F437809

General Info

Members Datasets Scaffolds Average Seq Length
412 245 824 230

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10087133|Ga0157375_100871333
Length 220
Sequence MQRRNFTSGLVSAGGLWGLAAWPSARAAGITESDAALGVRAALERGAASAVSLLGKSGGFLDNPKVRIPLPGFLNEAAKLAKFTGQQRRVDELVTAMNRAAEAAVPQARALLTNAVRSMGDNSVTQFFAAKTRVPLNARFLPIVTKETAKVSLADKYNALAGKAAATGLLKKDDANIQQYVTGKALDGLYLMIGEEERKIRQNPVATGSAILSKVFGSLR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
171 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
218 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
227 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
228 2547132374 Acidovorax radicis N35 Isolate Unclassified
229 2643221570 Acidovorax sp. Root568 Isolate Unclassified
230 2643221609 Acidovorax sp. Root217 Isolate Unclassified
231 2643221611 Acidovorax sp. Root219 Isolate Unclassified
232 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
233 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
234 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
235 2643221652 Acidovorax sp. Root402 Isolate Unclassified
236 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
237 2643221660 Methylibium sp. Root1272 Isolate Unclassified
238 2643221717 Acidovorax sp. Root267 Isolate Unclassified
239 2738541337 Pelomonas sp. BT06 Isolate Unclassified
240 2831864461 Roseateles noduli HZ7 Isolate Nodule
241 2842733646 Variovorax sp. R-72446 Isolate Unclassified
242 2842747753 Variovorax sp. R-72060 Isolate Unclassified
243 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
244 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
245 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 0.24
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.68
Nodule 0.97
Rhizoplane 0.73
Rhizosphere 45.63
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10087133 3300013308 Bacteria 3174
2 JGI25155J39150_1000031 3300002704 Bacteria 106418
3 JGI25156J39149_1000040 3300002705 Bacteria 106617
4 JGI25154J39366_1000060 3300002738 Bacteria 106617
5 JGI25157J39369_1000058 3300002741 Bacteria 106617
6 JGI25159J45721_1000140 3300002987 Bacteria 33403
7 JGI25159J45721_1001846 3300002987 Bacteria 8465
8 Ga0006778J45830_1055026 3300003162 Bacteria 1929
9 JGI25151J46595_10003714 3300003187 Bacteria 8295
10 JGI25151J46595_10005843 3300003187 Bacteria 6294
11 rootH1_10001728 3300003316 Bacteria 11784
12 rootH2_10001809 3300003320 Bacteria 13966
13 rootL2_10000062 3300003322 Bacteria 27456
14 rootL2_10029867 3300003322 Bacteria 4286
15 rootH1_10003360 3300003323 Bacteria 7493
16 rootH1_10017044 3300003323 Bacteria 11838
17 JGI25160J50197_1000198 3300003354 Bacteria 50243
18 JGI25161J50226_1000021 3300003374 Bacteria 163584
19 Ga0055526_1009325 3300003771 Bacteria 4743
20 Ga0055526_1015450 3300003771 Bacteria 3063
21 Ga0055526_1015722 3300003771 Bacteria 3017
22 Ga0055526_1055789 3300003771 Bacteria 869
23 Ga0055537_1000265 3300003773 Bacteria 38230
24 Ga0055524_1000139 3300003775 Bacteria 86430
25 Ga0055524_1000338 3300003775 Bacteria 43287
26 Ga0055524_1000614 3300003775 Bacteria 25561
27 Ga0055524_1008203 3300003775 Bacteria 4360
28 Ga0055536_1004503 3300003781 Bacteria 7096
29 Ga0055536_1036375 3300003781 Bacteria 1218
30 Ga0055534_1000911 3300003784 Bacteria 13330
31 Ga0055528_1001693 3300003790 Bacteria 12842
32 Ga0055530_10000509 3300003791 Bacteria 33816
33 Ga0055530_10007910 3300003791 Bacteria 4363
34 Ga0055540_1000090 3300003792 Bacteria 99454
35 Ga0055540_1000091 3300003792 Bacteria 99089
36 Ga0055540_1000274 3300003792 Bacteria 46571
37 Ga0055540_1005597 3300003792 Bacteria 5230
38 Ga0055531_10002811 3300003794 Bacteria 11424
39 Ga0055531_10003224 3300003794 Bacteria 10465
40 Ga0055531_10003742 3300003794 Bacteria 9554
41 Ga0055531_10005864 3300003794 Bacteria 7092
42 Ga0055531_10021893 3300003794 Bacteria 2459
43 Ga0055543_1000238 3300004625 Bacteria 42822
44 Ga0055543_1002946 3300004625 Bacteria 5303
45 Ga0065165_1000235 3300005262 Bacteria 96698
46 Ga0065165_1000496 3300005262 Bacteria 60846
