F437812

General Info

Members Datasets Scaffolds Average Seq Length
412 184 412 157

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10000281|Ga0163163_1000028129
Length 174
Sequence VDCCTSTFEFLIFTFDFSMQIQIGQLAPDFTLYDTEKKQHSLHDYKGSNVLILFFPLAFTSTCTKELCSVRDNIAFYNNSNAQVLGISVDSVYTLGRYKSDQGLNFTLLSDFNKEVSAQYGSLYETFGLGMKGVSKRSAFIIDKEGVIRYAEVLENASEVPNFEAIQGVLGRLT

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
174 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 2.43
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10020079 3300003322 Unclassified 3931
2 rootL2_10156579 3300003322 Bacteria 3990
3 rootL2_10265127 3300003322 Bacteria 2440
4 rootL2_10356099 3300003322 Unclassified 1148
5 Ga0065712_10102439 3300005290 Bacteria 2009
6 Ga0065712_10131287 3300005290 Bacteria 1547
7 Ga0070658_10510589 3300005327 Bacteria 1039
8 Ga0070676_10053857 3300005328 Bacteria 2371
9 Ga0070676_10515734 3300005328 Bacteria 851
10 Ga0070676_10857182 3300005328 Unclassified 674
11 Ga0070683_100011874 3300005329 Bacteria 7549
12 Ga0070683_100029872 3300005329 Bacteria 4941
13 Ga0070683_101082061 3300005329 Bacteria 770
14 Ga0070690_100010667 3300005330 Bacteria 5353
15 Ga0070690_100069961 3300005330 Bacteria 2278
16 Ga0070690_100182327 3300005330 Bacteria 1451
17 Ga0070670_100047757 3300005331 Unclassified 3684
18 Ga0070670_100569522 3300005331 Bacteria 1012
19 Ga0068869_100012195 3300005334 Bacteria 5671
20 Ga0068869_100016045 3300005334 Bacteria 5041
21 Ga0068869_100053941 3300005334 Unclassified 2924
22 Ga0068869_100166167 3300005334 Bacteria 1721
23 Ga0068869_100192411 3300005334 Bacteria 1605
24 Ga0068869_101228199 3300005334 Bacteria 659
25 Ga0070666_10001826 3300005335 Bacteria 12979
26 Ga0070666_10081816 3300005335 Unclassified 2208
27 Ga0070666_10108945 3300005335 Bacteria 1914
28 Ga0070682_100041697 3300005337 Bacteria 2831
29 Ga0068868_100067834 3300005338 Bacteria 2839
30 Ga0068868_100086357 3300005338 Bacteria 2522
31 Ga0068868_100090519 3300005338 Bacteria 2464
32 Ga0068868_100090686 3300005338 Unclassified 2462
33 Ga0070660_100010648 3300005339 Bacteria 6503
34 Ga0070689_100031269 3300005340 Bacteria 4045
35 Ga0070689_100146846 3300005340 Bacteria 1900
36 Ga0070689_100858900 3300005340 Bacteria 801
37 Ga0070689_101182918 3300005340 Bacteria 686
38 Ga0070687_100244327 3300005343 Bacteria 1112
39 Ga0070661_100000395 3300005344 Bacteria 33843
40 Ga0070661_100010605 3300005344 Bacteria 6409
41 Ga0070661_100018585 3300005344 Bacteria 4943
42 Ga0070668_100131162 3300005347 Bacteria 2012
43 Ga0070669_100036802 3300005353 Unclassified 3548
44 Ga0070669_100432608 3300005353 Bacteria 1082
45 Ga0070675_100086181 3300005354 Unclassified 2625
46 Ga0070675_100282044 3300005354 Bacteria 1460
47 Ga0070671_100003971 3300005355 Bacteria 11647
48 Ga0070671_100011917 3300005355 Bacteria 6993
49 Ga0070671_100378463 3300005355 Bacteria 1210
50 Ga0070671_100511067 3300005355 Bacteria 1034
51 Ga0070671_101328672 3300005355 Unclassified 634
52 Ga0070674_100094436 3300005356 Bacteria 2166
53 Ga0070674_100228063 3300005356 Bacteria 1452
54 Ga0070673_100012579 3300005364 Bacteria 5814
55 Ga0070673_100082715 3300005364 Unclassified 2606
56 Ga0070673_100204649 3300005364 Bacteria 1701
57 Ga0070673_100449145 3300005364 Unclassified 1159
58 Ga0070688_100008418 3300005365 Bacteria 5595
59 Ga0070688_100015756 3300005365 Unclassified 4309
60 Ga0070688_100521564 3300005365 Unclassified 899
61 Ga0070659_100046876 3300005366 Bacteria 3388
62 Ga0070667_100015154 3300005367 Bacteria 6367
63 Ga0070667_100325324 3300005367 Bacteria 1388
64 Ga0070700_100527012 3300005441 Bacteria 914
65 Ga0070663_100078392 3300005455 Bacteria 2421
66 Ga0070678_100029294 3300005456 Unclassified 3768
67 Ga0070678_101321143 3300005456 Bacteria 671
68 Ga0070662_100005669 3300005457 Bacteria 7992
69 Ga0070662_100031312 3300005457 Unclassified 3733
70 Ga0070681_10082314 3300005458 Bacteria 3174
71 Ga0068867_100017762 3300005459 Bacteria 5050
72 Ga0068867_100026401 3300005459 Unclassified 4170
73 Ga0068867_100032255 3300005459 Bacteria 3787
74 Ga0068867_100450097 3300005459 Unclassified 1097
75 Ga0068867_100514515 3300005459 Bacteria 1031
76 Ga0070685_10149956 3300005466 Bacteria 1477
77 Ga0070684_100000134 3300005535 Bacteria 49154
78 Ga0070684_100003170 3300005535 Bacteria 12297
79 Ga0070684_100012580 3300005535 Bacteria 6788
80 Ga0070684_100302032 3300005535 Bacteria 1469
81 Ga0070684_100500956 3300005535 Bacteria 1125
82 Ga0068853_100001259 3300005539 Bacteria 18115
83 Ga0068853_100031827 3300005539 Bacteria 4464
84 Ga0068853_100493725 3300005539 Bacteria 1155
85 Ga0068853_100668904 3300005539 Bacteria 989
86 Ga0068853_101088022 3300005539 Unclassified 771
87 Ga0070672_100106315 3300005543 Bacteria 2283
88 Ga0070672_101481242 3300005543 Bacteria 608
89 Ga0070686_100010690 3300005544 Bacteria 5188
90 Ga0070686_100799263 3300005544 Bacteria 760
91 Ga0070665_100596875 3300005548 Bacteria 1117
92 Ga0068855_100321857 3300005563 Bacteria 1709
93 Ga0068855_102176303 3300005563 Unclassified 557
94 Ga0070664_100000327 3300005564 Bacteria 34498
95 Ga0070664_100021830 3300005564 Bacteria 5278
96 Ga0070664_100027141 3300005564 Bacteria 4757
97 Ga0070664_100030603 3300005564 Bacteria 4491
98 Ga0070664_100087874 3300005564 Bacteria 2688
99 Ga0068857_100096449 3300005577 Bacteria 2650
100 Ga0068857_100140353 3300005577 Unclassified 2184
101 Ga0068857_100397247 3300005577 Bacteria 1282
102 Ga0068857_100400923 3300005577 Bacteria 1276
103 Ga0068854_100016937 3300005578 Unclassified 4869
104 Ga0068854_100116902 3300005578 Bacteria 2019
105 Ga0068856_100611089 3300005614 Bacteria 1111
106 Ga0070702_100279166 3300005615 Bacteria 1146
107 Ga0068852_100029837 3300005616 Unclassified 4483
108 Ga0068852_100043078 3300005616 Bacteria 3826
109 Ga0068852_100643712 3300005616 Bacteria 1067
