3300025935 Bacteria 1906
231 Ga0207669_10003464 3300025937 Bacteria 6821
232 Ga0207704_10321290 3300025938 Bacteria 1194
233 Ga0207691_10058280 3300025940 Bacteria 3513
234 Ga0207691_10106319 3300025940 Bacteria 2500
235 Ga0207691_10403024 3300025940 Bacteria 1167
236 Ga0207711_10061318 3300025941 Bacteria 3243
237 Ga0207711_10216605 3300025941 Bacteria 1750
238 Ga0207711_10246800 3300025941 Bacteria 1638
239 Ga0207689_10536356 3300025942 Unclassified 982
240 Ga0207689_10543294 3300025942 Unclassified 976
241 Ga0207679_10081282 3300025945 Bacteria 2477
242 Ga0207679_10128946 3300025945 Bacteria 2026
243 Ga0207679_10193426 3300025945 Bacteria 1693
244 Ga0207651_10003862 3300025960 Bacteria 7438
245 Ga0207651_10491310 3300025960 Unclassified 1059
246 Ga0207651_10955802 3300025960 Bacteria 764
247 Ga0207668_11005718 3300025972 Bacteria 745
248 Ga0207640_10116748 3300025981 Bacteria 1903
249 Ga0207640_11449234 3300025981 Unclassified 616
250 Ga0207658_10024109 3300025986 Bacteria 4252
251 Ga0207658_10703672 3300025986 Bacteria 913
252 Ga0207677_10024538 3300026023 Bacteria 3747
253 Ga0207677_10820630 3300026023 Bacteria 834
254 Ga0207703_10225027 3300026035 Bacteria 1679
255 Ga0207678_10005230 3300026067 Bacteria 11626
256 Ga0207678_10049165 3300026067 Bacteria 3644
257 Ga0207678_10604868 3300026067 Unclassified 961
258 Ga0207678_11024072 3300026067 Bacteria 731
259 Ga0207702_10012501 3300026078 Bacteria 7061
260 Ga0207702_10026160 3300026078 Bacteria 4843
261 Ga0207702_10233851 3300026078 Bacteria 1719
262 Ga0207641_10033857 3300026088 Bacteria 4246
263 Ga0207648_10002037 3300026089 Bacteria 22055
264 Ga0207648_10017076 3300026089 Bacteria 6616
265 Ga0207676_10266993 3300026095 Bacteria 1548
266 Ga0207674_10003946 3300026116 Bacteria 18051
267 Ga0207674_10019952 3300026116 Bacteria 7253
268 Ga0207674_10089175 3300026116 Bacteria 3077
269 Ga0207683_10002018 3300026121 Bacteria 17961
270 Ga0207683_10029068 3300026121 Bacteria 4783
271 Ga0207698_10006272 3300026142 Bacteria 7400
272 Ga0268266_10255548 3300028379 Bacteria 1622
273 Ga0268266_10516857 3300028379 Bacteria 1141
274 Ga0268264_10273390 3300028381 Bacteria 1579
275 Ga0307408_100415574 3300031548 Bacteria 1158
276 Ga0307405_10022244 3300031731 Bacteria 3581
277 Ga0307413_10116570 3300031824 Bacteria 1800
278 Ga0307413_10262846 3300031824 Bacteria 1287
279 Ga0307410_10333156 3300031852 Bacteria 1207
280 Ga0307406_10102657 3300031901 Bacteria 1951
281 Ga0307412_10710892 3300031911 Bacteria 863
282 Ga0307409_100517991 3300031995 Bacteria 1164
283 Ga0307416_100367939 3300032002 Bacteria 1462
284 Ga0307414_10274562 3300032004 Bacteria 1413
285 Ga0307411_10264777 3300032005 Bacteria 1359
286 Ga0307415_100044647 3300032126 Bacteria 2964
287 Ga0307415_101083417 3300032126 Bacteria 749
288 Ga0373960_0039575 3300035121 Bacteria 1357
289 Ga0373942_0109657 3300035207 Archaea 852
290 Ga0373961_0260841 3300035241 Unclassified 630
291 Ga0373931_0121019 3300035691 Bacteria 1496
292 Ga0373937_0896054 3300036401 Unclassified 836
293 Ga0395899_0000365 3300037312 Bacteria 54914
294 Ga0395899_0015489 3300037312 Bacteria 5812
295 Ga0395899_0549555 3300037312 Bacteria 742
296 Ga0395899_0805079 3300037312 Unclassified 580
297 Ga0395900_0000093 3300037418 Bacteria 166505
