F437797

General Info

Members Datasets Scaffolds Average Seq Length
412 195 824 141

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10649121|Ga0105237_106491213
Length 150
Sequence MATEQQEHLKIEELQQLSPDQIEVMAGRDRENLEGWIPALATEAEVKDAFEKAFDYRGDVTLTLKSGEVVEGYIYDRRQGSTLENSLVRVMPSKGEDRSRRSIPYSEIAALNFSGRDTAAGKTFEAWVKKYWEKKAAGEKNIQIEPEKLD

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.91
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10649121 3300009545 Bacteria 1062
2 rootH2_10052997 3300003320 Unclassified 1562
3 rootH2_10112230 3300003320 Bacteria 1486
4 Ga0065712_10212787 3300005290 Unclassified 1061
5 Ga0070658_10079868 3300005327 Unclassified 2686
6 Ga0070683_100004411 3300005329 Bacteria 11593
7 Ga0070683_100074194 3300005329 Bacteria 3177
8 Ga0070683_100279477 3300005329 Bacteria 1588
9 Ga0070690_100101837 3300005330 Bacteria 1905
10 Ga0070670_100007161 3300005331 Bacteria 9447
11 Ga0070670_100138839 3300005331 Bacteria 2101
12 Ga0068869_100009801 3300005334 Bacteria 6221
13 Ga0070666_10038326 3300005335 Bacteria 3188
14 Ga0070680_100013637 3300005336 Bacteria 6335
15 Ga0070680_100210381 3300005336 Bacteria 1641
16 Ga0068868_100000977 3300005338 Bacteria 19488
17 Ga0068868_100065225 3300005338 Bacteria 2892
18 Ga0068868_100097960 3300005338 Bacteria 2370
19 Ga0070660_100015353 3300005339 Bacteria 5527
20 Ga0070660_100967368 3300005339 Bacteria 719
21 Ga0070689_100956057 3300005340 Bacteria 760
22 Ga0070687_100173242 3300005343 Unclassified 1286
23 Ga0070661_100032414 3300005344 Bacteria 3783
24 Ga0070661_100063804 3300005344 Unclassified 2706
25 Ga0070661_100215697 3300005344 Bacteria 1470
26 Ga0070668_100410470 3300005347 Unclassified 1158
27 Ga0070675_100372530 3300005354 Bacteria 1270
28 Ga0070671_100483294 3300005355 Bacteria 1064
29 Ga0070674_101204360 3300005356 Bacteria 672
30 Ga0070673_100043548 3300005364 Bacteria 3470
31 Ga0070673_100068475 3300005364 Bacteria 2842
32 Ga0070667_100567948 3300005367 Bacteria 1043
33 Ga0070714_100031531 3300005435 Bacteria 4423
34 Ga0070714_100082996 3300005435 Bacteria 2793
35 Ga0070714_100168191 3300005435 Unclassified 1988
36 Ga0070714_100238992 3300005435 Bacteria 1676
37 Ga0070713_100012512 3300005436 Bacteria 6228
38 Ga0070713_100529258 3300005436 Bacteria 1114
39 Ga0070713_101734166 3300005436 Bacteria 606
40 Ga0070711_100041031 3300005439 Bacteria 3124
41 Ga0070711_100066264 3300005439 Bacteria 2529
42 Ga0070708_100040260 3300005445 Bacteria 4092
43 Ga0070662_100156621 3300005457 Bacteria 1779
44 Ga0070662_100187820 3300005457 Bacteria 1632
45 Ga0070681_10003258 3300005458 Bacteria 15139
46 Ga0070681_10055499 3300005458 Bacteria 3944
47 Ga0070681_11194819 3300005458 Unclassified 682
48 Ga0068867_100002729 3300005459 Bacteria 12447
49 Ga0068867_100366057 3300005459 Bacteria 1207
50 Ga0070707_100452153 3300005468 Bacteria 1245
51 Ga0070679_100005928 3300005530 Bacteria 11354
52 Ga0070679_100118202 3300005530 Bacteria 2636
53 Ga0070679_100191837 3300005530 Bacteria 2012
54 Ga0070679_100206606 3300005530 Bacteria 1928
55 Ga0070684_100113398 3300005535 Bacteria 2433
56 Ga0070684_100565183 3300005535 Bacteria 1056
57 Ga0070697_100590136 3300005536 Bacteria 976
58 Ga0068853_100461875 3300005539 Bacteria 1195
59 Ga0068853_100567793 3300005539 Bacteria 1076
60 Ga0068853_100637875 3300005539 Bacteria 1013
61 Ga0068853_101209828 3300005539 Bacteria 729
62 Ga0068853_101326621 3300005539 Bacteria 695
63 Ga0070672_100001063 3300005543 Bacteria 16743
64 Ga0070693_100224261 3300005547 Bacteria 1233
65 Ga0070665_100014033 3300005548 Bacteria 8054
66 Ga0070665_100181188 3300005548 Bacteria 2107
67 Ga0068855_100009663 3300005563 Bacteria 11640
68 Ga0068855_100015585 3300005563 Bacteria 9147
69 Ga0068855_100019740 3300005563 Bacteria 8093
70 Ga0068855_100076983 3300005563 Bacteria 3870
71 Ga0070664_100004851 3300005564 Bacteria 10777
72 Ga0068857_100004083 3300005577 Bacteria 12299