47 Ga0065165_1007398 3300005262 Bacteria 5412
48 Ga0065165_1008359 3300005262 Bacteria 4861
49 Ga0065704_10365554 3300005289 Bacteria 790
50 Ga0070676_10221069 3300005328 Bacteria 1251
51 Ga0070676_10233863 3300005328 Bacteria 1219
52 Ga0070670_100260704 3300005331 Unclassified 1511
53 Ga0070677_10004605 3300005333 Bacteria 4508
54 Ga0070666_10073748 3300005335 Bacteria 2325
55 Ga0070661_100010214 3300005344 Bacteria 6522
56 Ga0070668_100618844 3300005347 Bacteria 949
57 Ga0070669_100009870 3300005353 Bacteria 6800
58 Ga0070669_100405444 3300005353 Bacteria 1116
59 Ga0070675_100001482 3300005354 Bacteria 17319
60 Ga0070674_100012232 3300005356 Bacteria 5266
61 Ga0070673_100011049 3300005364 Bacteria 6151
62 Ga0070673_100208758 3300005364 Bacteria 1685
63 Ga0070659_100005081 3300005366 Bacteria 9434
64 Ga0070663_100003133 3300005455 Bacteria 9477
65 Ga0070663_100018262 3300005455 Bacteria 4594
66 Ga0070678_100027436 3300005456 Bacteria 3867
67 Ga0070678_100459486 3300005456 Bacteria 1116
68 Ga0070662_100001654 3300005457 Bacteria 13712
69 Ga0070662_100202236 3300005457 Bacteria 1577
70 Ga0070662_100215834 3300005457 Bacteria 1528
71 Ga0068867_100002317 3300005459 Bacteria 13397
72 Ga0068867_100132034 3300005459 Bacteria 1942
73 Ga0068867_100360329 3300005459 Bacteria 1216
74 Ga0070706_100000367 3300005467 Bacteria 54314
75 Ga0070706_100536786 3300005467 Bacteria 1088
76 Ga0068853_100348093 3300005539 Bacteria 1378
77 Ga0070672_100000485 3300005543 Bacteria 23134
78 Ga0070665_100514228 3300005548 Bacteria 1209
79 Ga0070664_100002915 3300005564 Bacteria 13849
80 Ga0070664_100069438 3300005564 Bacteria 3015
81 Ga0070664_100196841 3300005564 Bacteria 1797
82 Ga0068857_100097449 3300005577 Bacteria 2636
83 Ga0068854_100061852 3300005578 Bacteria 2712
84 Ga0068854_100134601 3300005578 Bacteria 1891
85 Ga0068856_100008694 3300005614 Bacteria 9879
86 Ga0068852_100104534 3300005616 Bacteria 2563
87 Ga0068852_100386559 3300005616 Bacteria 1374
88 Ga0068859_100187630 3300005617 Bacteria 2152
89 Ga0068864_100272298 3300005618 Bacteria 1578
90 Ga0068866_10264243 3300005718 Bacteria 1059
91 Ga0068861_100388683 3300005719 Bacteria 1235
92 Ga0068870_10419541 3300005840 Bacteria 875
93 Ga0068863_100047320 3300005841 Bacteria 4080
94 Ga0068860_100035852 3300005843 Bacteria 4757
95 Ga0068860_100848564 3300005843 Bacteria 928
96 Ga0075363_100000145 3300006048 Bacteria 17501
97 Ga0075363_100112468 3300006048 Bacteria 1514
98 Ga0075363_100140224 3300006048 Bacteria 1361
99 Ga0075364_10048249 3300006051 Bacteria 2774
100 Ga0075362_10011743 3300006177 Bacteria 3457
101 Ga0075362_10053283 3300006177 Bacteria 1815
102 Ga0075367_10002249 3300006178 Bacteria 8731
103 Ga0075367_10040639 3300006178 Bacteria 2716
104 Ga0075366_10000582 3300006195 Bacteria 17130
105 Ga0075366_10018221 3300006195 Bacteria 4051
106 Ga0075366_10042975 3300006195 Bacteria 2676
107 Ga0075366_10118062 3300006195 Bacteria 1598
108 Ga0075366_10151287 3300006195 Bacteria 1405
109 Ga0097621_100048632 3300006237 Bacteria 3442
110 Ga0097621_100884546 3300006237 Bacteria 831
111 Ga0075370_10000854 3300006353 Bacteria 12360
112 Ga0075370_10007981 3300006353 Bacteria 5425
113 Ga0075370_10008475 3300006353 Bacteria 5292
114 Ga0075370_10011221 3300006353 Bacteria 4702
115 Ga0075370_10036759 3300006353 Bacteria 2751
116 Ga0075370_10068866 3300006353 Bacteria 2022
117 Ga0075370_10174071 3300006353 Bacteria 1266
118 Ga0068871_100059839 3300006358 Bacteria 3105
119 Ga0075430_100035051 3300006846 Bacteria 4260
120 Ga0075429_100001726 3300006880 Bacteria 18078
121 Ga0068865_100053358 3300006881 Bacteria 2805
122 Ga0097620_100187616 3300006931 Bacteria 2152
123 Ga0099823_1000003 3300006944 Bacteria 189058
124 Ga0079104_1005464 3300006946 Bacteria 5069
125 Ga0105245_10413263 3300009098 Bacteria 1351
126 Ga0114129_10369273 3300009147 Bacteria 1897
127 Ga0105237_10160741 3300009545 Bacteria 2245
128 Ga0105239_10091245 3300010375 Bacteria 3361
129 Ga0157319_1000002 3300012497 Bacteria 410803
130 Ga0157371_10078847 3300013102 Bacteria 2333