298 Ga0395900_0003442 3300037418 Bacteria 17112
299 Ga0395900_0011711 3300037418 Bacteria 8969
300 Ga0395900_0083969 3300037418 Bacteria 3272
301 Ga0395900_0148568 3300037418 Bacteria 2395
302 Ga0395900_0393252 3300037418 Bacteria 1352
303 Ga0395900_0431069 3300037418 Bacteria 1278
304 Ga0395900_0765352 3300037418 Bacteria 895
305 Ga0395900_1286916 3300037418 Unclassified 645
306 Ga0395898_0000053 3300037466 Bacteria 279600
307 Ga0395898_0001500 3300037466 Bacteria 32350
308 Ga0395898_0456099 3300037466 Bacteria 1217
309 Ga0395898_0812844 3300037466 Bacteria 875
310 Ga0395905_0000031 3300037471 Bacteria 286757
311 Ga0395905_0003933 3300037471 Bacteria 15633
312 Ga0395905_0004217 3300037471 Bacteria 15031
313 Ga0395905_0043181 3300037471 Bacteria 4229
314 Ga0395905_0130037 3300037471 Bacteria 2368
315 Ga0395905_0167382 3300037471 Bacteria 2065
316 Ga0395905_0207232 3300037471 Bacteria 1837
317 Ga0395905_0510856 3300037471 Bacteria 1102
318 Ga0395905_0857078 3300037471 Bacteria 811
319 Ga0395901_0001291 3300038443 Bacteria 26477
320 Ga0395901_0003232 3300038443 Bacteria 16388
321 Ga0395901_0019432 3300038443 Bacteria 6947
322 Ga0395901_0073888 3300038443 Bacteria 3556
323 Ga0395901_0129392 3300038443 Bacteria 2653
324 Ga0395901_0166196 3300038443 Bacteria 2317
325 Ga0395901_0208691 3300038443 Bacteria 2045
326 Ga0395901_0303550 3300038443 Bacteria 1655
327 Ga0395901_0310892 3300038443 Bacteria 1632
328 Ga0395901_0438896 3300038443 Bacteria 1337
329 Ga0395901_1240846 3300038443 Bacteria 709
330 Ga0395901_1478575 3300038443 Unclassified 636
331 Ga0439432_159421 3300042006 Bacteria 660
332 Ga0439449_0085314 3300042007 Bacteria 1165
333 Ga0466972_0271455 3300044658 Unclassified 792
334 Ga0466966_0021581 3300044684 Unclassified 4229
335 Ga0466961_0006233 3300044693 Bacteria 7579
336 Ga0466961_0051187 3300044693 Bacteria 2638
337 Ga0466961_0108405 3300044693 Bacteria 1748
338 Ga0466961_0682827 3300044693 Bacteria 615
339 Ga0466963_0007697 3300044694 Bacteria 6434
340 Ga0466963_0020619 3300044694 Bacteria 4145
341 Ga0466963_0023040 3300044694 Bacteria 3949
342 Ga0466963_0026075 3300044694 Bacteria 3736
343 Ga0466963_0053135 3300044694 Bacteria 2689
344 Ga0466963_0069102 3300044694 Bacteria 2373
345 Ga0466963_0088800 3300044694 Bacteria 2102
346 Ga0466963_0693818 3300044694 Bacteria 718
347 Ga0466964_0008282 3300044706 Bacteria 3902
348 Ga0466964_0226108 3300044706 Bacteria 911
349 Ga0453684_0785755 3300044712 Bacteria 1028
350 Ga0466971_0009296 3300044719 Bacteria 4293
351 Ga0466971_0121703 3300044719 Bacteria 1208
352 Ga0466971_0435091 3300044719 Bacteria 642
353 Ga0466968_0023373 3300044735 Bacteria 2517
354 Ga0466968_0216163 3300044735 Bacteria 902
355 Ga0466970_0065222 3300044765 Bacteria 1953
356 Ga0466970_0215722 3300044765 Unclassified 1070
357 Ga0466957_0008134 3300044842 Bacteria 5954
358 Ga0466957_0041700 3300044842 Bacteria 2775
359 Ga0466957_0063033 3300044842 Bacteria 2278
360 Ga0466957_0077435 3300044842 Bacteria 2066
361 Ga0466959_0092863 3300045049 Bacteria 2166
362 Ga0466959_0116432 3300045049 Unclassified 1903
363 Ga0466958_0003935 3300045836 Bacteria 7788
364 Ga0466958_0009487 3300045836 Bacteria 5426
365 Ga0466958_0015675 3300045836 Bacteria 4349