110 Ga0068859_100012477 3300005617 Bacteria 8547
111 Ga0068859_100132568 3300005617 Bacteria 2564
112 Ga0068859_100170741 3300005617 Bacteria 2255
113 Ga0068864_100015251 3300005618 Bacteria 6391
114 Ga0068864_100368975 3300005618 Bacteria 1358
115 Ga0068864_100715702 3300005618 Bacteria 979
116 Ga0068866_10024315 3300005718 Bacteria 2831
117 Ga0068866_10030496 3300005718 Bacteria 2589
118 Ga0068866_10372762 3300005718 Bacteria 913
119 Ga0068861_100557083 3300005719 Bacteria 1046
120 Ga0068861_102210379 3300005719 Bacteria 551
121 Ga0068851_10168525 3300005834 Bacteria 1207
122 Ga0068870_10077080 3300005840 Bacteria 1833
123 Ga0068863_100044204 3300005841 Unclassified 4228
124 Ga0068863_100056393 3300005841 Unclassified 3719
125 Ga0068863_100277652 3300005841 Bacteria 1623
126 Ga0068863_100688195 3300005841 Bacteria 1016
127 Ga0068858_100032156 3300005842 Bacteria 4874
128 Ga0068858_100118861 3300005842 Bacteria 2471
129 Ga0068858_101519212 3300005842 Bacteria 660
130 Ga0068860_100141182 3300005843 Bacteria 2315
131 Ga0068860_100189612 3300005843 Bacteria 1989
132 Ga0068860_100190102 3300005843 Unclassified 1987
133 Ga0068860_100390008 3300005843 Bacteria 1376
134 Ga0068862_100086062 3300005844 Bacteria 2732
135 Ga0068862_100913397 3300005844 Bacteria 864
136 Ga0075366_10133430 3300006195 Bacteria 1499
137 Ga0097621_100001082 3300006237 Bacteria 19034
138 Ga0097621_100026215 3300006237 Bacteria 4570
139 Ga0097621_100121408 3300006237 Unclassified 2216
140 Ga0097621_100208379 3300006237 Bacteria 1699
141 Ga0068871_100000076 3300006358 Bacteria 55186
142 Ga0068871_100022246 3300006358 Unclassified 4888
143 Ga0068871_100166168 3300006358 Bacteria 1889
144 Ga0068871_100233035 3300006358 Bacteria 1599
145 Ga0068871_100414106 3300006358 Bacteria 1202
146 Ga0075434_100055677 3300006871 Bacteria 3930
147 Ga0068865_100031492 3300006881 Bacteria 3537
148 Ga0068865_100076835 3300006881 Bacteria 2385
149 Ga0097620_100012477 3300006931 Bacteria 8547
150 Ga0097620_100132572 3300006931 Bacteria 2564
151 Ga0097620_100170744 3300006931 Bacteria 2255
152 Ga0075435_100212079 3300007076 Bacteria 1643
153 Ga0105251_10156238 3300009011 Bacteria 1029
154 Ga0105251_10449612 3300009011 Bacteria 597
155 Ga0105240_10000011 3300009093 Bacteria 523646
156 Ga0105240_11924260 3300009093 Bacteria 615
157 Ga0105243_11170470 3300009148 Bacteria 781
158 Ga0105241_10357242 3300009174 Bacteria 1270
159 Ga0105241_10391966 3300009174 Bacteria 1216
160 Ga0105241_11150828 3300009174 Bacteria 733
161 Ga0105242_10025037 3300009176 Bacteria 4717
162 Ga0105242_10159532 3300009176 Bacteria 1973
163 Ga0105242_10421905 3300009176 Bacteria 1250
164 Ga0105248_10005454 3300009177 Bacteria 13977
165 Ga0105248_10298092 3300009177 Bacteria 1815
166 Ga0105237_10408235 3300009545 Bacteria 1363
167 Ga0105237_11047145 3300009545 Bacteria 823
168 Ga0105238_10425368 3300009551 Bacteria 1323
169 Ga0105249_10062966 3300009553 Bacteria 3406
170 Ga0105249_10123469 3300009553 Unclassified 2463
171 Ga0105249_11339621 3300009553 Bacteria 787
172 Ga0105239_10000122 3300010375 Bacteria 109167
173 Ga0105239_10137063 3300010375 Unclassified 2725
174 Ga0105239_10325970 3300010375 Bacteria 1732
175 Ga0105239_11093823 3300010375 Bacteria 917
176 Ga0105239_13320784 3300010375 Bacteria 524
177 Ga0105246_10028182 3300011119 Unclassified 3688
178 Ga0157373_10037622 3300013100 Bacteria 3469
179 Ga0157373_10613677 3300013100 Bacteria 792
180 Ga0157371_10280133 3300013102 Bacteria 1204
181 Ga0157371_10830687 3300013102 Bacteria 698
182 Ga0157369_10057872 3300013105 Bacteria 4181
183 Ga0157374_10001176 3300013296 Bacteria 22324
184 Ga0157374_10002087 3300013296 Bacteria 16807
185 Ga0157374_10147380 3300013296 Bacteria 2287
186 Ga0157374_10163298 3300013296 Bacteria 2170
187 Ga0157378_10014089 3300013297 Bacteria 7000
188 Ga0157378_10082968 3300013297 Bacteria 2899
189 Ga0157378_10175865 3300013297 Bacteria 2011
190 Ga0157378_10556198 3300013297 Bacteria 1153
191 Ga0163162_10000214 3300013306 Bacteria 53543
192 Ga0163162_10000621 3300013306 Bacteria 32911
193 Ga0163162_10005646 3300013306 Bacteria 12085
194 Ga0163162_10101862 3300013306 Bacteria 2964
195 Ga0163162_10229047 3300013306 Bacteria 1988
196 Ga0163162_10344672 3300013306 Bacteria 1622
197 Ga0163162_10615389 3300013306 Bacteria 1212
198 Ga0157372_10306009 3300013307 Bacteria 1849
199 Ga0157372_11300247 3300013307 Bacteria 839
200 Ga0157372_12166373 3300013307 Unclassified 639
201 Ga0157375_10000125 3300013308 Bacteria 75607
202 Ga0157375_10028180 3300013308 Bacteria 5260
203 Ga0157375_10046135 3300013308 Bacteria 4246
204 Ga0157375_10127132 3300013308 Bacteria 2665
205 Ga0157375_10614577 3300013308 Bacteria 1245
206 Ga0157375_10623686 3300013308 Bacteria 1236
207 Ga0157375_11118408 3300013308 Unclassified 923
208 Ga0157375_11210310 3300013308 Unclassified 886
209 Ga0163163_10000281 3300014325 Bacteria 50719
210 Ga0163163_10000448 3300014325 Bacteria 37700
211 Ga0163163_10054004 3300014325 Unclassified 3968
212 Ga0163163_10407172 3300014325 Bacteria 1419
213 Ga0157380_10000088 3300014326 Bacteria 50565
214 Ga0157380_10020990 3300014326 Bacteria 4893
215 Ga0157377_10004734 3300014745 Bacteria 6300
216 Ga0157377_10100393 3300014745 Bacteria 1723
217 Ga0157377_10701761 3300014745 Bacteria 735
218 Ga0157379_10027878 3300014968 Bacteria 5027
219 Ga0157379_10033868 3300014968 Unclassified 4555
220 Ga0157379_10049350 3300014968 Unclassified 3758
221 Ga0157379_11443411 3300014968 Unclassified 668
222 Ga0157379_11701587 3300014968 Bacteria 618
223 Ga0157376_10001405 3300014969 Bacteria 15829
224 Ga0157376_10065154 3300014969 Bacteria 3075
225 Ga0157376_11616809 3300014969 Bacteria 682
226 Ga0163161_10000612 3300017792 Bacteria 28547
227 Ga0163161_10001802 3300017792 Bacteria 15639
228 Ga0163161_10056035 3300017792 Bacteria 2862