131 Ga0157370_10429675 3300013104 Bacteria 1215
132 Ga0157378_10040522 3300013297 Bacteria 4130
133 Ga0157372_10390070 3300013307 Bacteria 1623
134 Ga0157375_10608280 3300013308 Bacteria 1252
135 Ga0163163_10687341 3300014325 Bacteria 1087
136 Ga0182008_10001996 3300014497 Bacteria 13096
137 Ga0157376_10053709 3300014969 Bacteria 3356
138 Ga0163161_10012105 3300017792 Bacteria 5985
139 Ga0163161_10243392 3300017792 Bacteria 1400
140 Ga0163161_10267084 3300017792 Bacteria 1338
141 Ga0209435_100019 3300025206 Bacteria 260989
142 Ga0209436_115500 3300025208 Bacteria 1176
143 Ga0209563_100014 3300025230 Bacteria 940582
144 Ga0209646_1000038 3300025246 Bacteria 353982
145 Ga0209026_1000048 3300025250 Bacteria 257264
146 Ga0209759_1000038 3300025256 Bacteria 257264
147 Ga0209129_1004774 3300025258 Bacteria 5124
148 Ga0209129_1008371 3300025258 Bacteria 2889
149 Ga0209129_1017475 3300025258 Bacteria 1405
150 Ga0209565_1000309 3300025263 Bacteria 45428
151 Ga0209565_1001566 3300025263 Bacteria 9786
152 Ga0209565_1004921 3300025263 Bacteria 3979
153 Ga0209673_1000088 3300025273 Bacteria 204629
154 Ga0209673_1014859 3300025273 Bacteria 2992
155 Ga0209673_1017666 3300025273 Bacteria 2622
156 Ga0209673_1020442 3300025273 Bacteria 2344
157 Ga0209673_1026312 3300025273 Bacteria 1913
158 Ga0209130_1000103 3300025284 Bacteria 137115
159 Ga0209130_1000920 3300025284 Bacteria 23688
160 Ga0209675_1001254 3300025291 Bacteria 15221
161 Ga0209676_1001499 3300025292 Bacteria 21342
162 Ga0209676_1002299 3300025292 Bacteria 13921
163 Ga0209025_1003677 3300025294 Bacteria 14173
164 Ga0209025_1004241 3300025294 Bacteria 12621
165 Ga0209025_1014316 3300025294 Bacteria 4890
166 Ga0209564_1000392 3300025295 Bacteria 78508
167 Ga0209564_1000702 3300025295 Bacteria 49036
168 Ga0209564_1003145 3300025295 Bacteria 11626
169 Ga0209564_1050431 3300025295 Bacteria 1019
170 Ga0209758_1000769 3300025297 Bacteria 46067
171 Ga0209050_1000008 3300025298 Bacteria 1144179
172 Ga0209050_1000326 3300025298 Bacteria 95495
173 Ga0209050_1001275 3300025298 Bacteria 28904
174 Ga0209050_1006914 3300025298 Bacteria 6556
175 Ga0209050_1013952 3300025298 Bacteria 3515
176 Ga0209256_1000019 3300025299 Bacteria 558627
177 Ga0209256_1000072 3300025299 Bacteria 239812
178 Ga0209256_1000096 3300025299 Bacteria 204629
179 Ga0209256_1000634 3300025299 Bacteria 47973
180 Ga0207426_1000586 3300025302 Bacteria 48467
181 Ga0207426_1004328 3300025302 Bacteria 6996
182 Ga0209051_1000005 3300025303 Bacteria 1142353
183 Ga0209051_1000133 3300025303 Bacteria 139014
184 Ga0209051_1000306 3300025303 Bacteria 77135
185 Ga0209051_1001694 3300025303 Bacteria 17686
186 Ga0209257_1000015 3300025304 Bacteria 908141
187 Ga0209257_1000031 3300025304 Bacteria 688770
188 Ga0209257_1000038 3300025304 Bacteria 609032
189 Ga0209257_1000401 3300025304 Bacteria 84658
190 Ga0209257_1001115 3300025304 Bacteria 34828
191 Ga0209257_1061111 3300025304 Bacteria 1023
192 Ga0207697_10004600 3300025315 Bacteria 6555
193 Ga0207682_10009338 3300025893 Bacteria 3875
194 Ga0207682_10028565 3300025893 Bacteria 2227
195 Ga0207680_10192070 3300025903 Bacteria 1387
196 Ga0207684_10008021 3300025910 Bacteria 9432
197 Ga0207684_10435774 3300025910 Bacteria 1126
198 Ga0207649_10062829 3300025920 Bacteria 2342
199 Ga0207681_10005629 3300025923 Bacteria 7689
200 Ga0207681_10008769 3300025923 Bacteria 6177
201 Ga0207650_10000275 3300025925 Bacteria 53824
202 Ga0207659_10003305 3300025926 Bacteria 9661
203 Ga0207644_10005477 3300025931 Bacteria 8268
204 Ga0207644_10092343 3300025931 Bacteria 2258
205 Ga0207690_10012535 3300025932 Bacteria 5073
206 Ga0207706_10000754 3300025933 Bacteria 33680
207 Ga0207706_10071939 3300025933 Bacteria 3042
208 Ga0207706_10199236 3300025933 Bacteria 1756
209 Ga0207669_10004036 3300025937 Bacteria 6424
210 Ga0207704_10042029 3300025938 Bacteria 2687
211 Ga0207691_10001335 3300025940 Bacteria 24610
212 Ga0207679_10000339 3300025945 Bacteria 34501
213 Ga0207679_10200491 3300025945 Bacteria 1666
214 Ga0207679_10405584 3300025945 Bacteria 1200
215 Ga0207651_10248154 3300025960 Bacteria 1455