366 Ga0466958_0043928 3300045836 Bacteria 2692
367 Ga0466958_0103616 3300045836 Bacteria 1772
368 Ga0466958_0545619 3300045836 Bacteria 753
369 Ga0466967_0030198 3300045976 Bacteria 4546
370 Ga0466967_0045253 3300045976 Bacteria 3823
371 Ga0466967_0067325 3300045976 Bacteria 3194
372 Ga0466967_0075620 3300045976 Bacteria 3027
373 Ga0466967_0090121 3300045976 Bacteria 2785
374 Ga0466967_0102631 3300045976 Bacteria 2616
375 Ga0466967_0418290 3300045976 Bacteria 1306
376 Ga0466967_0564956 3300045976 Bacteria 1120
377 Ga0466967_0703636 3300045976 Bacteria 1001
378 Ga0466967_0721486 3300045976 Unclassified 988
379 Ga0466967_2156629 3300045976 Unclassified 553
380 Ga0495621_0002896 3300046539 Bacteria 4676
381 Ga0495669_0032261 3300046684 Bacteria 2302
382 Ga0495669_0057798 3300046684 Bacteria 1750
383 Ga0496100_0002960 3300048903 Bacteria 8737
384 Ga0496101_0006159 3300048904 Bacteria 7705
385 Ga0496102_0134593 3300048905 Bacteria 2315
386 Ga0496102_0834272 3300048905 Bacteria 844
387 Ga0496103_0041225 3300048906 Bacteria 2838
388 Ga0496103_0124656 3300048906 Bacteria 1642
389 Ga0496103_0323786 3300048906 Bacteria 991
390 Ga0496105_0030889 3300048908 Bacteria 4392
391 Ga0496106_0114977 3300048909 Bacteria 2098
392 Ga0496106_0273487 3300048909 Bacteria 1353
393 Ga0496107_0030311 3300048910 Bacteria 3855
394 Ga0496107_0082798 3300048910 Bacteria 2340
395 Ga0496108_0014499 3300048911 Bacteria 6434
396 Ga0496108_0036870 3300048911 Bacteria 4070
397 Ga0496108_0384902 3300048911 Bacteria 1225
398 Ga0496109_0037513 3300048912 Bacteria 4378
399 Ga0496109_0065675 3300048912 Bacteria 3321
400 Ga0496109_0208714 3300048912 Bacteria 1837
401 Ga0496110_0042060 3300048913 Bacteria 3988
402 Ga0496111_0057222 3300048914 Bacteria 2822
403 Ga0496111_0155204 3300048914 Bacteria 1699
404 Ga0496111_0166159 3300048914 Bacteria 1639
405 Ga0496112_0024208 3300048915 Bacteria 5810
406 Ga0496112_0114638 3300048915 Bacteria 2665
407 Ga0496112_0758838 3300048915 Bacteria 896
408 Ga0496113_0002989 3300048916 Bacteria 10011
409 Ga0496113_0010374 3300048916 Bacteria 6157
410 Ga0496114_0591950 3300048917 Bacteria 978
411 Ga0466962_0025683 3300061719 Bacteria 2827
412 Ga0466962_0269891 3300061719 Bacteria 838
413 Ga0105248_10284539
414 JGI24752J21851_1016986
415 JGI24740J21852_10002306
416 JGI24739J22299_10058361
417 JGI24737J22298_10005893
418 JGI24737J22298_10015228
419 JGI24743J22301_10119299
420 JGI24735J21928_10119160
421 JGI24738J21930_10042307
422 JGI24738J21930_10096253
423 JGI24744J21845_10000222
424 Ga0070658_10078726
425 Ga0070658_10081278
426 Ga0070658_10452126
427 Ga0070658_10539861
428 Ga0070690_100006041
429 Ga0070670_100054947
430 Ga0070677_10093428
431 Ga0068869_100121584
432 Ga0068869_100455030
433 Ga0070666_10165085
434 Ga0070666_10207165
435 Ga0070680_100000707
436 Ga0070680_100037122
437 Ga0070682_100708658
438 Ga0068868_100171436
439 Ga0068868_100294213
440 Ga0070660_100027318
441 Ga0070660_100066632
442 Ga0070660_100373378
443 Ga0070661_100108949
444 Ga0070661_100218401
445 Ga0070661_100289905
446 Ga0070661_100498915
447 Ga0070661_100927850
448 Ga0070668_100717615
449 Ga0070675_100931662
450 Ga0070671_100302961
451 Ga0070674_100009731
452 Ga0070674_100014920
453 Ga0070673_100114921
454 Ga0070673_100248513
455 Ga0070673_100838161