229 Ga0163161_10321517 3300017792 Bacteria 1223
230 Ga0207697_10224786 3300025315 Bacteria 828
231 Ga0207682_10004328 3300025893 Bacteria 5967
232 Ga0207642_10006052 3300025899 Unclassified 3998
233 Ga0207642_10432706 3300025899 Bacteria 794
234 Ga0207688_10365409 3300025901 Bacteria 891
235 Ga0207680_10018313 3300025903 Unclassified 3720
236 Ga0207680_10079548 3300025903 Unclassified 2056
237 Ga0207647_10096222 3300025904 Unclassified 1762
238 Ga0207647_10141951 3300025904 Bacteria 1407
239 Ga0207645_10007714 3300025907 Bacteria 7580
240 Ga0207645_10082191 3300025907 Bacteria 2065
241 Ga0207643_10508435 3300025908 Bacteria 770
242 Ga0207643_10653241 3300025908 Unclassified 679
243 Ga0207654_10478543 3300025911 Bacteria 877
244 Ga0207707_10177624 3300025912 Bacteria 1859
245 Ga0207695_10000010 3300025913 Bacteria 981919
246 Ga0207695_11393796 3300025913 Bacteria 581
247 Ga0207662_10275173 3300025918 Bacteria 1112
248 Ga0207657_10001260 3300025919 Bacteria 27067
249 Ga0207657_10159088 3300025919 Bacteria 1835
250 Ga0207649_10006671 3300025920 Bacteria 6273
251 Ga0207649_10111540 3300025920 Bacteria 1828
252 Ga0207649_10222106 3300025920 Bacteria 1346
253 Ga0207681_10044488 3300025923 Bacteria 2976
254 Ga0207650_10078903 3300025925 Unclassified 2492
255 Ga0207650_10410919 3300025925 Bacteria 1122
256 Ga0207659_10172309 3300025926 Bacteria 1708
257 Ga0207659_10211228 3300025926 Unclassified 1555
258 Ga0207659_10276080 3300025926 Bacteria 1372
259 Ga0207644_10267261 3300025931 Bacteria 1369
260 Ga0207644_10302981 3300025931 Bacteria 1288
261 Ga0207644_10483447 3300025931 Bacteria 1020
262 Ga0207690_10087315 3300025932 Bacteria 2194
263 Ga0207690_10325529 3300025932 Bacteria 1209
264 Ga0207690_10335275 3300025932 Bacteria 1192
265 Ga0207706_10000633 3300025933 Bacteria 37294
266 Ga0207706_10004767 3300025933 Bacteria 12702
267 Ga0207706_10013033 3300025933 Bacteria 7567
268 Ga0207706_10114351 3300025933 Bacteria 2374
269 Ga0207686_10120774 3300025934 Bacteria 1783
270 Ga0207686_10382044 3300025934 Bacteria 1068
271 Ga0207686_10630333 3300025934 Bacteria 846
272 Ga0207709_10262131 3300025935 Bacteria 1268
273 Ga0207670_10028004 3300025936 Unclassified 3571
274 Ga0207670_10034123 3300025936 Unclassified 3285
275 Ga0207670_10943470 3300025936 Bacteria 724
276 Ga0207669_10177579 3300025937 Bacteria 1523
277 Ga0207669_10215793 3300025937 Bacteria 1404
278 Ga0207704_10185164 3300025938 Bacteria 1509
279 Ga0207704_10460855 3300025938 Bacteria 1016
280 Ga0207704_10719758 3300025938 Bacteria 828
281 Ga0207691_10091989 3300025940 Unclassified 2717
282 Ga0207691_10123234 3300025940 Bacteria 2294
283 Ga0207711_10151536 3300025941 Unclassified 2093
284 Ga0207711_10383345 3300025941 Bacteria 1305
285 Ga0207689_10006672 3300025942 Bacteria 10179
286 Ga0207689_10027421 3300025942 Bacteria 4768
287 Ga0207689_10086986 3300025942 Bacteria 2568
288 Ga0207689_10202651 3300025942 Bacteria 1638
289 Ga0207689_10228812 3300025942 Bacteria 1537
290 Ga0207689_11297914 3300025942 Bacteria 612
291 Ga0207661_10000092 3300025944 Bacteria 57540
292 Ga0207661_10034101 3300025944 Bacteria 3955
293 Ga0207661_10034398 3300025944 Bacteria 3940
294 Ga0207661_10548757 3300025944 Bacteria 1059
295 Ga0207661_10619685 3300025944 Bacteria 994
296 Ga0207679_10000146 3300025945 Bacteria 58219
297 Ga0207679_10032941 3300025945 Bacteria 3643
298 Ga0207679_10148541 3300025945 Bacteria 1904
299 Ga0207679_10282699 3300025945 Bacteria 1423
300 Ga0207679_10801222 3300025945 Bacteria 859
301 Ga0207667_10163156 3300025949 Unclassified 2291
302 Ga0207667_11735563 3300025949 Unclassified 590
303 Ga0207651_10022122 3300025960 Unclassified 3880
304 Ga0207651_10146084 3300025960 Bacteria 1834
305 Ga0207651_10428137 3300025960 Unclassified 1131
306 Ga0207651_11349951 3300025960 Bacteria 641
307 Ga0207712_10513088 3300025961 Bacteria 1026
308 Ga0207640_10037140 3300025981 Bacteria 3063
309 Ga0207640_10387139 3300025981 Bacteria 1135
310 Ga0207640_10458508 3300025981 Bacteria 1052
311 Ga0207658_10010829 3300025986 Bacteria 6205
312 Ga0207658_10060074 3300025986 Unclassified 2835
313 Ga0207658_10709838 3300025986 Bacteria 909
314 Ga0207677_10081708 3300026023 Bacteria 2320
315 Ga0207677_10181829 3300026023 Bacteria 1655
316 Ga0207677_11373587 3300026023 Bacteria 650
317 Ga0207703_10032666 3300026035 Bacteria 4119
318 Ga0207703_10847188 3300026035 Bacteria 874
319 Ga0207639_10009404 3300026041 Bacteria 6742
320 Ga0207639_10071822 3300026041 Bacteria 2709
321 Ga0207639_10089871 3300026041 Bacteria 2455
322 Ga0207639_10321817 3300026041 Bacteria 1373
323 Ga0207639_10536024 3300026041 Bacteria 1073
324 Ga0207678_10057736 3300026067 Bacteria 3340
325 Ga0207678_10384437 3300026067 Bacteria 1214
326 Ga0207708_10870125 3300026075 Bacteria 779
327 Ga0207702_10100606 3300026078 Bacteria 2551
328 Ga0207641_10106613 3300026088 Unclassified 2477
329 Ga0207641_10130375 3300026088 Unclassified 2257
330 Ga0207641_10854769 3300026088 Bacteria 902
331 Ga0207641_10883239 3300026088 Unclassified 887
332 Ga0207648_10000488 3300026089 Bacteria 44152
333 Ga0207648_10019021 3300026089 Bacteria 6202
334 Ga0207648_10036480 3300026089 Bacteria 4331
335 Ga0207648_10101077 3300026089 Unclassified 2527
336 Ga0207648_10329240 3300026089 Bacteria 1374
337 Ga0207648_10835883 3300026089 Bacteria 858
338 Ga0207676_10010857 3300026095 Bacteria 6496
339 Ga0207676_10023316 3300026095 Bacteria 4565
340 Ga0207676_10974114 3300026095 Bacteria 835
341 Ga0207674_10032624 3300026116 Bacteria 5460
342 Ga0207674_10095593 3300026116 Bacteria 2957
343 Ga0207674_10165181 3300026116 Bacteria 2168
344 Ga0207675_100079095 3300026118 Unclassified 3081
345 Ga0207675_100098954 3300026118 Bacteria 2747
346 Ga0207675_100233501 3300026118 Bacteria 1775
347 Ga0207675_100299591 3300026118 Bacteria 1566