216 Ga0207668_10241999 3300025972 Bacteria 1460
217 Ga0207640_10033092 3300025981 Bacteria 3212
218 Ga0207658_10181785 3300025986 Bacteria 1741
219 Ga0207648_10007993 3300026089 Bacteria 10315
220 Ga0207648_10358994 3300026089 Bacteria 1314
221 Ga0207676_10082283 3300026095 Bacteria 2618
222 Ga0207676_10120816 3300026095 Bacteria 2209
223 Ga0207674_10454511 3300026116 Bacteria 1238
224 Ga0207683_10011844 3300026121 Bacteria 7441
225 Ga0207698_10173892 3300026142 Bacteria 1899
226 Ga0207698_10356824 3300026142 Bacteria 1383
227 Ga0207698_10520621 3300026142 Bacteria 1161
228 Ga0209389_1028617 3300027296 Bacteria 4768
229 Ga0209970_1000452 3300027614 Bacteria 7005
230 Ga0210002_1025500 3300027617 Bacteria 967
231 Ga0207428_10227751 3300027907 Bacteria 1396
232 Ga0307517_10009127 3300028786 Bacteria 14120
233 Ga0307517_10051134 3300028786 Bacteria 4180
234 Ga0307517_10060868 3300028786 Bacteria 3583
235 Ga0307517_10141299 3300028786 Bacteria 1689
236 Ga0307515_10011753 3300028794 Bacteria 16566
237 Ga0307515_10146272 3300028794 Bacteria 2500
238 Ga0307515_10233660 3300028794 Bacteria 1625
239 Ga0307513_10000028 3300031456 Bacteria 193264
240 Ga0307513_10000568 3300031456 Bacteria 52926
241 Ga0307513_10010837 3300031456 Bacteria 11385
242 Ga0307513_10018553 3300031456 Bacteria 8309
243 Ga0307513_10083646 3300031456 Bacteria 3281
244 Ga0307513_10109819 3300031456 Bacteria 2755
245 Ga0307513_10338479 3300031456 Bacteria 1256
246 Ga0307513_10432371 3300031456 Bacteria 1044
247 Ga0307509_10000405 3300031507 Bacteria 72472
248 Ga0307509_10024760 3300031507 Bacteria 6716
249 Ga0307509_10032600 3300031507 Bacteria 5740
250 Ga0307509_10038943 3300031507 Bacteria 5181
251 Ga0307509_10107897 3300031507 Bacteria 2798
252 Ga0307509_10119283 3300031507 Bacteria 2619
253 Ga0307509_10202041 3300031507 Bacteria 1823
254 Ga0307408_100010674 3300031548 Bacteria 6057
255 Ga0307408_100089582 3300031548 Bacteria 2319
256 Ga0307408_100169664 3300031548 Bacteria 1741
257 Ga0307508_10007741 3300031616 Bacteria 9985
258 Ga0307508_10015474 3300031616 Bacteria 6948
259 Ga0307508_10086523 3300031616 Bacteria 2718
260 Ga0307514_10000530 3300031649 Bacteria 74660
261 Ga0307514_10051154 3300031649 Bacteria 3203
262 Ga0307516_10001028 3300031730 Bacteria 38713
263 Ga0307516_10020978 3300031730 Bacteria 6740
264 Ga0307516_10104215 3300031730 Bacteria 2649
265 Ga0307413_10224548 3300031824 Bacteria 1374
266 Ga0307410_10014472 3300031852 Bacteria 4643
267 Ga0307406_10000604 3300031901 Bacteria 20514
268 Ga0307406_10037932 3300031901 Bacteria 2980
269 Ga0307406_10051828 3300031901 Bacteria 2607
270 Ga0307412_10227212 3300031911 Bacteria 1435
271 Ga0307412_10268720 3300031911 Unclassified 1333
272 Ga0307409_100321106 3300031995 Bacteria 1449
273 Ga0307416_100744629 3300032002 Bacteria 1072
274 Ga0307507_10069283 3300033179 Bacteria 3211
275 Ga0307510_10003419 3300033180 Bacteria 18519
276 Ga0307510_10033328 3300033180 Bacteria 5786
277 Ga0307510_10038258 3300033180 Bacteria 5306
278 Ga0307510_10128141 3300033180 Bacteria 2220
279 Ga0373928_0011363 3300035084 Bacteria 1761
280 Ga0373932_0010722 3300035112 Bacteria 2225
281 Ga0373931_0007559 3300035691 Bacteria 5117
282 Ga0395905_0409399 3300037471 Bacteria 1251
283 Ga0439436_0000739 3300041404 Bacteria 8808
284 Ga0439439_0039459 3300041406 Bacteria 1220
285 Ga0439461_0027759 3300041410 Bacteria 1163
286 Ga0439466_0005624 3300041411 Bacteria 4781
287 Ga0439465_0002727 3300041413 Bacteria 5774
288 Ga0451795_1587285 3300041456 Bacteria 1232
289 Ga0451802_1066716 3300041460 Bacteria 696
290 Ga0451853_0936850 3300041512 Bacteria 1386
291 Ga0439431_0000511 3300041997 Bacteria 8246
292 Ga0439433_0004335 3300041999 Bacteria 3058
293 Ga0439445_0001177 3300042004 Bacteria 5615
294 Ga0439432_001319 3300042006 Bacteria 9397
295 Ga0439432_065954 3300042006 Bacteria 1109
296 Ga0439449_0000991 3300042007 Bacteria 11160
297 Ga0439449_0003349 3300042007 Bacteria 6245
298 Ga0439449_0006224 3300042007 Bacteria 4560
299 Ga0439452_003019 3300042010 Bacteria 5985