73 Ga0068857_100185241 3300005577 Bacteria 1895
74 Ga0068857_100876267 3300005577 Bacteria 860
75 Ga0068854_100033521 3300005578 Bacteria 3581
76 Ga0068854_100414299 3300005578 Bacteria 1118
77 Ga0068854_101548406 3300005578 Unclassified 603
78 Ga0068856_100000916 3300005614 Bacteria 31561
79 Ga0068856_100002146 3300005614 Bacteria 20446
80 Ga0068856_100038548 3300005614 Bacteria 4692
81 Ga0068856_100116925 3300005614 Bacteria 2667
82 Ga0068856_100142795 3300005614 Bacteria 2401
83 Ga0068856_100257797 3300005614 Bacteria 1759
84 Ga0068856_101008846 3300005614 Unclassified 851
85 Ga0068856_101620318 3300005614 Unclassified 660
86 Ga0068852_100000009 3300005616 Bacteria 149600
87 Ga0068852_100063446 3300005616 Bacteria 3217
88 Ga0068852_100342508 3300005616 Bacteria 1457
89 Ga0068852_100385007 3300005616 Bacteria 1376
90 Ga0068859_100000418 3300005617 Bacteria 42477
91 Ga0068859_100711242 3300005617 Bacteria 1095
92 Ga0068864_100001207 3300005618 Bacteria 21455
93 Ga0068864_100543222 3300005618 Bacteria 1122
94 Ga0068866_10079592 3300005718 Bacteria 1756
95 Ga0068851_10089914 3300005834 Bacteria 1615
96 Ga0068870_10051365 3300005840 Bacteria 2182
97 Ga0068863_100066586 3300005841 Unclassified 3407
98 Ga0068863_100199683 3300005841 Bacteria 1923
99 Ga0068863_100757916 3300005841 Unclassified 967
100 Ga0068863_100758561 3300005841 Bacteria 966
101 Ga0068858_100010741 3300005842 Bacteria 8659
102 Ga0068858_100044802 3300005842 Bacteria 4100
103 Ga0068858_100184206 3300005842 Unclassified 1972
104 Ga0068860_100005689 3300005843 Bacteria 12584
105 Ga0068860_100624841 3300005843 Bacteria 1084
106 Ga0070717_10944813 3300006028 Bacteria 785
107 Ga0070717_11355492 3300006028 Unclassified 646
108 Ga0070712_100115100 3300006175 Bacteria 2015
109 Ga0070712_100483134 3300006175 Bacteria 1036
110 Ga0070712_100510045 3300006175 Bacteria 1009
111 Ga0070712_101403492 3300006175 Unclassified 609
112 Ga0097621_100085364 3300006237 Bacteria 2633
113 Ga0097621_100112546 3300006237 Bacteria 2301
114 Ga0068871_100058109 3300006358 Bacteria 3148
115 Ga0068871_100092657 3300006358 Bacteria 2520
116 Ga0068865_100034242 3300006881 Bacteria 3407
117 Ga0075436_100231106 3300006914 Unclassified 1314
118 Ga0097620_100000418 3300006931 Bacteria 42477
119 Ga0097620_100711377 3300006931 Bacteria 1095
120 Ga0105240_10000148 3300009093 Bacteria 142265
121 Ga0105240_10001474 3300009093 Bacteria 40151
122 Ga0105240_10017072 3300009093 Bacteria 9801
123 Ga0105240_10026818 3300009093 Bacteria 7556
124 Ga0105240_10067694 3300009093 Bacteria 4426
125 Ga0105240_10154475 3300009093 Bacteria 2731
126 Ga0105240_10282630 3300009093 Bacteria 1906
127 Ga0105240_11903464 3300009093 Unclassified 619
128 Ga0105245_10860272 3300009098 Bacteria 947
129 Ga0105247_10051351 3300009101 Bacteria 2539
130 Ga0105247_10411538 3300009101 Unclassified 966
131 Ga0105243_10250202 3300009148 Bacteria 1582
132 Ga0105241_10039831 3300009174 Bacteria 3545
133 Ga0105241_10174250 3300009174 Bacteria 1779
134 Ga0105241_10211294 3300009174 Bacteria 1626
135 Ga0105241_10995299 3300009174 Unclassified 784
136 Ga0105241_11648709 3300009174 Bacteria 622
137 Ga0105242_10052652 3300009176 Bacteria 3322
138 Ga0105242_10663758 3300009176 Bacteria 1016
139 Ga0105248_10000004 3300009177 Bacteria 695244
140 Ga0105248_10001829 3300009177 Bacteria 23588
141 Ga0105248_13140357 3300009177 Unclassified 526
142 Ga0105237_10007053 3300009545 Bacteria 12359
143 Ga0105237_10010661 3300009545 Bacteria 9765
144 Ga0105237_10057258 3300009545 Bacteria 3901
145 Ga0105237_10164025 3300009545 Bacteria 2221
146 Ga0105237_11071337 3300009545 Unclassified 813
147 Ga0105238_10006069 3300009551 Bacteria 11983
148 Ga0105238_10050591 3300009551 Bacteria 4182
149 Ga0105238_10062798 3300009551 Bacteria 3715
150 Ga0105238_10077665 3300009551 Bacteria 3311
151 Ga0105239_10084545 3300010375 Bacteria 3495