456 Ga0070659_100052040
457 Ga0070659_100058250
458 Ga0070659_100114460
459 Ga0070659_100170905
460 Ga0070659_100175155
461 Ga0070659_100394502
462 Ga0070659_100500677
463 Ga0070667_100029816
464 Ga0070667_101016810
465 Ga0070714_100023725
466 Ga0070701_10641521
467 Ga0070663_100134040
468 Ga0070663_101465251
469 Ga0070678_100131598
470 Ga0070662_100061324
471 Ga0070662_100287888
472 Ga0070662_100376066
473 Ga0070662_100421555
474 Ga0070662_100433067
475 Ga0070662_100548365
476 Ga0070681_10002173
477 Ga0070681_10073884
478 Ga0070681_10632631
479 Ga0068867_100077582
480 Ga0068867_100085275
481 Ga0068867_100107706
482 Ga0070679_100204911
483 Ga0070679_100514003
484 Ga0068853_100016257
485 Ga0068853_100828295
486 Ga0068853_100933463
487 Ga0070672_100002875
488 Ga0070672_100046929
489 Ga0070686_100416308
490 Ga0070693_100031831
491 Ga0070693_100093802
492 Ga0070665_100160375
493 Ga0070665_100239255
494 Ga0070665_100468317
495 Ga0070664_100082732
496 Ga0070664_100098404
497 Ga0070664_100116836
498 Ga0070664_100397159
499 Ga0070664_100479478
500 Ga0070664_100579316
501 Ga0070664_100755026
502 Ga0068857_100327016
503 Ga0068857_100363023
504 Ga0068857_100392935
505 Ga0068857_100873078
506 Ga0068857_101159181
507 Ga0068854_100125427
508 Ga0068854_100204230
509 Ga0068854_100229562
510 Ga0068856_100370804
511 Ga0068856_100377575
512 Ga0068852_100013358
513 Ga0068852_100050939
514 Ga0068852_100669960
515 Ga0068859_100115028
516 Ga0068864_100005969
517 Ga0068864_100836980
518 Ga0068866_10013908
519 Ga0068866_10097339
520 Ga0068851_10010542
521 Ga0068870_10411998
522 Ga0068863_100046956
523 Ga0068863_100098295
524 Ga0068858_101016730
525 Ga0068860_100285870
526 Ga0068862_101345873
527 Ga0097621_100038120
528 Ga0097621_100210687
529 Ga0068871_100013320
530 Ga0068865_100096821
531 Ga0097620_100115034
532 Ga0105240_10448523
533 Ga0105240_11653036
534 Ga0105245_10076536
535 Ga0105245_10163649
536 Ga0105247_11029781
537 Ga0105243_10649807
538 Ga0105243_10943956
539 Ga0105241_10557120
540 Ga0105242_10726657
541 Ga0105242_11239699
542 Ga0105248_10081585
543 Ga0105248_11332916
544 Ga0105238_10564648
545 Ga0105239_10333063
546 Ga0105246_10667434
547 Ga0157373_10003364
548 Ga0157373_10107037
549 Ga0157373_10186788
550 Ga0157373_10675454
551 Ga0157371_10079041
552 Ga0157371_10126550
553 Ga0157371_10131769
554 Ga0157371_10146891
555 Ga0157371_11027364
556 Ga0157370_10035182
557 Ga0157370_10075851
558 Ga0157370_10206120
559 Ga0157369_10017175
560 Ga0157369_10346587
561 Ga0157369_11036215
562 Ga0157374_10365365
563 Ga0157378_10010589
564 Ga0157378_10390717
565 Ga0163162_10177152
566 Ga0163162_10677376
567 Ga0157372_10120441
568 Ga0157375_10367709
569 Ga0157376_10330709
570 Ga0207697_10031299
571 Ga0207697_10091591
572 Ga0207656_10016776
573 Ga0207682_10016933
574 Ga0207682_10205013
575 Ga0207642_10650266
576 Ga0207688_10191240
577 Ga0207688_10193272
578 Ga0207680_10046664
579 Ga0207680_10375993
580 Ga0207647_10055626
581 Ga0207647_10073717
582 Ga0207647_10111444
583 Ga0207647_10510617
584 Ga0207645_10305385
585 Ga0207645_10319197
586 Ga0207645_10639111
587 Ga0207705_10004738
588 Ga0207705_10029237
589 Ga0207705_10045610
590 Ga0207705_10063287
591 Ga0207705_10095440
592 Ga0207705_10567015
593 Ga0207654_10675103