300 Ga0439462_0013351 3300042015 Bacteria 2104
301 Ga0439462_0056499 3300042015 Bacteria 1059
302 Ga0450919_001094 3300042121 Bacteria 3517
303 Ga0450923_090175 3300042125 Bacteria 698
304 Ga0450890_000423 3300042127 Bacteria 6178
305 Ga0450918_001356 3300042531 Bacteria 4904
306 Ga0451577_0000194 3300042876 Bacteria 127614
307 Ga0451577_0218910 3300042876 Bacteria 1721
308 Ga0466969_0000073 3300044656 Bacteria 52700
309 Ga0466972_0001178 3300044658 Bacteria 12542
310 Ga0466966_0119426 3300044684 Bacteria 1620
311 Ga0466963_0082442 3300044694 Bacteria 2180
312 Ga0466963_0206099 3300044694 Bacteria 1375
313 Ga0453684_0000218 3300044712 Bacteria 250267
314 Ga0453684_0019417 3300044712 Bacteria 10351
315 Ga0453684_0037298 3300044712 Bacteria 6673
316 Ga0453684_0126986 3300044712 Bacteria 3067
317 Ga0451576_0001036 3300045051 Bacteria 51297
318 Ga0451576_0411658 3300045051 Bacteria 1418
319 Ga0495627_056720 3300046453 Bacteria 1167
320 Ga0495592_0000528 3300046454 Bacteria 27565
321 Ga0495638_0055223 3300046460 Bacteria 2467
322 Ga0495610_0019994 3300046512 Bacteria 3731
323 Ga0495632_0004766 3300046519 Bacteria 9136
324 Ga0495648_0097729 3300046524 Bacteria 1628
325 Ga0495597_0159045 3300046542 Bacteria 923
326 Ga0495668_0123625 3300046616 Bacteria 1416
327 Ga0495625_0011949 3300046660 Bacteria 7048
328 Ga0495624_0090298 3300046690 Bacteria 1890
329 Ga0495649_0015516 3300046694 Bacteria 4335
330 Ga0495660_0007345 3300046810 Bacteria 6474
331 Ga0495674_0726003 3300047319 Bacteria 778
332 Ga0495676_0014995 3300047321 Bacteria 6916
333 Ga0495687_004859 3300047443 Bacteria 8826
334 Ga0495626_0042463 3300048091 Bacteria 2136
335 Ga0496106_0013343 3300048909 Bacteria 6065
336 Ga0496122_0002564 3300048925 Bacteria 25525
337 Ga0496123_0002427 3300048926 Bacteria 23189
338 Ga0496124_0055529 3300048927 Bacteria 3347
339 Ga0496124_0160369 3300048927 Bacteria 1753
340 Ga0496126_0070649 3300048929 Bacteria 3110
341 Ga0496126_0320173 3300048929 Bacteria 1275
342 Ga0501042_0123411 3300049578 Bacteria 1865
343 Ga0501043_0000277 3300049579 Bacteria 46284
344 Ga0501046_0000345 3300049580 Bacteria 46730
345 Ga0501047_0000395 3300049581 Bacteria 48969
346 Ga0501048_0000111 3300049582 Bacteria 46009
347 Ga0501045_0018065 3300049824 Bacteria 5010
348 nmdc:mga03683_2693_c1 3300050489 Bacteria 5570
349 nmdc:mga03683_29768_c1 3300050489 Bacteria 2180
350 nmdc:mga00v17_131641_c1 3300050491 Bacteria 1599
351 nmdc:mga0k408_11041_c1 3300050493 Bacteria 4906
352 nmdc:mga0k408_1412_c1 3300050493 Bacteria 12975
353 nmdc:mga0k408_162597_c1 3300050493 Bacteria 1330
354 nmdc:mga0k408_1975_c1 3300050493 Bacteria 10995
355 nmdc:mga0k408_2145_c1 3300050493 Bacteria 10579
356 nmdc:mga0k408_247273_c1 3300050493 Bacteria 1065
357 nmdc:mga0k408_39289_c1 3300050493 Bacteria 2718
358 nmdc:mga0k408_47485_c1 3300050493 Bacteria 2482
359 nmdc:mga06z11_111955_c1 3300050494 Bacteria 1513
360 nmdc:mga06z11_3034_c1 3300050494 Bacteria 6460
361 nmdc:mga06z11_52447_c1 3300050494 Bacteria 2093
362 nmdc:mga07m45_1136_c1 3300050496 Bacteria 11938
363 nmdc:mga07m45_132692_c1 3300050496 Bacteria 1441
364 nmdc:mga07m45_14735_c1 3300050496 Bacteria 4173
365 nmdc:mga07m45_1876_c1 3300050496 Bacteria 9712
366 nmdc:mga07m45_320101_c1 3300050496 Bacteria 902
367 nmdc:mga07m45_406956_c1 3300050496 Bacteria 790
368 nmdc:mga07m45_56516_c1 3300050496 Bacteria 2218
369 nmdc:mga09592_1763_c1 3300050508 Bacteria 17376
370 nmdc:mga0qj67_27872_c2 3300050509 Bacteria 3974
371 Ga0500578_0019391 3300053086 Bacteria 4367
372 Ga0500644_0007104 3300053088 Bacteria 2901
373 Ga0500651_0009118 3300053093 Bacteria 5877
374 Ga0500650_0073215 3300053098 Bacteria 1602
375 Ga0500594_0000734 3300053118 Bacteria 6961
376 Ga0500594_0008561 3300053118 Bacteria 2335
377 Ga0500597_080086 3300053120 Bacteria 1417
378 Ga0500607_049625 3300053121 Bacteria 2240
379 Ga0500658_0002749 3300053134 Bacteria 6768
380 Ga0500559_0000265 3300053136 Bacteria 40939
381 Ga0500559_0003422 3300053136 Bacteria 7808
382 Ga0500559_0018940 3300053136 Bacteria 2908