152 Ga0105239_10615574 3300010375 Bacteria 1239
153 Ga0105239_13655150 3300010375 Bacteria 500
154 Ga0105246_10020248 3300011119 Bacteria 4265
155 Ga0105246_10093191 3300011119 Unclassified 2175
156 Ga0157373_10027038 3300013100 Bacteria 4140
157 Ga0157373_10275584 3300013100 Bacteria 1191
158 Ga0157373_11181932 3300013100 Unclassified 576
159 Ga0157371_10655651 3300013102 Bacteria 783
160 Ga0157370_10001908 3300013104 Bacteria 25647
161 Ga0157370_10013011 3300013104 Bacteria 8595
162 Ga0157370_10114251 3300013104 Bacteria 2523
163 Ga0157369_10000035 3300013105 Bacteria 191300
164 Ga0157369_10035416 3300013105 Bacteria 5473
165 Ga0157369_10036867 3300013105 Bacteria 5355
166 Ga0157369_10061361 3300013105 Bacteria 4053
167 Ga0157369_10064089 3300013105 Bacteria 3958
168 Ga0157369_10088346 3300013105 Unclassified 3308
169 Ga0157369_10175025 3300013105 Bacteria 2259
170 Ga0157369_10259485 3300013105 Bacteria 1812
171 Ga0157369_10531781 3300013105 Bacteria 1216
172 Ga0157374_10001749 3300013296 Bacteria 18238
173 Ga0157374_10072350 3300013296 Bacteria 3253
174 Ga0157374_10455667 3300013296 Bacteria 1281
175 Ga0157374_10544677 3300013296 Bacteria 1168
176 Ga0157374_10743811 3300013296 Bacteria 995
177 Ga0157378_10000388 3300013297 Bacteria 43382
178 Ga0157378_10000672 3300013297 Bacteria 32242
179 Ga0157378_10016166 3300013297 Bacteria 6534
180 Ga0157378_10437047 3300013297 Bacteria 1296
181 Ga0163162_10542137 3300013306 Unclassified 1292
182 Ga0163162_10784970 3300013306 Bacteria 1071
183 Ga0157372_10000049 3300013307 Bacteria 142350
184 Ga0157372_10001589 3300013307 Bacteria 24720
185 Ga0157372_10002152 3300013307 Bacteria 21430
186 Ga0157372_10005916 3300013307 Bacteria 13022
187 Ga0157372_10008238 3300013307 Bacteria 11079
188 Ga0157372_10066228 3300013307 Bacteria 4058
189 Ga0157372_10069876 3300013307 Bacteria 3950
190 Ga0157372_10276110 3300013307 Bacteria 1953
191 Ga0157372_10996386 3300013307 Bacteria 970
192 Ga0157372_12383707 3300013307 Bacteria 608
193 Ga0157375_10072281 3300013308 Bacteria 3465
194 Ga0157375_10130216 3300013308 Bacteria 2634
195 Ga0163163_10855780 3300014325 Bacteria 973
196 Ga0157377_10589582 3300014745 Bacteria 791
197 Ga0157379_10246399 3300014968 Bacteria 1621
198 Ga0157376_10831839 3300014969 Bacteria 938
199 Ga0163161_10007132 3300017792 Bacteria 7726
200 Ga0206356_11053223 3300020070 Bacteria 1001
201 Ga0206356_11480910 3300020070 Bacteria 858
202 Ga0206351_10648075 3300020077 Bacteria 686
203 Ga0206352_10260040 3300020078 Unclassified 1037
204 Ga0154015_1325885 3300020610 Bacteria 742
205 Ga0224712_10177344 3300022467 Bacteria 958
206 Ga0224572_1008204 3300024225 Bacteria 1928
207 Ga0209233_1000980 3300025261 Bacteria 12250
208 Ga0207697_10022000 3300025315 Bacteria 2612
209 Ga0207656_10106532 3300025321 Bacteria 1291
210 Ga0207692_10023508 3300025898 Bacteria 2851
211 Ga0207642_10084132 3300025899 Bacteria 1553
212 Ga0207647_10055991 3300025904 Bacteria 2421
213 Ga0207643_10072745 3300025908 Bacteria 1980
214 Ga0207705_10167350 3300025909 Bacteria 1654
215 Ga0207654_10030722 3300025911 Bacteria 2952
216 Ga0207654_10214520 3300025911 Bacteria 1273
217 Ga0207707_10011242 3300025912 Bacteria 7790
218 Ga0207707_10080845 3300025912 Bacteria 2837
219 Ga0207707_10118077 3300025912 Bacteria 2319
220 Ga0207695_10000105 3300025913 Bacteria 254764
221 Ga0207695_10008132 3300025913 Bacteria 13189
222 Ga0207695_10017583 3300025913 Bacteria 8310
223 Ga0207695_10025983 3300025913 Bacteria 6543
224 Ga0207695_10027299 3300025913 Bacteria 6360
225 Ga0207695_10112325 3300025913 Bacteria 2703
226 Ga0207695_10153523 3300025913 Bacteria 2239
227 Ga0207695_10177870 3300025913 Bacteria 2049
228 Ga0207695_10182210 3300025913 Bacteria 2021
229 Ga0207693_10066174 3300025915 Unclassified 2830
230 Ga0207693_10646324 3300025915 Unclassified 822
231 Ga0207663_10050923 3300025916 Bacteria 2576
232 Ga0207663_10424468 3300025916 Bacteria 1021