348 Ga0207683_10006400 3300026121 Bacteria 10085
349 Ga0207698_10248367 3300026142 Bacteria 1626
350 Ga0207698_10278633 3300026142 Bacteria 1546
351 Ga0207698_10297477 3300026142 Bacteria 1501
352 Ga0207698_10446607 3300026142 Bacteria 1247
353 Ga0268265_10128471 3300028380 Bacteria 2102
354 Ga0268265_10220634 3300028380 Bacteria 1659
355 Ga0268265_10508285 3300028380 Bacteria 1137
356 Ga0268264_10082578 3300028381 Bacteria 2750
357 Ga0268264_10091658 3300028381 Unclassified 2622
358 Ga0268264_10372215 3300028381 Bacteria 1366
359 Ga0265327_10000030 3300031251 Bacteria 333531
360 Ga0265327_10073185 3300031251 Bacteria 1710
361 Ga0307509_10363888 3300031507 Viruses 1165
362 Ga0307508_10000992 3300031616 Bacteria 32986
363 Ga0265314_10432974 3300031711 Unclassified 704
364 Ga0307410_10056113 3300031852 Unclassified 2677
365 Ga0307414_10623925 3300032004 Bacteria 969
366 Ga0307411_10202154 3300032005 Bacteria 1527
367 Ga0373936_0130841 3300035113 Bacteria 1078
368 Ga0373953_0165562 3300035117 Bacteria 951
369 Ga0373943_0143996 3300035170 Bacteria 1286
370 Ga0373924_0150731 3300035410 Bacteria 1017
371 Ga0373935_0062204 3300035692 Bacteria 2391
372 Ga0373933_0083277 3300035724 Bacteria 1964
373 Ga0373937_0067006 3300036401 Unclassified 3307
374 Ga0395901_1103909 3300038443 Bacteria 764
375 Ga0451798_0298967 3300041458 Bacteria 976
376 Ga0451800_0839339 3300041459 Unclassified 745
377 Ga0466960_0021738 3300044901 Bacteria 2861
378 Ga0451576_0000003 3300045051 Bacteria 1550573
379 Ga0495638_0093327 3300046460 Unclassified 1810
380 Ga0495638_0111906 3300046460 Unclassified 1621
381 Ga0495608_0073299 3300046511 Bacteria 2233
382 Ga0495628_0288801 3300046516 Bacteria 1216
383 Ga0495630_0015082 3300046517 Bacteria 5638
384 Ga0495640_0145478 3300046533 Bacteria 1525
385 Ga0495587_0311739 3300046536 Bacteria 879
386 Ga0495598_0276418 3300046537 Unclassified 629
387 Ga0495625_0420409 3300046660 Bacteria 831
388 Ga0495684_0041842 3300047471 Unclassified 3511
389 Ga0495686_0188673 3300047472 Bacteria 1189
390 Ga0496101_0341226 3300048904 Bacteria 1177
391 Ga0496107_0872559 3300048910 Unclassified 657
392 Ga0496109_0647044 3300048912 Bacteria 994
393 Ga0496110_0084727 3300048913 Bacteria 2829
394 Ga0496110_0153018 3300048913 Bacteria 2089
395 Ga0496111_0369097 3300048914 Bacteria 1062
396 Ga0496112_0819885 3300048915 Bacteria 855
397 Ga0496112_1065447 3300048915 Unclassified 727
398 Ga0501219_000117 3300049703 Bacteria 14038
399 Ga0501225_0188604 3300049705 Bacteria 648
400 Ga0501241_005248 3300049758 Bacteria 2419
401 Ga0501284_00018 3300050005 Bacteria 93729
402 nmdc:mga0k408_183389_c1 3300050493 Bacteria 1248
403 nmdc:mga08y16_445905_c1 3300050511 Bacteria 1320
404 nmdc:mga0n895_51103_c1 3300050512 Bacteria 4054
405 nmdc:mga0rr50_436275_c1 3300050513 Bacteria 1109
406 Ga0500651_0195321 3300053093 Unclassified 1196
407 Ga0500641_0005915 3300053096 Bacteria 4329
408 Ga0500568_0000895 3300053139 Bacteria 20694
409 Ga0500568_0065793 3300053139 Bacteria 1395
410 Ga0500588_0039959 3300053146 Bacteria 1407
411 Ga0500616_0116231 3300053153 Bacteria 1284
412 Ga0500611_000005 3300053727 Bacteria 228837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10156579 rootL2_101565794 152
2 3300005456 Ga0070678_101321143 Ga0070678_1013211431 153
3 3300013308 Ga0157375_11210310 Ga0157375_112103102 153
4 3300041459 Ga0451800_0839339 Ga0451800_0839339_216_680 153
5 3300005365 Ga0070688_100521564 Ga0070688_1005215641 154
6 3300005563 Ga0068855_102176303 Ga0068855_1021763031 154
7 3300009553 Ga0105249_10062966 Ga0105249_100629664 154
8 3300013306 Ga0163162_10615389 Ga0163162_106153892 154
9 3300017792 Ga0163161_10056035 Ga0163161_100560352 154
10 3300025934 Ga0207686_10630333 Ga0207686_106303331 154
11 3300025949 Ga0207667_11735563 Ga0207667_117355631 154
12 3300045051 Ga0451576_0000003 Ga0451576_0000003_863289_863756 154
13 3300050005 Ga0501284_00018 Ga0501284_00018_79537_80001 154
14 3300025925 Ga0207650_10078903 Ga0207650_100789032 155
15 3300047472 Ga0495686_0188673 Ga0495686_0188673_467_934 155
16 3300053096 Ga0500641_0005915 Ga0500641_0005915_3327_3794 155
17 3300003322 rootL2_10265127 rootL2_102651272 156
18 3300003322 rootL2_10356099 rootL2_103560992 156
19 3300005290 Ga0065712_10102439 Ga0065712_101024392 156
20 3300005290 Ga0065712_10131287 Ga0065712_101312873 156
21 3300005327 Ga0070658_10510589 Ga0070658_105105892 156
22 3300005328 Ga0070676_10053857 Ga0070676_100538572 156
23 3300005328 Ga0070676_10515734 Ga0070676_105157342 156
24 3300005328 Ga0070676_10857182 Ga0070676_108571822 156
25 3300005329 Ga0070683_100011874 Ga0070683_1000118746 156
26 3300005329 Ga0070683_100029872 Ga0070683_1000298722 156
27 3300005330 Ga0070690_100010667 Ga0070690_1000106675 156
28 3300005330 Ga0070690_100069961 Ga0070690_1000699613 156
29 3300005330 Ga0070690_100182327 Ga0070690_1001823272 156
30 3300005331 Ga0070670_100047757 Ga0070670_1000477572 156
31 3300005331 Ga0070670_100569522 Ga0070670_1005695222 156
32 3300005334 Ga0068869_100012195 Ga0068869_1000121952 156
33 3300005334 Ga0068869_100016045 Ga0068869_1000160455 156
34 3300005334 Ga0068869_100053941 Ga0068869_1000539413 156
35 3300005334 Ga0068869_100166167 Ga0068869_1001661672 156
36 3300005334 Ga0068869_101228199 Ga0068869_1012281991 156
37 3300005335 Ga0070666_10001826 Ga0070666_1000182610 156
38 3300005335 Ga0070666_10081816 Ga0070666_100818162 156
39 3300005337 Ga0070682_100041697 Ga0070682_1000416973 156
40 3300005338 Ga0068868_100067834 Ga0068868_1000678342 156
41 3300005338 Ga0068868_100086357 Ga0068868_1000863573 156
42 3300005338 Ga0068868_100090519 Ga0068868_1000905194 156
43 3300005338 Ga0068868_100090686 Ga0068868_1000906861 156
44 3300005339 Ga0070660_100010648 Ga0070660_1000106484 156
45 3300005340 Ga0070689_100031269 Ga0070689_1000312695 156