383 Ga0500559_0131724 3300053136 Bacteria 1168
384 Ga0500568_0011378 3300053139 Bacteria 4135
385 Ga0500619_010295 3300053154 Bacteria 2358
386 Ga0500622_0002135 3300053156 Bacteria 14718
387 Ga0500622_0004571 3300053156 Bacteria 8625
388 Ga0500622_0154096 3300053156 Bacteria 1083
389 Ga0500645_000422 3300053730 Bacteria 29281
390 Ga0500645_004503 3300053730 Bacteria 5329
391 Ga0500645_007176 3300053730 Bacteria 3910
392 Ga0500645_022008 3300053730 Bacteria 1964
393 Ga0500661_009009 3300055283 Bacteria 1832
394 2511244139 2511231002 Bacteria 5042903
395 2548501679 2547132374 Bacteria 5530232
396 2643865057 2643221570 Bacteria 5103772
397 2644059087 2643221609 Bacteria 6756331
398 2644075873 2643221611 Bacteria 6820941
399 2644219569 2643221639 Bacteria 6649903
400 2644247320 2643221644 Bacteria 6865017
401 2644255999 2643221646 Bacteria 6433402
402 2644292338 2643221652 Bacteria 5140275
403 2644303484 2643221654 Bacteria 5273570
404 2644338366 2643221660 Bacteria 4208257
405 2644645464 2643221717 Bacteria 5676132
406 2739054457 2738541337 Bacteria 6183410
407 2831868784 2831864461 Bacteria 6502356
408 2842737733 2842733646 Bacteria 5716726
409 2842752888 2842747753 Bacteria 5578255
410 2885197567 2885192300 Bacteria 5882526
411 2886849132 2886848708 Bacteria 5632523
412 2990710951 2990710928 Bacteria 5002431
413 Ga0157375_10087133
414 JGI25155J39150_1000031
415 JGI25156J39149_1000040
416 JGI25154J39366_1000060
417 JGI25157J39369_1000058
418 JGI25159J45721_1000140
419 JGI25159J45721_1001846
420 Ga0006778J45830_1055026
421 JGI25151J46595_10003714
422 JGI25151J46595_10005843
423 rootH1_10001728
424 rootH2_10001809
425 rootL2_10000062
426 rootL2_10029867
427 rootH1_10003360
428 rootH1_10017044
429 JGI25160J50197_1000198
430 JGI25161J50226_1000021
431 Ga0055526_1009325
432 Ga0055526_1015450
433 Ga0055526_1015722
434 Ga0055526_1055789
435 Ga0055537_1000265
436 Ga0055524_1000139
437 Ga0055524_1000338
438 Ga0055524_1000614
439 Ga0055524_1008203
440 Ga0055536_1004503
441 Ga0055536_1036375
442 Ga0055534_1000911
443 Ga0055528_1001693
444 Ga0055530_10000509
445 Ga0055530_10007910
446 Ga0055540_1000090
447 Ga0055540_1000091
448 Ga0055540_1000274
449 Ga0055540_1005597
450 Ga0055531_10002811
451 Ga0055531_10003224
452 Ga0055531_10003742
453 Ga0055531_10005864
454 Ga0055531_10021893
455 Ga0055543_1000238
456 Ga0055543_1002946
457 Ga0065165_1000235
458 Ga0065165_1000496
459 Ga0065165_1007398
460 Ga0065165_1008359
461 Ga0065704_10365554
462 Ga0070676_10221069
463 Ga0070676_10233863
464 Ga0070670_100260704
465 Ga0070677_10004605
466 Ga0070666_10073748
467 Ga0070661_100010214
468 Ga0070668_100618844
469 Ga0070669_100009870
470 Ga0070669_100405444
471 Ga0070675_100001482
472 Ga0070674_100012232
473 Ga0070673_100011049
474 Ga0070673_100208758
475 Ga0070659_100005081
476 Ga0070663_100003133
477 Ga0070663_100018262
478 Ga0070678_100027436
479 Ga0070678_100459486
480 Ga0070662_100001654
481 Ga0070662_100202236
482 Ga0070662_100215834
483 Ga0068867_100002317
484 Ga0068867_100132034
485 Ga0068867_100360329
486 Ga0070706_100000367
487 Ga0070706_100536786
488 Ga0068853_100348093
489 Ga0070672_100000485
490 Ga0070665_100514228
491 Ga0070664_100002915
492 Ga0070664_100069438
493 Ga0070664_100196841
494 Ga0068857_100097449
495 Ga0068854_100061852
496 Ga0068854_100134601
497 Ga0068856_100008694
498 Ga0068852_100104534
499 Ga0068852_100386559
500 Ga0068859_100187630
501 Ga0068864_100272298
502 Ga0068866_10264243
503 Ga0068861_100388683
504 Ga0068870_10419541
505 Ga0068863_100047320
506 Ga0068860_100035852
507 Ga0068860_100848564
508 Ga0075363_100000145
509 Ga0075363_100112468
510 Ga0075363_100140224
511 Ga0075364_10048249
512 Ga0075362_10011743
513 Ga0075362_10053283
514 Ga0075367_10002249
515 Ga0075367_10040639
516 Ga0075366_10000582
517 Ga0075366_10018221
518 Ga0075366_10042975
519 Ga0075366_10118062
520 Ga0075366_10151287
521 Ga0097621_100048632
522 Ga0097621_100884546
523 Ga0075370_10000854
524 Ga0075370_10007981
525 Ga0075370_10008475
526 Ga0075370_10011221
527 Ga0075370_10036759
528 Ga0075370_10068866