233 Ga0207663_11294148 3300025916 Unclassified 587
234 Ga0207660_10020026 3300025917 Bacteria 4483
235 Ga0207660_10044584 3300025917 Bacteria 3120
236 Ga0207657_10004170 3300025919 Bacteria 15323
237 Ga0207649_10058173 3300025920 Bacteria 2420
238 Ga0207649_10298055 3300025920 Bacteria 1178
239 Ga0207652_10013107 3300025921 Bacteria 6711
240 Ga0207652_10119419 3300025921 Bacteria 2345
241 Ga0207652_10187860 3300025921 Bacteria 1858
242 Ga0207681_10707742 3300025923 Bacteria 838
243 Ga0207694_10153253 3300025924 Bacteria 1857
244 Ga0207694_10368423 3300025924 Bacteria 1191
245 Ga0207694_10387689 3300025924 Bacteria 1160
246 Ga0207650_10015022 3300025925 Bacteria 5386
247 Ga0207687_10519376 3300025927 Bacteria 996
248 Ga0207700_10012704 3300025928 Bacteria 5443
249 Ga0207700_10047618 3300025928 Bacteria 3179
250 Ga0207700_10323770 3300025928 Bacteria 1336
251 Ga0207700_10478794 3300025928 Unclassified 1100
252 Ga0207700_11630092 3300025928 Bacteria 570
253 Ga0207664_10046993 3300025929 Bacteria 3390
254 Ga0207664_10090509 3300025929 Unclassified 2507
255 Ga0207664_10111222 3300025929 Bacteria 2279
256 Ga0207664_10233543 3300025929 Bacteria 1599
257 Ga0207664_11052364 3300025929 Bacteria 728
258 Ga0207706_10042902 3300025933 Bacteria 4009
259 Ga0207706_11397196 3300025933 Bacteria 575
260 Ga0207704_10114432 3300025938 Unclassified 1831
261 Ga0207691_10012573 3300025940 Bacteria 8113
262 Ga0207711_10000032 3300025941 Bacteria 199046
263 Ga0207711_10091885 3300025941 Bacteria 2670
264 Ga0207689_10070918 3300025942 Bacteria 2862
265 Ga0207661_10016724 3300025944 Bacteria 5415
266 Ga0207661_10021122 3300025944 Bacteria 4877
267 Ga0207661_10237994 3300025944 Bacteria 1614
268 Ga0207679_10032028 3300025945 Bacteria 3686
269 Ga0207667_10000079 3300025949 Bacteria 163341
270 Ga0207667_10009046 3300025949 Bacteria 11779
271 Ga0207667_10032407 3300025949 Bacteria 5632
272 Ga0207667_10033068 3300025949 Bacteria 5564
273 Ga0207667_10168748 3300025949 Bacteria 2249
274 Ga0207667_12129290 3300025949 Unclassified 519
275 Ga0207651_10055915 3300025960 Bacteria 2713
276 Ga0207668_10374472 3300025972 Bacteria 1197
277 Ga0207658_10026422 3300025986 Bacteria 4070
278 Ga0207677_10009772 3300026023 Bacteria 5405
279 Ga0207677_10039899 3300026023 Bacteria 3091
280 Ga0207677_10173551 3300026023 Bacteria 1688
281 Ga0207703_10098541 3300026035 Bacteria 2472
282 Ga0207703_10186392 3300026035 Bacteria 1834
283 Ga0207703_10193084 3300026035 Unclassified 1805
284 Ga0207639_10028287 3300026041 Bacteria 4091
285 Ga0207639_10600754 3300026041 Bacteria 1015
286 Ga0207639_11159795 3300026041 Bacteria 725
287 Ga0207639_11515266 3300026041 Bacteria 629
288 Ga0207678_10506371 3300026067 Bacteria 1053
289 Ga0207702_10000915 3300026078 Bacteria 30520
290 Ga0207702_10030153 3300026078 Unclassified 4519
291 Ga0207702_10127990 3300026078 Bacteria 2282
292 Ga0207702_10283873 3300026078 Bacteria 1566
293 Ga0207702_10305131 3300026078 Bacteria 1512
294 Ga0207702_10734283 3300026078 Unclassified 974
295 Ga0207641_10468782 3300026088 Unclassified 1219
296 Ga0207641_10648435 3300026088 Unclassified 1037
297 Ga0207641_10702034 3300026088 Unclassified 996
298 Ga0207648_10030012 3300026089 Bacteria 4821
299 Ga0207648_10527567 3300026089 Bacteria 1082
300 Ga0207676_10001232 3300026095 Bacteria 19062
301 Ga0207676_10665569 3300026095 Bacteria 1006
302 Ga0207674_10000125 3300026116 Bacteria 89047
303 Ga0207674_10223179 3300026116 Bacteria 1833
304 Ga0207683_10000078 3300026121 Bacteria 77219
305 Ga0207683_10176225 3300026121 Bacteria 1938
306 Ga0207698_10000020 3300026142 Bacteria 139630
307 Ga0207698_10023264 3300026142 Bacteria 4325
308 Ga0207698_10086157 3300026142 Bacteria 2553
309 Ga0268266_10072003 3300028379 Bacteria 2996
310 Ga0268266_10899312 3300028379 Bacteria 856
311 Ga0268264_10006216 3300028381 Bacteria 10080
312 Ga0265318_10008783 3300028577 Bacteria 4476