46 3300005340 Ga0070689_100146846 Ga0070689_1001468463 156
47 3300005340 Ga0070689_100858900 Ga0070689_1008589002 156
48 3300005340 Ga0070689_101182918 Ga0070689_1011829181 156
49 3300005343 Ga0070687_100244327 Ga0070687_1002443271 156
50 3300005344 Ga0070661_100010605 Ga0070661_1000106057 156
51 3300005344 Ga0070661_100018585 Ga0070661_1000185853 156
52 3300005353 Ga0070669_100036802 Ga0070669_1000368025 156
53 3300005353 Ga0070669_100432608 Ga0070669_1004326081 156
54 3300005354 Ga0070675_100086181 Ga0070675_1000861813 156
55 3300005354 Ga0070675_100282044 Ga0070675_1002820442 156
56 3300005355 Ga0070671_100011917 Ga0070671_1000119173 156
57 3300005355 Ga0070671_100378463 Ga0070671_1003784632 156
58 3300005355 Ga0070671_100511067 Ga0070671_1005110672 156
59 3300005355 Ga0070671_101328672 Ga0070671_1013286721 156
60 3300005356 Ga0070674_100094436 Ga0070674_1000944363 156
61 3300005356 Ga0070674_100228063 Ga0070674_1002280633 156
62 3300005364 Ga0070673_100012579 Ga0070673_1000125794 156
63 3300005364 Ga0070673_100082715 Ga0070673_1000827152 156
64 3300005364 Ga0070673_100204649 Ga0070673_1002046491 156
65 3300005364 Ga0070673_100449145 Ga0070673_1004491452 156
66 3300005365 Ga0070688_100008418 Ga0070688_1000084184 156
67 3300005365 Ga0070688_100015756 Ga0070688_1000157565 156
68 3300005366 Ga0070659_100046876 Ga0070659_1000468764 156
69 3300005367 Ga0070667_100015154 Ga0070667_1000151544 156
70 3300005367 Ga0070667_100325324 Ga0070667_1003253241 156
71 3300005455 Ga0070663_100078392 Ga0070663_1000783923 156
72 3300005457 Ga0070662_100005669 Ga0070662_1000056696 156
73 3300005457 Ga0070662_100031312 Ga0070662_1000313124 156
74 3300005458 Ga0070681_10082314 Ga0070681_100823143 156
75 3300005459 Ga0068867_100026401 Ga0068867_1000264012 156
76 3300005459 Ga0068867_100032255 Ga0068867_1000322551 156
77 3300005459 Ga0068867_100514515 Ga0068867_1005145152 156
78 3300005466 Ga0070685_10149956 Ga0070685_101499561 156
79 3300005535 Ga0070684_100003170 Ga0070684_1000031705 156
80 3300005535 Ga0070684_100012580 Ga0070684_1000125807 156
81 3300005535 Ga0070684_100302032 Ga0070684_1003020323 156
82 3300005535 Ga0070684_100500956 Ga0070684_1005009562 156
83 3300005539 Ga0068853_100493725 Ga0068853_1004937252 156
84 3300005539 Ga0068853_100668904 Ga0068853_1006689042 156
85 3300005539 Ga0068853_101088022 Ga0068853_1010880221 156
86 3300005543 Ga0070672_100106315 Ga0070672_1001063153 156
87 3300005543 Ga0070672_101481242 Ga0070672_1014812421 156
88 3300005544 Ga0070686_100010690 Ga0070686_1000106904 156
89 3300005548 Ga0070665_100596875 Ga0070665_1005968752 156
90 3300005563 Ga0068855_100321857 Ga0068855_1003218573 156
91 3300005564 Ga0070664_100021830 Ga0070664_1000218304 156
92 3300005564 Ga0070664_100027141 Ga0070664_1000271416 156
93 3300005564 Ga0070664_100030603 Ga0070664_1000306034 156
94 3300005564 Ga0070664_100087874 Ga0070664_1000878743 156
95 3300005577 Ga0068857_100096449 Ga0068857_1000964494 156
96 3300005577 Ga0068857_100397247 Ga0068857_1003972471 156
97 3300005577 Ga0068857_100400923 Ga0068857_1004009231 156
98 3300005578 Ga0068854_100016937 Ga0068854_1000169374 156
99 3300005578 Ga0068854_100116902 Ga0068854_1001169023 156
100 3300005615 Ga0070702_100279166 Ga0070702_1002791661 156
101 3300005616 Ga0068852_100029837 Ga0068852_1000298374 156
102 3300005616 Ga0068852_100043078 Ga0068852_1000430783 156
103 3300005616 Ga0068852_100643712 Ga0068852_1006437122 156
104 3300005617 Ga0068859_100012477 Ga0068859_1000124775 156
105 3300005617 Ga0068859_100132568 Ga0068859_1001325684 156
106 3300005617 Ga0068859_100170741 Ga0068859_1001707413 156
107 3300005618 Ga0068864_100015251 Ga0068864_1000152517 156
108 3300005618 Ga0068864_100368975 Ga0068864_1003689752 156
109 3300005618 Ga0068864_100715702 Ga0068864_1007157021 156
110 3300005718 Ga0068866_10030496 Ga0068866_100304963 156
111 3300005718 Ga0068866_10372762 Ga0068866_103727622 156
112 3300005719 Ga0068861_100557083 Ga0068861_1005570832 156
113 3300005719 Ga0068861_102210379 Ga0068861_1022103791 156
114 3300005834 Ga0068851_10168525 Ga0068851_101685252 156
115 3300005840 Ga0068870_10077080 Ga0068870_100770802 156
116 3300005841 Ga0068863_100056393 Ga0068863_1000563933 156
117 3300005841 Ga0068863_100277652 Ga0068863_1002776523 156
118 3300005841 Ga0068863_100688195 Ga0068863_1006881951 156
119 3300005842 Ga0068858_100032156 Ga0068858_1000321564 156
120 3300005842 Ga0068858_100118861 Ga0068858_1001188613 156
121 3300005842 Ga0068858_101519212 Ga0068858_1015192121 156
122 3300005843 Ga0068860_100141182 Ga0068860_1001411824 156
123 3300005843 Ga0068860_100189612 Ga0068860_1001896122 156
124 3300005843 Ga0068860_100190102 Ga0068860_1001901023 156
125 3300005844 Ga0068862_100913397 Ga0068862_1009133972 156
126 3300006237 Ga0097621_100026215 Ga0097621_1000262154 156
127 3300006237 Ga0097621_100121408 Ga0097621_1001214083 156
128 3300006237 Ga0097621_100208379 Ga0097621_1002083792 156
129 3300006358 Ga0068871_100022246 Ga0068871_1000222464 156
130 3300006358 Ga0068871_100166168 Ga0068871_1001661683 156
131 3300006358 Ga0068871_100233035 Ga0068871_1002330352 156
132 3300006358 Ga0068871_100414106 Ga0068871_1004141061 156
133 3300006871 Ga0075434_100055677 Ga0075434_1000556774 156
134 3300006881 Ga0068865_100031492 Ga0068865_1000314923 156
135 3300006931 Ga0097620_100012477 Ga0097620_1000124775 156
136 3300006931 Ga0097620_100132572 Ga0097620_1001325724 156
137 3300006931 Ga0097620_100170744 Ga0097620_1001707442 156
138 3300007076 Ga0075435_100212079 Ga0075435_1002120793 156
139 3300009011 Ga0105251_10156238 Ga0105251_101562382 156
140 3300009011 Ga0105251_10449612 Ga0105251_104496121 156
141 3300009093 Ga0105240_10000011 Ga0105240_10000011107 156
142 3300009174 Ga0105241_10357242 Ga0105241_103572422 156
143 3300009174 Ga0105241_10391966 Ga0105241_103919662 156