529 Ga0075370_10174071
530 Ga0068871_100059839
531 Ga0075430_100035051
532 Ga0075429_100001726
533 Ga0068865_100053358
534 Ga0097620_100187616
535 Ga0099823_1000003
536 Ga0079104_1005464
537 Ga0105245_10413263
538 Ga0114129_10369273
539 Ga0105237_10160741
540 Ga0105239_10091245
541 Ga0157319_1000002
542 Ga0157371_10078847
543 Ga0157370_10429675
544 Ga0157378_10040522
545 Ga0157372_10390070
546 Ga0157375_10608280
547 Ga0163163_10687341
548 Ga0182008_10001996
549 Ga0157376_10053709
550 Ga0163161_10012105
551 Ga0163161_10243392
552 Ga0163161_10267084
553 Ga0209435_100019
554 Ga0209436_115500
555 Ga0209563_100014
556 Ga0209646_1000038
557 Ga0209026_1000048
558 Ga0209759_1000038
559 Ga0209129_1004774
560 Ga0209129_1008371
561 Ga0209129_1017475
562 Ga0209565_1000309
563 Ga0209565_1001566
564 Ga0209565_1004921
565 Ga0209673_1000088
566 Ga0209673_1014859
567 Ga0209673_1017666
568 Ga0209673_1020442
569 Ga0209673_1026312
570 Ga0209130_1000103
571 Ga0209130_1000920
572 Ga0209675_1001254
573 Ga0209676_1001499
574 Ga0209676_1002299
575 Ga0209025_1003677
576 Ga0209025_1004241
577 Ga0209025_1014316
578 Ga0209564_1000392
579 Ga0209564_1000702
580 Ga0209564_1003145
581 Ga0209564_1050431
582 Ga0209758_1000769
583 Ga0209050_1000008
584 Ga0209050_1000326
585 Ga0209050_1001275
586 Ga0209050_1006914
587 Ga0209050_1013952
588 Ga0209256_1000019
589 Ga0209256_1000072
590 Ga0209256_1000096
591 Ga0209256_1000634
592 Ga0207426_1000586
593 Ga0207426_1004328
594 Ga0209051_1000005
595 Ga0209051_1000133
596 Ga0209051_1000306
597 Ga0209051_1001694
598 Ga0209257_1000015
599 Ga0209257_1000031
600 Ga0209257_1000038
601 Ga0209257_1000401
602 Ga0209257_1001115
603 Ga0209257_1061111
604 Ga0207697_10004600
605 Ga0207682_10009338
606 Ga0207682_10028565
607 Ga0207680_10192070
608 Ga0207684_10008021
609 Ga0207684_10435774
610 Ga0207649_10062829
611 Ga0207681_10005629
612 Ga0207681_10008769
613 Ga0207650_10000275
614 Ga0207659_10003305
615 Ga0207644_10005477
616 Ga0207644_10092343
617 Ga0207690_10012535
618 Ga0207706_10000754
619 Ga0207706_10071939
620 Ga0207706_10199236
621 Ga0207669_10004036
622 Ga0207704_10042029
623 Ga0207691_10001335
624 Ga0207679_10000339
625 Ga0207679_10200491
626 Ga0207679_10405584
627 Ga0207651_10248154
628 Ga0207668_10241999
629 Ga0207640_10033092
630 Ga0207658_10181785
631 Ga0207648_10007993
632 Ga0207648_10358994
633 Ga0207676_10082283
634 Ga0207676_10120816
635 Ga0207674_10454511
636 Ga0207683_10011844
637 Ga0207698_10173892
638 Ga0207698_10356824
639 Ga0207698_10520621
640 Ga0209389_1028617
641 Ga0209970_1000452
642 Ga0210002_1025500
643 Ga0207428_10227751
644 Ga0307517_10009127
645 Ga0307517_10051134
646 Ga0307517_10060868
647 Ga0307517_10141299
648 Ga0307515_10011753
649 Ga0307515_10146272
650 Ga0307515_10233660
651 Ga0307513_10000028
652 Ga0307513_10000568
653 Ga0307513_10010837
654 Ga0307513_10018553
655 Ga0307513_10083646
656 Ga0307513_10109819
657 Ga0307513_10338479
658 Ga0307513_10432371
659 Ga0307509_10000405
660 Ga0307509_10024760
661 Ga0307509_10032600
662 Ga0307509_10038943
663 Ga0307509_10107897
664 Ga0307509_10119283
665 Ga0307509_10202041
666 Ga0307408_100010674
667 Ga0307408_100089582
668 Ga0307408_100169664
669 Ga0307508_10007741
670 Ga0307508_10015474
671 Ga0307508_10086523
672 Ga0307514_10000530
673 Ga0307514_10051154
674 Ga0307516_10001028
675 Ga0307516_10020978
676 Ga0307516_10104215
677 Ga0307413_10224548
678 Ga0307410_10014472
679 Ga0307406_10000604
680 Ga0307406_10037932
681 Ga0307406_10051828
682 Ga0307412_10227212
683 Ga0307412_10268720
684 Ga0307409_100321106
685 Ga0307416_100744629
686 Ga0307507_10069283
687 Ga0307510_10003419
688 Ga0307510_10033328
689 Ga0307510_10038258
690 Ga0307510_10128141
691 Ga0373928_0011363
692 Ga0373932_0010722
693 Ga0373931_0007559
694 Ga0395905_0409399
695 Ga0439436_0000739
696 Ga0439439_0039459
697 Ga0439461_0027759
698 Ga0439466_0005624
699 Ga0439465_0002727
700 Ga0451795_1587285
701 Ga0451802_1066716
702 Ga0451853_0936850
703 Ga0439431_0000511
704 Ga0439433_0004335
705 Ga0439445_0001177
706 Ga0439432_001319
707 Ga0439432_065954