313 Ga0265338_10006656 3300028800 Bacteria 14624
314 Ga0265338_10138903 3300028800 Bacteria 1906
315 Ga0265338_10596555 3300028800 Bacteria 770
316 Ga0265338_11102631 3300028800 Unclassified 534
317 Ga0265760_10023636 3300031090 Bacteria 1786
318 Ga0265760_10110401 3300031090 Bacteria 876
319 Ga0265330_10001337 3300031235 Bacteria 14397
320 Ga0265332_10023777 3300031238 Bacteria 2701
321 Ga0265332_10215537 3300031238 Bacteria 797
322 Ga0265332_10218533 3300031238 Unclassified 791
323 Ga0265328_10001245 3300031239 Bacteria 11812
324 Ga0265328_10176433 3300031239 Bacteria 807
325 Ga0265328_10363057 3300031239 Bacteria 565
326 Ga0265325_10000925 3300031241 Bacteria 21196
327 Ga0265325_10100594 3300031241 Bacteria 1415
328 Ga0265325_10157612 3300031241 Bacteria 1070
329 Ga0265329_10043958 3300031242 Bacteria 1428
330 Ga0265340_10001298 3300031247 Bacteria 14317
331 Ga0265340_10028573 3300031247 Bacteria 2804
332 Ga0265340_10042145 3300031247 Bacteria 2242
333 Ga0265340_10079946 3300031247 Bacteria 1540
334 Ga0265339_10000003 3300031249 Bacteria 305994
335 Ga0265339_10003140 3300031249 Bacteria 11632
336 Ga0265339_10014214 3300031249 Bacteria 4803
337 Ga0265339_10312036 3300031249 Bacteria 748
338 Ga0265316_10009816 3300031344 Bacteria 8786
339 Ga0265316_10019740 3300031344 Bacteria 5755
340 Ga0265316_10023472 3300031344 Bacteria 5181
341 Ga0265316_10272964 3300031344 Bacteria 1237
342 Ga0265316_10393891 3300031344 Bacteria 998
343 Ga0265316_10536173 3300031344 Bacteria 834
344 Ga0265313_10001307 3300031595 Bacteria 23503
345 Ga0265313_10213394 3300031595 Bacteria 799
346 Ga0265314_10037641 3300031711 Bacteria 3504
347 Ga0265314_10114874 3300031711 Bacteria 1705
348 Ga0265314_10291976 3300031711 Bacteria 918
349 Ga0265342_10013919 3300031712 Bacteria 5365
350 Ga0265342_10021660 3300031712 Bacteria 4099
351 Ga0265342_10071586 3300031712 Bacteria 2020
352 Ga0316214_1039606 3300033545 Unclassified 676
353 Ga0373934_0212370 3300035086 Bacteria 798
354 Ga0373932_0347270 3300035112 Unclassified 563
355 Ga0373939_0171470 3300035114 Bacteria 803
356 Ga0373953_0113592 3300035117 Unclassified 1147
357 Ga0373953_0345143 3300035117 Bacteria 652
358 Ga0373943_0440305 3300035170 Unclassified 756
359 Ga0373955_0074077 3300035172 Bacteria 1910
360 Ga0373924_0465620 3300035410 Bacteria 567
361 Ga0373931_0390504 3300035691 Unclassified 879
362 Ga0373931_0640128 3300035691 Bacteria 698
363 Ga0373935_0270208 3300035692 Unclassified 1195
364 Ga0373933_0582910 3300035724 Unclassified 734
365 Ga0373933_0714231 3300035724 Bacteria 659
366 Ga0373937_0038373 3300036401 Bacteria 4364
367 Ga0373937_0039697 3300036401 Bacteria 4290
368 Ga0373937_0163071 3300036401 Bacteria 2090
369 Ga0373937_0622494 3300036401 Unclassified 1024
370 Ga0373925_0914916 3300037068 Unclassified 723
371 Ga0395900_0787235 3300037418 Unclassified 880
372 Ga0436364_1419765 3300037853 Bacteria 1487
373 Ga0436360_0880983 3300039438 Bacteria 2663
374 Ga0436363_0556994 3300039450 Bacteria 2177
375 Ga0436362_0986411 3300039453 Unclassified 671
376 Ga0453683_0364577 3300044673 Archaea 929
377 Ga0495592_0683321 3300046454 Unclassified 619
378 Ga0495629_0042298 3300046459 Bacteria 3203
379 Ga0495580_0898248 3300046472 Bacteria 569
380 Ga0495639_0233891 3300046475 Bacteria 906
381 Ga0495586_0349749 3300046535 Bacteria 849
382 Ga0495645_0091172 3300046543 Bacteria 2177
383 Ga0495645_0375487 3300046543 Bacteria 911
384 Ga0495667_0188339 3300046559 Bacteria 1323
385 Ga0495657_0800711 3300046675 Bacteria 539
386 Ga0495623_0079519 3300046679 Bacteria 2031
387 Ga0495669_0332181 3300046684 Unclassified 734
388 Ga0495604_0262617 3300047317 Unclassified 1173
389 Ga0495674_0075587 3300047319 Bacteria 2899
390 Ga0495684_0399589 3300047471 Unclassified 965
391 Ga0495686_0000035 3300047472 Bacteria 314930
392 Ga0495686_0004378 3300047472 Bacteria 11646
393 Ga0495686_0046392 3300047472 Bacteria 2747