144 3300009174 Ga0105241_11150828 Ga0105241_111508282 156
145 3300009176 Ga0105242_10025037 Ga0105242_100250373 156
146 3300009177 Ga0105248_10298092 Ga0105248_102980923 156
147 3300009545 Ga0105237_10408235 Ga0105237_104082351 156
148 3300009545 Ga0105237_11047145 Ga0105237_110471451 156
149 3300009551 Ga0105238_10425368 Ga0105238_104253681 156
150 3300009553 Ga0105249_10123469 Ga0105249_101234692 156
151 3300009553 Ga0105249_11339621 Ga0105249_113396211 156
152 3300010375 Ga0105239_10000122 Ga0105239_1000012275 156
153 3300010375 Ga0105239_10137063 Ga0105239_101370632 156
154 3300010375 Ga0105239_10325970 Ga0105239_103259702 156
155 3300010375 Ga0105239_11093823 Ga0105239_110938231 156
156 3300010375 Ga0105239_13320784 Ga0105239_133207841 156
157 3300011119 Ga0105246_10028182 Ga0105246_100281823 156
158 3300013100 Ga0157373_10037622 Ga0157373_100376223 156
159 3300013100 Ga0157373_10613677 Ga0157373_106136771 156
160 3300013102 Ga0157371_10280133 Ga0157371_102801331 156
161 3300013102 Ga0157371_10830687 Ga0157371_108306871 156
162 3300013105 Ga0157369_10057872 Ga0157369_100578722 156
163 3300013296 Ga0157374_10001176 Ga0157374_100011766 156
164 3300013296 Ga0157374_10002087 Ga0157374_1000208712 156
165 3300013296 Ga0157374_10147380 Ga0157374_101473802 156
166 3300013296 Ga0157374_10163298 Ga0157374_101632981 156
167 3300013297 Ga0157378_10082968 Ga0157378_100829682 156
168 3300013297 Ga0157378_10175865 Ga0157378_101758652 156
169 3300013297 Ga0157378_10556198 Ga0157378_105561982 156
170 3300013306 Ga0163162_10000621 Ga0163162_1000062128 156
171 3300013306 Ga0163162_10005646 Ga0163162_100056467 156
172 3300013306 Ga0163162_10101862 Ga0163162_101018623 156
173 3300013306 Ga0163162_10229047 Ga0163162_102290471 156
174 3300013306 Ga0163162_10344672 Ga0163162_103446721 156
175 3300013307 Ga0157372_10306009 Ga0157372_103060091 156
176 3300013307 Ga0157372_11300247 Ga0157372_113002472 156
177 3300013308 Ga0157375_10028180 Ga0157375_100281804 156
178 3300013308 Ga0157375_10046135 Ga0157375_100461355 156
179 3300013308 Ga0157375_10127132 Ga0157375_101271323 156
180 3300013308 Ga0157375_10614577 Ga0157375_106145772 156
181 3300013308 Ga0157375_10623686 Ga0157375_106236862 156
182 3300014325 Ga0163163_10000281 Ga0163163_1000028129 156
183 3300014325 Ga0163163_10000448 Ga0163163_1000044830 156
184 3300014325 Ga0163163_10054004 Ga0163163_100540043 156
185 3300014325 Ga0163163_10407172 Ga0163163_104071721 156
186 3300014326 Ga0157380_10000088 Ga0157380_100000886 156
187 3300014326 Ga0157380_10020990 Ga0157380_100209904 156
188 3300014745 Ga0157377_10004734 Ga0157377_100047345 156
189 3300014745 Ga0157377_10100393 Ga0157377_101003931 156
190 3300014745 Ga0157377_10701761 Ga0157377_107017611 156
191 3300014968 Ga0157379_10027878 Ga0157379_100278786 156
192 3300014968 Ga0157379_10033868 Ga0157379_100338683 156
193 3300014968 Ga0157379_11443411 Ga0157379_114434111 156
194 3300014968 Ga0157379_11701587 Ga0157379_117015872 156
195 3300014969 Ga0157376_10065154 Ga0157376_100651543 156
196 3300014969 Ga0157376_11616809 Ga0157376_116168091 156
197 3300017792 Ga0163161_10001802 Ga0163161_1000180210 156
198 3300017792 Ga0163161_10321517 Ga0163161_103215172 156
199 3300025315 Ga0207697_10224786 Ga0207697_102247861 156
200 3300025893 Ga0207682_10004328 Ga0207682_100043286 156
201 3300025899 Ga0207642_10006052 Ga0207642_100060524 156
202 3300025899 Ga0207642_10432706 Ga0207642_104327061 156
203 3300025901 Ga0207688_10365409 Ga0207688_103654092 156
204 3300025903 Ga0207680_10018313 Ga0207680_100183133 156
205 3300025903 Ga0207680_10079548 Ga0207680_100795483 156
206 3300025904 Ga0207647_10096222 Ga0207647_100962223 156
207 3300025904 Ga0207647_10141951 Ga0207647_101419512 156
208 3300025907 Ga0207645_10007714 Ga0207645_100077142 156
209 3300025908 Ga0207643_10508435 Ga0207643_105084351 156
210 3300025911 Ga0207654_10478543 Ga0207654_104785431 156
211 3300025912 Ga0207707_10177624 Ga0207707_101776244 156
212 3300025913 Ga0207695_10000010 Ga0207695_10000010495 156
213 3300025918 Ga0207662_10275173 Ga0207662_102751731 156
214 3300025919 Ga0207657_10001260 Ga0207657_1000126022 156
215 3300025920 Ga0207649_10111540 Ga0207649_101115403 156
216 3300025920 Ga0207649_10222106 Ga0207649_102221062 156
217 3300025923 Ga0207681_10044488 Ga0207681_100444882 156
218 3300025925 Ga0207650_10410919 Ga0207650_104109191 156
219 3300025926 Ga0207659_10172309 Ga0207659_101723092 156
220 3300025926 Ga0207659_10211228 Ga0207659_102112283 156
221 3300025926 Ga0207659_10276080 Ga0207659_102760803 156
222 3300025931 Ga0207644_10267261 Ga0207644_102672612 156
223 3300025931 Ga0207644_10483447 Ga0207644_104834472 156
224 3300025932 Ga0207690_10087315 Ga0207690_100873152 156
225 3300025932 Ga0207690_10325529 Ga0207690_103255292 156
226 3300025933 Ga0207706_10000633 Ga0207706_1000063310 156
227 3300025933 Ga0207706_10004767 Ga0207706_100047674 156
228 3300025933 Ga0207706_10013033 Ga0207706_100130336 156
229 3300025933 Ga0207706_10114351 Ga0207706_101143513 156
230 3300025934 Ga0207686_10382044 Ga0207686_103820442 156
231 3300025936 Ga0207670_10028004 Ga0207670_100280042 156
232 3300025936 Ga0207670_10034123 Ga0207670_100341232 156
233 3300025936 Ga0207670_10943470 Ga0207670_109434701 156
234 3300025937 Ga0207669_10177579 Ga0207669_101775793 156
235 3300025937 Ga0207669_10215793 Ga0207669_102157932 156
236 3300025938 Ga0207704_10460855 Ga0207704_104608552 156
237 3300025940 Ga0207691_10091989 Ga0207691_100919892 156
238 3300025940 Ga0207691_10123234 Ga0207691_101232342 156
239 3300025941 Ga0207711_10383345 Ga0207711_103833452 156
240 3300025942 Ga0207689_10006672 Ga0207689_100066725 156
241 3300025942 Ga0207689_10027421 Ga0207689_100274212 156
242 3300025942 Ga0207689_10086986 Ga0207689_100869862 156
243 3300025942 Ga0207689_10202651 Ga0207689_102026513 156