594 Ga0207707_10273356
595 Ga0207695_10742767
596 Ga0207660_10003425
597 Ga0207660_10614150
598 Ga0207657_10000576
599 Ga0207657_10011758
600 Ga0207657_10038469
601 Ga0207657_10057919
602 Ga0207657_10085686
603 Ga0207657_10107237
604 Ga0207657_10229627
605 Ga0207657_10433756
606 Ga0207649_10077718
607 Ga0207649_10114875
608 Ga0207649_10169915
609 Ga0207652_10126263
610 Ga0207652_10154425
611 Ga0207652_10269983
612 Ga0207652_10400978
613 Ga0207681_10101435
614 Ga0207681_10136743
615 Ga0207681_10872921
616 Ga0207694_10024367
617 Ga0207650_10043156
618 Ga0207659_10150238
619 Ga0207659_10982830
620 Ga0207687_10445021
621 Ga0207664_10193157
622 Ga0207644_10002273
623 Ga0207644_10223582
624 Ga0207644_10246326
625 Ga0207644_10291826
626 Ga0207690_10001625
627 Ga0207690_10016520
628 Ga0207690_10037062
629 Ga0207690_10080488
630 Ga0207690_10255187
631 Ga0207690_10458203
632 Ga0207690_10479409
633 Ga0207690_10534377
634 Ga0207706_10005821
635 Ga0207706_10008262
636 Ga0207706_10008548
637 Ga0207706_10156017
638 Ga0207706_10183358
639 Ga0207706_10426894
640 Ga0207706_11096006
641 Ga0207686_10556653
642 Ga0207709_10101095
643 Ga0207669_10003464
644 Ga0207704_10321290
645 Ga0207691_10058280
646 Ga0207691_10106319
647 Ga0207691_10403024
648 Ga0207711_10061318
649 Ga0207711_10216605
650 Ga0207711_10246800
651 Ga0207689_10536356
652 Ga0207689_10543294
653 Ga0207679_10081282
654 Ga0207679_10128946
655 Ga0207679_10193426
656 Ga0207651_10003862
657 Ga0207651_10491310
658 Ga0207651_10955802
659 Ga0207668_11005718
660 Ga0207640_10116748
661 Ga0207640_11449234
662 Ga0207658_10024109
663 Ga0207658_10703672
664 Ga0207677_10024538
665 Ga0207677_10820630
666 Ga0207703_10225027
667 Ga0207678_10005230
668 Ga0207678_10049165
669 Ga0207678_10604868
670 Ga0207678_11024072
671 Ga0207702_10012501
672 Ga0207702_10026160
673 Ga0207702_10233851
674 Ga0207641_10033857
675 Ga0207648_10002037
676 Ga0207648_10017076
677 Ga0207676_10266993
678 Ga0207674_10003946
679 Ga0207674_10019952
680 Ga0207674_10089175
681 Ga0207683_10002018
682 Ga0207683_10029068
683 Ga0207698_10006272
684 Ga0268266_10255548
685 Ga0268266_10516857
686 Ga0268264_10273390
687 Ga0307408_100415574
688 Ga0307405_10022244
689 Ga0307413_10116570
690 Ga0307413_10262846
691 Ga0307410_10333156
692 Ga0307406_10102657
693 Ga0307412_10710892
694 Ga0307409_100517991
695 Ga0307416_100367939
696 Ga0307414_10274562
697 Ga0307411_10264777
698 Ga0307415_100044647
699 Ga0307415_101083417
700 Ga0373960_0039575
701 Ga0373942_0109657
702 Ga0373961_0260841
703 Ga0373931_0121019
704 Ga0373937_0896054
705 Ga0395899_0000365
706 Ga0395899_0015489
707 Ga0395899_0549555
708 Ga0395899_0805079
709 Ga0395900_0000093
710 Ga0395900_0003442
711 Ga0395900_0011711
712 Ga0395900_0083969
713 Ga0395900_0148568
714 Ga0395900_0393252
715 Ga0395900_0431069
716 Ga0395900_0765352
717 Ga0395900_1286916
718 Ga0395898_0000053
719 Ga0395898_0001500
720 Ga0395898_0456099
721 Ga0395898_0812844
722 Ga0395905_0000031
723 Ga0395905_0003933
724 Ga0395905_0004217
725 Ga0395905_0043181
726 Ga0395905_0130037
727 Ga0395905_0167382
728 Ga0395905_0207232
729 Ga0395905_0510856
730 Ga0395905_0857078
731 Ga0395901_0001291
732 Ga0395901_0003232
733 Ga0395901_0019432
734 Ga0395901_0073888
735 Ga0395901_0129392