394 Ga0495602_0166808 3300048088 Bacteria 1713
395 Ga0495602_0257102 3300048088 Bacteria 1298
396 Ga0496101_0620766 3300048904 Bacteria 855
397 Ga0496104_0000076 3300048907 Bacteria 102010
398 Ga0496105_0058989 3300048908 Bacteria 3167
399 Ga0496106_0973247 3300048909 Bacteria 668
400 Ga0496107_0714670 3300048910 Bacteria 736
401 Ga0496108_0313170 3300048911 Bacteria 1368
402 Ga0496108_0888845 3300048911 Bacteria 765
403 Ga0496110_0577450 3300048913 Bacteria 1021
404 Ga0496112_0006343 3300048915 Bacteria 10380
405 Ga0496112_0624163 3300048915 Bacteria 1009
406 Ga0496114_0465700 3300048917 Bacteria 1119
407 Ga0496115_0156782 3300048918 Bacteria 1881
408 Ga0496126_0000110 3300048929 Bacteria 196225
409 Ga0496126_0001061 3300048929 Bacteria 46386
410 nmdc:mga08x19_540203_c1 3300050514 Bacteria 824
411 nmdc:mga08x19_56110_c1 3300050514 Bacteria 1320
412 Ga0500595_031316 3300053119 Bacteria 1785
413 Ga0105237_10649121
414 rootH2_10052997
415 rootH2_10112230
416 Ga0065712_10212787
417 Ga0070658_10079868
418 Ga0070683_100004411
419 Ga0070683_100074194
420 Ga0070683_100279477
421 Ga0070690_100101837
422 Ga0070670_100007161
423 Ga0070670_100138839
424 Ga0068869_100009801
425 Ga0070666_10038326
426 Ga0070680_100013637
427 Ga0070680_100210381
428 Ga0068868_100000977
429 Ga0068868_100065225
430 Ga0068868_100097960
431 Ga0070660_100015353
432 Ga0070660_100967368
433 Ga0070689_100956057
434 Ga0070687_100173242
435 Ga0070661_100032414
436 Ga0070661_100063804
437 Ga0070661_100215697
438 Ga0070668_100410470
439 Ga0070675_100372530
440 Ga0070671_100483294
441 Ga0070674_101204360
442 Ga0070673_100043548
443 Ga0070673_100068475
444 Ga0070667_100567948
445 Ga0070714_100031531
446 Ga0070714_100082996
447 Ga0070714_100168191
448 Ga0070714_100238992
449 Ga0070713_100012512
450 Ga0070713_100529258
451 Ga0070713_101734166
452 Ga0070711_100041031
453 Ga0070711_100066264
454 Ga0070708_100040260
455 Ga0070662_100156621
456 Ga0070662_100187820
457 Ga0070681_10003258
458 Ga0070681_10055499
459 Ga0070681_11194819
460 Ga0068867_100002729
461 Ga0068867_100366057
462 Ga0070707_100452153
463 Ga0070679_100005928
464 Ga0070679_100118202
465 Ga0070679_100191837
466 Ga0070679_100206606
467 Ga0070684_100113398
468 Ga0070684_100565183
469 Ga0070697_100590136
470 Ga0068853_100461875
471 Ga0068853_100567793
472 Ga0068853_100637875
473 Ga0068853_101209828
474 Ga0068853_101326621
475 Ga0070672_100001063
476 Ga0070693_100224261
477 Ga0070665_100014033
478 Ga0070665_100181188
479 Ga0068855_100009663
480 Ga0068855_100015585
481 Ga0068855_100019740
482 Ga0068855_100076983
483 Ga0070664_100004851
484 Ga0068857_100004083
485 Ga0068857_100185241
486 Ga0068857_100876267
487 Ga0068854_100033521
488 Ga0068854_100414299
489 Ga0068854_101548406
490 Ga0068856_100000916
491 Ga0068856_100002146
492 Ga0068856_100038548
493 Ga0068856_100116925
494 Ga0068856_100142795
495 Ga0068856_100257797
496 Ga0068856_101008846
497 Ga0068856_101620318
498 Ga0068852_100000009
499 Ga0068852_100063446
500 Ga0068852_100342508
501 Ga0068852_100385007
502 Ga0068859_100000418
503 Ga0068859_100711242
504 Ga0068864_100001207
505 Ga0068864_100543222
506 Ga0068866_10079592
507 Ga0068851_10089914
508 Ga0068870_10051365
509 Ga0068863_100066586
510 Ga0068863_100199683
511 Ga0068863_100757916
512 Ga0068863_100758561
513 Ga0068858_100010741
514 Ga0068858_100044802
515 Ga0068858_100184206
516 Ga0068860_100005689
517 Ga0068860_100624841
518 Ga0070717_10944813
519 Ga0070717_11355492
520 Ga0070712_100115100
521 Ga0070712_100483134
522 Ga0070712_100510045
523 Ga0070712_101403492
524 Ga0097621_100085364
525 Ga0097621_100112546
526 Ga0068871_100058109
527 Ga0068871_100092657
528 Ga0068865_100034242
529 Ga0075436_100231106
530 Ga0097620_100000418
531 Ga0097620_100711377
532 Ga0105240_10000148
533 Ga0105240_10001474
534 Ga0105240_10017072
535 Ga0105240_10026818
536 Ga0105240_10067694
537 Ga0105240_10154475
538 Ga0105240_10282630