244 3300025942 Ga0207689_10228812 Ga0207689_102288122 156
245 3300025942 Ga0207689_11297914 Ga0207689_112979141 156
246 3300025944 Ga0207661_10034101 Ga0207661_100341011 156
247 3300025944 Ga0207661_10034398 Ga0207661_100343984 156
248 3300025944 Ga0207661_10619685 Ga0207661_106196851 156
249 3300025945 Ga0207679_10032941 Ga0207679_100329414 156
250 3300025945 Ga0207679_10148541 Ga0207679_101485412 156
251 3300025945 Ga0207679_10282699 Ga0207679_102826992 156
252 3300025945 Ga0207679_10801222 Ga0207679_108012222 156
253 3300025949 Ga0207667_10163156 Ga0207667_101631562 156
254 3300025960 Ga0207651_10022122 Ga0207651_100221224 156
255 3300025960 Ga0207651_10146084 Ga0207651_101460842 156
256 3300025960 Ga0207651_10428137 Ga0207651_104281372 156
257 3300025960 Ga0207651_11349951 Ga0207651_113499511 156
258 3300025961 Ga0207712_10513088 Ga0207712_105130881 156
259 3300025981 Ga0207640_10037140 Ga0207640_100371403 156
260 3300025981 Ga0207640_10458508 Ga0207640_104585082 156
261 3300025986 Ga0207658_10060074 Ga0207658_100600741 156
262 3300025986 Ga0207658_10709838 Ga0207658_107098381 156
263 3300026023 Ga0207677_10081708 Ga0207677_100817084 156
264 3300026023 Ga0207677_10181829 Ga0207677_101818292 156
265 3300026023 Ga0207677_11373587 Ga0207677_113735871 156
266 3300026035 Ga0207703_10032666 Ga0207703_100326664 156
267 3300026035 Ga0207703_10847188 Ga0207703_108471881 156
268 3300026041 Ga0207639_10071822 Ga0207639_100718222 156
269 3300026041 Ga0207639_10089871 Ga0207639_100898713 156
270 3300026041 Ga0207639_10536024 Ga0207639_105360241 156
271 3300026067 Ga0207678_10057736 Ga0207678_100577364 156
272 3300026067 Ga0207678_10384437 Ga0207678_103844373 156
273 3300026075 Ga0207708_10870125 Ga0207708_108701251 156
274 3300026078 Ga0207702_10100606 Ga0207702_101006063 156
275 3300026088 Ga0207641_10130375 Ga0207641_101303752 156
276 3300026088 Ga0207641_10854769 Ga0207641_108547692 156
277 3300026088 Ga0207641_10883239 Ga0207641_108832391 156
278 3300026089 Ga0207648_10019021 Ga0207648_100190214 156
279 3300026089 Ga0207648_10036480 Ga0207648_100364804 156
280 3300026089 Ga0207648_10101077 Ga0207648_101010771 156
281 3300026089 Ga0207648_10329240 Ga0207648_103292402 156
282 3300026095 Ga0207676_10010857 Ga0207676_100108574 156
283 3300026095 Ga0207676_10023316 Ga0207676_100233161 156
284 3300026095 Ga0207676_10974114 Ga0207676_109741141 156
285 3300026116 Ga0207674_10032624 Ga0207674_100326244 156
286 3300026116 Ga0207674_10095593 Ga0207674_100955933 156
287 3300026118 Ga0207675_100098954 Ga0207675_1000989542 156
288 3300026118 Ga0207675_100233501 Ga0207675_1002335014 156
289 3300026118 Ga0207675_100299591 Ga0207675_1002995912 156
290 3300026121 Ga0207683_10006400 Ga0207683_100064004 156
291 3300026142 Ga0207698_10248367 Ga0207698_102483672 156
292 3300026142 Ga0207698_10278633 Ga0207698_102786332 156
293 3300026142 Ga0207698_10297477 Ga0207698_102974771 156
294 3300026142 Ga0207698_10446607 Ga0207698_104466072 156
295 3300028380 Ga0268265_10128471 Ga0268265_101284713 156
296 3300028380 Ga0268265_10220634 Ga0268265_102206341 156
297 3300028381 Ga0268264_10082578 Ga0268264_100825783 156
298 3300028381 Ga0268264_10091658 Ga0268264_100916583 156
299 3300031507 Ga0307509_10363888 Ga0307509_103638882 156
300 3300031616 Ga0307508_10000992 Ga0307508_1000099213 156
301 3300032004 Ga0307414_10623925 Ga0307414_106239251 156
302 3300035170 Ga0373943_0143996 Ga0373943_0143996_143_613 156
303 3300035410 Ga0373924_0150731 Ga0373924_0150731_298_768 156
304 3300035692 Ga0373935_0062204 Ga0373935_0062204_379_849 156
305 3300035724 Ga0373933_0083277 Ga0373933_0083277_485_955 156
306 3300036401 Ga0373937_0067006 Ga0373937_0067006_963_1433 156
307 3300038443 Ga0395901_1103909 Ga0395901_1103909_56_526 156
308 3300041458 Ga0451798_0298967 Ga0451798_0298967_265_735 156
309 3300044901 Ga0466960_0021738 Ga0466960_0021738_119_589 156
310 3300046460 Ga0495638_0093327 Ga0495638_0093327_654_1124 156
311 3300046460 Ga0495638_0111906 Ga0495638_0111906_602_1072 156
312 3300046511 Ga0495608_0073299 Ga0495608_0073299_14_484 156
313 3300046516 Ga0495628_0288801 Ga0495628_0288801_178_648 156
314 3300046517 Ga0495630_0015082 Ga0495630_0015082_3416_3886 156
315 3300046533 Ga0495640_0145478 Ga0495640_0145478_568_1038 156
316 3300046536 Ga0495587_0311739 Ga0495587_0311739_342_812 156
317 3300046537 Ga0495598_0276418 Ga0495598_0276418_15_485 156
318 3300046660 Ga0495625_0420409 Ga0495625_0420409_280_750 156
319 3300047471 Ga0495684_0041842 Ga0495684_0041842_1708_2178 156
320 3300048904 Ga0496101_0341226 Ga0496101_0341226_479_949 156
321 3300048910 Ga0496107_0872559 Ga0496107_0872559_174_644 156
322 3300048912 Ga0496109_0647044 Ga0496109_0647044_172_642 156
323 3300048913 Ga0496110_0084727 Ga0496110_0084727_2098_2568 156
324 3300048913 Ga0496110_0153018 Ga0496110_0153018_1317_1787 156
325 3300048914 Ga0496111_0369097 Ga0496111_0369097_419_889 156
326 3300048915 Ga0496112_0819885 Ga0496112_0819885_170_640 156
327 3300048915 Ga0496112_1065447 Ga0496112_1065447_88_558 156
328 3300049703 Ga0501219_000117 Ga0501219_000117_11852_12322 156
329 3300049705 Ga0501225_0188604 Ga0501225_0188604_41_511 156
330 3300049758 Ga0501241_005248 Ga0501241_005248_1736_2206 156
331 3300050511 nmdc:mga08y16_445905_c1 nmdc:mga08y16_445905_c1_275_745 156
332 3300050512 nmdc:mga0n895_51103_c1 nmdc:mga0n895_51103_c1_875_1345 156
333 3300050513 nmdc:mga0rr50_436275_c1 nmdc:mga0rr50_436275_c1_421_891 156
334 3300053093 Ga0500651_0195321 Ga0500651_0195321_649_1119 156
335 3300053139 Ga0500568_0000895 Ga0500568_0000895_13191_13661 156
336 3300053146 Ga0500588_0039959 Ga0500588_0039959_697_1167 156
337 3300053153 Ga0500616_0116231 Ga0500616_0116231_514_984 156
338 3300053727 Ga0500611_000005 Ga0500611_000005_142649_143119 156
339 3300005329 Ga0070683_101082061 Ga0070683_1010820611 157