736 Ga0395901_0166196
737 Ga0395901_0208691
738 Ga0395901_0303550
739 Ga0395901_0310892
740 Ga0395901_0438896
741 Ga0395901_1240846
742 Ga0395901_1478575
743 Ga0439432_159421
744 Ga0439449_0085314
745 Ga0466972_0271455
746 Ga0466966_0021581
747 Ga0466961_0006233
748 Ga0466961_0051187
749 Ga0466961_0108405
750 Ga0466961_0682827
751 Ga0466963_0007697
752 Ga0466963_0020619
753 Ga0466963_0023040
754 Ga0466963_0026075
755 Ga0466963_0053135
756 Ga0466963_0069102
757 Ga0466963_0088800
758 Ga0466963_0693818
759 Ga0466964_0008282
760 Ga0466964_0226108
761 Ga0453684_0785755
762 Ga0466971_0009296
763 Ga0466971_0121703
764 Ga0466971_0435091
765 Ga0466968_0023373
766 Ga0466968_0216163
767 Ga0466970_0065222
768 Ga0466970_0215722
769 Ga0466957_0008134
770 Ga0466957_0041700
771 Ga0466957_0063033
772 Ga0466957_0077435
773 Ga0466959_0092863
774 Ga0466959_0116432
775 Ga0466958_0003935
776 Ga0466958_0009487
777 Ga0466958_0015675
778 Ga0466958_0043928
779 Ga0466958_0103616
780 Ga0466958_0545619
781 Ga0466967_0030198
782 Ga0466967_0045253
783 Ga0466967_0067325
784 Ga0466967_0075620
785 Ga0466967_0090121
786 Ga0466967_0102631
787 Ga0466967_0418290
788 Ga0466967_0564956
789 Ga0466967_0703636
790 Ga0466967_0721486
791 Ga0466967_2156629
792 Ga0495621_0002896
793 Ga0495669_0032261
794 Ga0495669_0057798
795 Ga0496100_0002960
796 Ga0496101_0006159
797 Ga0496102_0134593
798 Ga0496102_0834272
799 Ga0496103_0041225
800 Ga0496103_0124656
801 Ga0496103_0323786
802 Ga0496105_0030889
803 Ga0496106_0114977
804 Ga0496106_0273487
805 Ga0496107_0030311
806 Ga0496107_0082798
807 Ga0496108_0014499
808 Ga0496108_0036870
809 Ga0496108_0384902
810 Ga0496109_0037513
811 Ga0496109_0065675
812 Ga0496109_0208714
813 Ga0496110_0042060
814 Ga0496111_0057222
815 Ga0496111_0155204
816 Ga0496111_0166159
817 Ga0496112_0024208
818 Ga0496112_0114638
819 Ga0496112_0758838
820 Ga0496113_0002989
821 Ga0496113_0010374
822 Ga0496114_0591950
823 Ga0466962_0025683
824 Ga0466962_0269891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h5b-assembly1.cif.gz_A crystal structure of dr_1245 from deinococcus radiodurans 0.684 70 98
5uhj-assembly1.cif.gz_A-2 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.6625 59 111
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6549 56 118
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6496 59 118
7q2a-assembly1.cif.gz_C crystal structure of aphc in complex with 4-ethylcatechol 0.6494 63 111
ID Description Score Start End Superfamily
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7599 73 99 3.40.630.10
3oajB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7472 60 109 3.10.180.10
af_Q4VBH2_28_179_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7379 65 109 3.30.460.10
1zswA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.724 59 111 3.10.180.10
af_Q9SA02_134_259_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7104 83 113 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A7H0G958-F1-model_v4 deleted 0.9245 2 93
AF-A0A2P9F4S2-F1-model_v4 VOC domain-containing protein 0.897 2 120
AF-A0A7W7K400-F1-model_v4 Glyoxalase-like domain-containing protein 0.872 2 132
AF-A0A545TEN8-F1-model_v4 VOC family protein 0.8708 2 132
AF-A0A7Y7D8B2-F1-model_v4 VOC domain-containing protein 0.8704 2 118

Map