539 Ga0105240_11903464
540 Ga0105245_10860272
541 Ga0105247_10051351
542 Ga0105247_10411538
543 Ga0105243_10250202
544 Ga0105241_10039831
545 Ga0105241_10174250
546 Ga0105241_10211294
547 Ga0105241_10995299
548 Ga0105241_11648709
549 Ga0105242_10052652
550 Ga0105242_10663758
551 Ga0105248_10000004
552 Ga0105248_10001829
553 Ga0105248_13140357
554 Ga0105237_10007053
555 Ga0105237_10010661
556 Ga0105237_10057258
557 Ga0105237_10164025
558 Ga0105237_11071337
559 Ga0105238_10006069
560 Ga0105238_10050591
561 Ga0105238_10062798
562 Ga0105238_10077665
563 Ga0105239_10084545
564 Ga0105239_10615574
565 Ga0105239_13655150
566 Ga0105246_10020248
567 Ga0105246_10093191
568 Ga0157373_10027038
569 Ga0157373_10275584
570 Ga0157373_11181932
571 Ga0157371_10655651
572 Ga0157370_10001908
573 Ga0157370_10013011
574 Ga0157370_10114251
575 Ga0157369_10000035
576 Ga0157369_10035416
577 Ga0157369_10036867
578 Ga0157369_10061361
579 Ga0157369_10064089
580 Ga0157369_10088346
581 Ga0157369_10175025
582 Ga0157369_10259485
583 Ga0157369_10531781
584 Ga0157374_10001749
585 Ga0157374_10072350
586 Ga0157374_10455667
587 Ga0157374_10544677
588 Ga0157374_10743811
589 Ga0157378_10000388
590 Ga0157378_10000672
591 Ga0157378_10016166
592 Ga0157378_10437047
593 Ga0163162_10542137
594 Ga0163162_10784970
595 Ga0157372_10000049
596 Ga0157372_10001589
597 Ga0157372_10002152
598 Ga0157372_10005916
599 Ga0157372_10008238
600 Ga0157372_10066228
601 Ga0157372_10069876
602 Ga0157372_10276110
603 Ga0157372_10996386
604 Ga0157372_12383707
605 Ga0157375_10072281
606 Ga0157375_10130216
607 Ga0163163_10855780
608 Ga0157377_10589582
609 Ga0157379_10246399
610 Ga0157376_10831839
611 Ga0163161_10007132
612 Ga0206356_11053223
613 Ga0206356_11480910
614 Ga0206351_10648075
615 Ga0206352_10260040
616 Ga0154015_1325885
617 Ga0224712_10177344
618 Ga0224572_1008204
619 Ga0209233_1000980
620 Ga0207697_10022000
621 Ga0207656_10106532
622 Ga0207692_10023508
623 Ga0207642_10084132
624 Ga0207647_10055991
625 Ga0207643_10072745
626 Ga0207705_10167350
627 Ga0207654_10030722
628 Ga0207654_10214520
629 Ga0207707_10011242
630 Ga0207707_10080845
631 Ga0207707_10118077
632 Ga0207695_10000105
633 Ga0207695_10008132
634 Ga0207695_10017583
635 Ga0207695_10025983
636 Ga0207695_10027299
637 Ga0207695_10112325
638 Ga0207695_10153523
639 Ga0207695_10177870
640 Ga0207695_10182210
641 Ga0207693_10066174
642 Ga0207693_10646324
643 Ga0207663_10050923
644 Ga0207663_10424468
645 Ga0207663_11294148
646 Ga0207660_10020026
647 Ga0207660_10044584
648 Ga0207657_10004170
649 Ga0207649_10058173
650 Ga0207649_10298055
651 Ga0207652_10013107
652 Ga0207652_10119419
653 Ga0207652_10187860
654 Ga0207681_10707742
655 Ga0207694_10153253
656 Ga0207694_10368423
657 Ga0207694_10387689
658 Ga0207650_10015022
659 Ga0207687_10519376
660 Ga0207700_10012704
661 Ga0207700_10047618
662 Ga0207700_10323770
663 Ga0207700_10478794
664 Ga0207700_11630092
665 Ga0207664_10046993
666 Ga0207664_10090509
667 Ga0207664_10111222
668 Ga0207664_10233543
669 Ga0207664_11052364
670 Ga0207706_10042902
671 Ga0207706_11397196
672 Ga0207704_10114432
673 Ga0207691_10012573
674 Ga0207711_10000032
675 Ga0207711_10091885
676 Ga0207689_10070918
677 Ga0207661_10016724
678 Ga0207661_10021122
679 Ga0207661_10237994
680 Ga0207679_10032028
681 Ga0207667_10000079
682 Ga0207667_10009046
683 Ga0207667_10032407
684 Ga0207667_10033068
685 Ga0207667_10168748
686 Ga0207667_12129290
687 Ga0207651_10055915
688 Ga0207668_10374472
689 Ga0207658_10026422
690 Ga0207677_10009772
691 Ga0207677_10039899
692 Ga0207677_10173551
693 Ga0207703_10098541
694 Ga0207703_10186392
695 Ga0207703_10193084
696 Ga0207639_10028287
697 Ga0207639_10600754
698 Ga0207639_11159795
699 Ga0207639_11515266
700 Ga0207678_10506371
701 Ga0207702_10000915
702 Ga0207702_10030153
703 Ga0207702_10127990
704 Ga0207702_10283873
705 Ga0207702_10305131
706 Ga0207702_10734283
707 Ga0207641_10468782