340 3300005539 Ga0068853_100031827 Ga0068853_1000318274 157
341 3300005614 Ga0068856_100611089 Ga0068856_1006110891 157
342 3300009093 Ga0105240_11924260 Ga0105240_119242601 157
343 3300025913 Ga0207695_11393796 Ga0207695_113937961 157
344 3300025944 Ga0207661_10548757 Ga0207661_105487571 157
345 3300026041 Ga0207639_10321817 Ga0207639_103218172 157
346 3300031251 Ga0265327_10000030 Ga0265327_10000030243 157
347 3300031251 Ga0265327_10073185 Ga0265327_100731852 157
348 3300031711 Ga0265314_10432974 Ga0265314_104329742 157
349 3300035117 Ga0373953_0165562 Ga0373953_0165562_273_746 157
350 3300053139 Ga0500568_0065793 Ga0500568_0065793_365_838 157
351 3300003322 rootL2_10020079 rootL2_100200793 158
352 3300005334 Ga0068869_100192411 Ga0068869_1001924113 158
353 3300005335 Ga0070666_10108945 Ga0070666_101089452 158
354 3300005344 Ga0070661_100000395 Ga0070661_1000003954 158
355 3300005347 Ga0070668_100131162 Ga0070668_1001311623 158
356 3300005355 Ga0070671_100003971 Ga0070671_1000039713 158
357 3300005441 Ga0070700_100527012 Ga0070700_1005270121 158
358 3300005456 Ga0070678_100029294 Ga0070678_1000292943 158
359 3300005459 Ga0068867_100017762 Ga0068867_1000177624 158
360 3300005459 Ga0068867_100450097 Ga0068867_1004500972 158
361 3300005535 Ga0070684_100000134 Ga0070684_10000013429 158
362 3300005539 Ga0068853_100001259 Ga0068853_1000012595 158
363 3300005544 Ga0070686_100799263 Ga0070686_1007992632 158
364 3300005564 Ga0070664_100000327 Ga0070664_1000003278 158
365 3300005577 Ga0068857_100140353 Ga0068857_1001403531 158
366 3300005718 Ga0068866_10024315 Ga0068866_100243152 158
367 3300005841 Ga0068863_100044204 Ga0068863_1000442043 158
368 3300005843 Ga0068860_100390008 Ga0068860_1003900082 158
369 3300005844 Ga0068862_100086062 Ga0068862_1000860624 158
370 3300006195 Ga0075366_10133430 Ga0075366_101334302 158
371 3300006237 Ga0097621_100001082 Ga0097621_1000010823 158
372 3300006358 Ga0068871_100000076 Ga0068871_10000007638 158
373 3300006881 Ga0068865_100076835 Ga0068865_1000768352 158
374 3300009148 Ga0105243_11170470 Ga0105243_111704702 158
375 3300009176 Ga0105242_10159532 Ga0105242_101595323 158
376 3300009176 Ga0105242_10421905 Ga0105242_104219051 158
377 3300009177 Ga0105248_10005454 Ga0105248_100054546 158
378 3300013297 Ga0157378_10014089 Ga0157378_100140893 158
379 3300013306 Ga0163162_10000214 Ga0163162_1000021442 158
380 3300013307 Ga0157372_12166373 Ga0157372_121663731 158
381 3300013308 Ga0157375_10000125 Ga0157375_100001257 158
382 3300013308 Ga0157375_11118408 Ga0157375_111184081 158
383 3300014968 Ga0157379_10049350 Ga0157379_100493504 158
384 3300014969 Ga0157376_10001405 Ga0157376_1000140511 158
385 3300017792 Ga0163161_10000612 Ga0163161_100006123 158
386 3300025907 Ga0207645_10082191 Ga0207645_100821913 158
387 3300025908 Ga0207643_10653241 Ga0207643_106532411 158
388 3300025919 Ga0207657_10159088 Ga0207657_101590881 158
389 3300025920 Ga0207649_10006671 Ga0207649_100066714 158
390 3300025931 Ga0207644_10302981 Ga0207644_103029813 158
391 3300025932 Ga0207690_10335275 Ga0207690_103352752 158
392 3300025934 Ga0207686_10120774 Ga0207686_101207742 158
393 3300025935 Ga0207709_10262131 Ga0207709_102621311 158
394 3300025938 Ga0207704_10185164 Ga0207704_101851642 158
395 3300025938 Ga0207704_10719758 Ga0207704_107197582 158
396 3300025941 Ga0207711_10151536 Ga0207711_101515362 158
397 3300025944 Ga0207661_10000092 Ga0207661_1000009231 158
398 3300025945 Ga0207679_10000146 Ga0207679_1000014631 158
399 3300025981 Ga0207640_10387139 Ga0207640_103871392 158
400 3300025986 Ga0207658_10010829 Ga0207658_100108293 158
401 3300026041 Ga0207639_10009404 Ga0207639_100094044 158
402 3300026088 Ga0207641_10106613 Ga0207641_101066133 158
403 3300026089 Ga0207648_10000488 Ga0207648_1000048824 158
404 3300026089 Ga0207648_10835883 Ga0207648_108358831 158
405 3300026116 Ga0207674_10165181 Ga0207674_101651813 158
406 3300026118 Ga0207675_100079095 Ga0207675_1000790953 158
407 3300028380 Ga0268265_10508285 Ga0268265_105082852 158
408 3300028381 Ga0268264_10372215 Ga0268264_103722152 158
409 3300031852 Ga0307410_10056113 Ga0307410_100561133 158
410 3300032005 Ga0307411_10202154 Ga0307411_102021542 158
411 3300035113 Ga0373936_0130841 Ga0373936_0130841_529_1005 158
412 3300050493 nmdc:mga0k408_183389_c1 nmdc:mga0k408_183389_c1_551_1027 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

23

151

0.99

PF08534

Redoxin

Redoxin

22

166

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywn-assembly1.cif.gz_A crystal structure of peroxiredoxin-like protein from sulfolobus tokodaii 0.9327 2 156
4g2e-assembly1.cif.gz_A-2 crystal structure of a dimeric prxq from sulfolobus tokodaii 0.9273 2 156
2ywn-assembly1.cif.gz_A crystal structure of peroxiredoxin-like protein from sulfolobus tokodaii 0.9148 2 156
4g2e-assembly1.cif.gz_A-2 crystal structure of a dimeric prxq from sulfolobus tokodaii 0.9097 2 156
1y25-assembly1.cif.gz_B structure of mycobacterial thiol peroxidase tpx 0.8811 2 153
ID Description Score Start End Superfamily
4g2eA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9272 2 156 3.40.30.10
4g2eA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9096 2 156 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8673 1 152 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8618 7 155 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8445 7 155 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1G7MAD8-F1-model_v4 Peroxiredoxin 0.8796 1 152 GO:0016209
GO:0016491
AF-A0A318UUX6-F1-model_v4 deleted 0.8795 1 152
AF-A0A317GYK8-F1-model_v4 Peroxiredoxin 0.8771 1 155 GO:0016209
GO:0016491
AF-A0A6A5LA11-F1-model_v4 deleted 0.876 1 155
AF-A0A521GDL4-F1-model_v4 Peroxiredoxin 0.8712 3 156 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
84.99 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map