708 Ga0439449_0000991
709 Ga0439449_0003349
710 Ga0439449_0006224
711 Ga0439452_003019
712 Ga0439462_0013351
713 Ga0439462_0056499
714 Ga0450919_001094
715 Ga0450923_090175
716 Ga0450890_000423
717 Ga0450918_001356
718 Ga0451577_0000194
719 Ga0451577_0218910
720 Ga0466969_0000073
721 Ga0466972_0001178
722 Ga0466966_0119426
723 Ga0466963_0082442
724 Ga0466963_0206099
725 Ga0453684_0000218
726 Ga0453684_0019417
727 Ga0453684_0037298
728 Ga0453684_0126986
729 Ga0451576_0001036
730 Ga0451576_0411658
731 Ga0495627_056720
732 Ga0495592_0000528
733 Ga0495638_0055223
734 Ga0495610_0019994
735 Ga0495632_0004766
736 Ga0495648_0097729
737 Ga0495597_0159045
738 Ga0495668_0123625
739 Ga0495625_0011949
740 Ga0495624_0090298
741 Ga0495649_0015516
742 Ga0495660_0007345
743 Ga0495674_0726003
744 Ga0495676_0014995
745 Ga0495687_004859
746 Ga0495626_0042463
747 Ga0496106_0013343
748 Ga0496122_0002564
749 Ga0496123_0002427
750 Ga0496124_0055529
751 Ga0496124_0160369
752 Ga0496126_0070649
753 Ga0496126_0320173
754 Ga0501042_0123411
755 Ga0501043_0000277
756 Ga0501046_0000345
757 Ga0501047_0000395
758 Ga0501048_0000111
759 Ga0501045_0018065
760 nmdc:mga03683_2693_c1
761 nmdc:mga03683_29768_c1
762 nmdc:mga00v17_131641_c1
763 nmdc:mga0k408_11041_c1
764 nmdc:mga0k408_1412_c1
765 nmdc:mga0k408_162597_c1
766 nmdc:mga0k408_1975_c1
767 nmdc:mga0k408_2145_c1
768 nmdc:mga0k408_247273_c1
769 nmdc:mga0k408_39289_c1
770 nmdc:mga0k408_47485_c1
771 nmdc:mga06z11_111955_c1
772 nmdc:mga06z11_3034_c1
773 nmdc:mga06z11_52447_c1
774 nmdc:mga07m45_1136_c1
775 nmdc:mga07m45_132692_c1
776 nmdc:mga07m45_14735_c1
777 nmdc:mga07m45_1876_c1
778 nmdc:mga07m45_320101_c1
779 nmdc:mga07m45_406956_c1
780 nmdc:mga07m45_56516_c1
781 nmdc:mga09592_1763_c1
782 nmdc:mga0qj67_27872_c2
783 Ga0500578_0019391
784 Ga0500644_0007104
785 Ga0500651_0009118
786 Ga0500650_0073215
787 Ga0500594_0000734
788 Ga0500594_0008561
789 Ga0500597_080086
790 Ga0500607_049625
791 Ga0500658_0002749
792 Ga0500559_0000265
793 Ga0500559_0003422
794 Ga0500559_0018940
795 Ga0500559_0131724
796 Ga0500568_0011378
797 Ga0500619_010295
798 Ga0500622_0002135
799 Ga0500622_0004571
800 Ga0500622_0154096
801 Ga0500645_000422
802 Ga0500645_004503
803 Ga0500645_007176
804 Ga0500645_022008
805 Ga0500661_009009
806 2511244139
807 2548501679
808 2643865057
809 2644059087
810 2644075873
811 2644219569
812 2644247320
813 2644255999
814 2644292338
815 2644303484
816 2644338366
817 2644645464
818 2739054457
819 2831868784
820 2842737733
821 2842752888
822 2885197567
823 2886849132
824 2990710951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13852

DUF4197

Protein of unknown function (DUF4197)

29

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wlw-assembly1.cif.gz_2 the vo region of human v-atpase in state 1 (focused refinement) 0.3695 41 209
6xby-assembly1.cif.gz_g cryo-em structure of v-atpase from bovine brain, state 2 0.3648 41 212
6pe4-assembly1.cif.gz_H yeast vo motor in complex with 1 vopq molecule 0.3644 42 216
7uzf-assembly1.cif.gz_n rat kidney v-atpase with sidk, state 1 0.3613 42 212
6wm4-assembly1.cif.gz_2 human v-atpase in state 3 with sidk and adp 0.3508 45 212
ID Description Score Start End Superfamily
af_Q9LJR0_1_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3799 41 167 1.20.120.550
af_P06728_180_332_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.3797 42 170 1.20.120.20
af_P0AA93_45_200_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3671 96 226 1.10.1760.20
af_Q9LJR0_1_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3399 41 167 1.20.120.550
af_P06728_180_332_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.3324 42 170 1.20.120.20
ID Description Score Start End GO Terms
AF-A0A7S1HGS7-F1-model_v4 Uncharacterized protein 0.9794 48 153
AF-A0A315AIV8-F1-model_v4 DUF4197 domain-containing protein 0.979 33 237
AF-A0A656K504-F1-model_v4 Tail tape measure protein 0.9722 45 165
AF-A0A3B8HIQ7-F1-model_v4 DUF4197 domain-containing protein 0.9659 33 236
AF-A0A656K504-F1-model_v4 Tail tape measure protein 0.9568 45 165

Map