708 Ga0207641_10648435
709 Ga0207641_10702034
710 Ga0207648_10030012
711 Ga0207648_10527567
712 Ga0207676_10001232
713 Ga0207676_10665569
714 Ga0207674_10000125
715 Ga0207674_10223179
716 Ga0207683_10000078
717 Ga0207683_10176225
718 Ga0207698_10000020
719 Ga0207698_10023264
720 Ga0207698_10086157
721 Ga0268266_10072003
722 Ga0268266_10899312
723 Ga0268264_10006216
724 Ga0265318_10008783
725 Ga0265338_10006656
726 Ga0265338_10138903
727 Ga0265338_10596555
728 Ga0265338_11102631
729 Ga0265760_10023636
730 Ga0265760_10110401
731 Ga0265330_10001337
732 Ga0265332_10023777
733 Ga0265332_10215537
734 Ga0265332_10218533
735 Ga0265328_10001245
736 Ga0265328_10176433
737 Ga0265328_10363057
738 Ga0265325_10000925
739 Ga0265325_10100594
740 Ga0265325_10157612
741 Ga0265329_10043958
742 Ga0265340_10001298
743 Ga0265340_10028573
744 Ga0265340_10042145
745 Ga0265340_10079946
746 Ga0265339_10000003
747 Ga0265339_10003140
748 Ga0265339_10014214
749 Ga0265339_10312036
750 Ga0265316_10009816
751 Ga0265316_10019740
752 Ga0265316_10023472
753 Ga0265316_10272964
754 Ga0265316_10393891
755 Ga0265316_10536173
756 Ga0265313_10001307
757 Ga0265313_10213394
758 Ga0265314_10037641
759 Ga0265314_10114874
760 Ga0265314_10291976
761 Ga0265342_10013919
762 Ga0265342_10021660
763 Ga0265342_10071586
764 Ga0316214_1039606
765 Ga0373934_0212370
766 Ga0373932_0347270
767 Ga0373939_0171470
768 Ga0373953_0113592
769 Ga0373953_0345143
770 Ga0373943_0440305
771 Ga0373955_0074077
772 Ga0373924_0465620
773 Ga0373931_0390504
774 Ga0373931_0640128
775 Ga0373935_0270208
776 Ga0373933_0582910
777 Ga0373933_0714231
778 Ga0373937_0038373
779 Ga0373937_0039697
780 Ga0373937_0163071
781 Ga0373937_0622494
782 Ga0373925_0914916
783 Ga0395900_0787235
784 Ga0436364_1419765
785 Ga0436360_0880983
786 Ga0436363_0556994
787 Ga0436362_0986411
788 Ga0453683_0364577
789 Ga0495592_0683321
790 Ga0495629_0042298
791 Ga0495580_0898248
792 Ga0495639_0233891
793 Ga0495586_0349749
794 Ga0495645_0091172
795 Ga0495645_0375487
796 Ga0495667_0188339
797 Ga0495657_0800711
798 Ga0495623_0079519
799 Ga0495669_0332181
800 Ga0495604_0262617
801 Ga0495674_0075587
802 Ga0495684_0399589
803 Ga0495686_0000035
804 Ga0495686_0004378
805 Ga0495686_0046392
806 Ga0495602_0166808
807 Ga0495602_0257102
808 Ga0496101_0620766
809 Ga0496104_0000076
810 Ga0496105_0058989
811 Ga0496106_0973247
812 Ga0496107_0714670
813 Ga0496108_0313170
814 Ga0496108_0888845
815 Ga0496110_0577450
816 Ga0496112_0006343
817 Ga0496112_0624163
818 Ga0496114_0465700
819 Ga0496115_0156782
820 Ga0496126_0000110
821 Ga0496126_0001061
822 nmdc:mga08x19_540203_c1
823 nmdc:mga08x19_56110_c1
824 Ga0500595_031316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ahu-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8606 54 112
4a53-assembly1.cif.gz_A structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6 0.8173 52 113
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.7808 52 110
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.7804 52 110
7uwy-assembly1.cif.gz_A nmr solution structure of the de novo designed small beta-barrel protein 29_bp_sh3 0.7622 44 111
ID Description Score Start End Superfamily
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.8599 56 108 2.30.30.100
4a53A01 Mainly Beta;Roll;SH3 type barrels.; 0.8191 52 111 2.30.30.100
af_P45757_87_154_2.30.30.830 Mainly Beta;Roll;SH3 type barrels.; 0.8107 73 101 2.30.30.830
af_Q2FYW7_1_63_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8048 53 111 2.30.30.100
af_P52133_127_211_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7907 49 113 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2T4LLS1-F1-model_v4 LSM domain protein 0.8083 52 112
AF-Q2FYW7-F1-model_v4 LSM domain protein 0.8043 53 111
AF-A0A1L8MKA6-F1-model_v4 LSM domain protein 0.8002 51 111
AF-A0A7U8SSA8-F1-model_v4 deleted 0.7967 52 113
AF-A0A0M5N8T8-F1-model_v4 deleted 0.7904 53 112

Map