F437814

General Info

Members Datasets Scaffolds Average Seq Length
412 193 826 337

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10416439|Ga0157376_104164391
Length 380
Sequence MQLTVGTSRKKRSNGSARALGFAVVGCGRAGERHAAQIGKFGRLLAACDVVPAAARSLSEAYNVDGFHCYEEMLKAVKGNVDVIAVCTPNGLHCEHSIKAFEAGFHVICEKPMALTIHDCGDMIKAAERANRRLFVVKQNRYNPPVAHLKKLIDTGILGRIFTVHLNCYWNRNEEYYRRSWKGTRDMDGGTLYTQFSHFIDLLYWLVGDVKEVMAFTDNYCHKSSIEFEDAGVAILRFYTGAIGSVNFTINSYQKNMEGSLTLFCENGTIKIGGQYLNEIEYQHVKGIEQTKLEVGRPANEYGYYQGSMSNHEDVYNNVHKVLTADGAIVTIAYEGLKTVEIIDKIYAAARLTRANESRQHPRLTPNCYASTGRPQSLGR

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
182 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
191 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
192 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
193 2914759650 Rhizosphaericola mali Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 0
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 10.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10416439 3300014969 Bacteria 1303
2 rootH2_10000025 3300003320 Bacteria 71863
3 rootH2_10054339 3300003320 Bacteria 10059
4 rootH2_10076991 3300003320 Bacteria 8654
5 rootL2_10045720 3300003322 Bacteria 1578
6 rootL2_10254590 3300003322 Bacteria 2619
7 rootL2_10257508 3300003322 Unclassified 2941
8 rootL2_10273633 3300003322 Bacteria 2831
9 rootH1_10000940 3300003323 Bacteria 88997
10 rootH1_10007743 3300003316 Bacteria 6031
11 rootH1_10007743 3300003323 Bacteria 19767
12 rootH1_10012052 3300003316 Bacteria 7951
13 rootH1_10012052 3300003323 Bacteria 55556
14 rootH1_10228255 3300003323 Bacteria 2611
15 rootH1_10339790 3300003323 Bacteria 1607
16 Ga0065704_10086458 3300005289 Bacteria 3118
17 Ga0065704_10098741 3300005289 Bacteria 2341
18 Ga0065712_10078704 3300005290 Bacteria 3310
19 Ga0070676_10014631 3300005328 Bacteria 4316
20 Ga0070683_100003295 3300005329 Bacteria 13049
21 Ga0070683_100393582 3300005329 Bacteria 1321
22 Ga0070690_100024736 3300005330 Bacteria 3694
23 Ga0070670_100038016 3300005331 Bacteria 4139
24 Ga0070670_100065657 3300005331 Bacteria 3113
25 Ga0070670_100125137 3300005331 Bacteria 2219
26 Ga0070677_10032157 3300005333 Bacteria 2010
27 Ga0068869_100052098 3300005334 Bacteria 2971
28 Ga0070666_10000050 3300005335 Bacteria 100280
29 Ga0070666_10014478 3300005335 Bacteria 5024
30 Ga0070666_10015101 3300005335 Bacteria 4923
31 Ga0070666_10015863 3300005335 Unclassified 4813
32 Ga0070680_100008773 3300005336 Bacteria 7754
33 Ga0070680_100022805 3300005336 Unclassified 4987
34 Ga0070682_100000530 3300005337 Bacteria 23808
35 Ga0070682_100027419 3300005337 Unclassified 3418
36 Ga0068868_100004333 3300005338 Bacteria 9947
37 Ga0068868_100058558 3300005338 Bacteria 3045
38 Ga0068868_100063229 3300005338 Bacteria 2936
39 Ga0068868_100117513 3300005338 Bacteria 2166
40 Ga0070689_100038627 3300005340 Bacteria 3653
41 Ga0070687_100008693 3300005343 Unclassified 4312
42 Ga0070668_100000609 3300005347 Bacteria 23968
43 Ga0070668_100008373 3300005347 Bacteria 7681
44 Ga0070675_100035447 3300005354 Bacteria 4054
45 Ga0070671_100007972 3300005355 Bacteria 8472
46 Ga0070671_100225572 3300005355 Unclassified 1590
47 Ga0070674_100043217 3300005356 Unclassified 3064
48 Ga0070674_100405899 3300005356 Bacteria 1114
49 Ga0070673_100180376 3300005364 Bacteria 1807
50 Ga0070673_100244039 3300005364 Unclassified 1563
51 Ga0070667_100005272 3300005367 Bacteria 10814
52 Ga0070667_100008313 3300005367 Bacteria 8602
53 Ga0070711_100412006 3300005439 Bacteria 1099
54 Ga0070700_100115900 3300005441 Bacteria 1788
55 Ga0070678_100051103 3300005456 Bacteria 2994
56 Ga0070681_10003377 3300005458 Bacteria 14929
57 Ga0070681_10200033 3300005458 Bacteria 1916
58 Ga0068867_100067365 3300005459 Bacteria 2669
59 Ga0070698_100000434 3300005471 Bacteria 44513
60 Ga0070698_100005248 3300005471 Bacteria 14175
61 Ga0070679_100001311 3300005530 Bacteria 21935
62 Ga0070679_100004697 3300005530 Bacteria 12599
63 Ga0070684_100008889 3300005535 Bacteria 7881
64 Ga0068853_100159712 3300005539 Unclassified 2033
65 Ga0068853_100231599 3300005539 Bacteria 1690
66 Ga0068853_100267183 3300005539 Bacteria 1574
67 Ga0068853_100268579 3300005539 Bacteria 1570
68 Ga0068853_100324902 3300005539 Bacteria 1427
69 Ga0070672_100113101 3300005543 Bacteria 2215
70 Ga0070672_100278595 3300005543 Bacteria 1413
71 Ga0070693_100093298 3300005547 Bacteria 1819
72 Ga0070665_100000014 3300005548 Bacteria 484881
73 Ga0070665_100011201 3300005548 Bacteria 9067
74 Ga0070665_100216058 3300005548 Bacteria 1918
75 Ga0068855_100001688 3300005563 Bacteria 27642
76 Ga0068855_100003459 3300005563 Bacteria 19321
77 Ga0068855_100008672 3300005563 Bacteria 12288
78 Ga0068855_100021302 3300005563 Bacteria 7772
79 Ga0068855_100060090 3300005563 Unclassified 4446
80 Ga0068855_100237497 3300005563 Bacteria 2038
81 Ga0070664_100191296 3300005564 Bacteria 1823
82 Ga0068857_100037732 3300005577 Bacteria 4281
83 Ga0068857_100057094 3300005577 Bacteria 3465
84 Ga0068854_100077134 3300005578 Bacteria 2451
85 Ga0068854_100140429 3300005578 Bacteria 1853
86 Ga0068854_100151716 3300005578 Bacteria 1788
87 Ga0068856_100152273 3300005614 Bacteria 2322
88 Ga0070702_100006709 3300005615 Bacteria 5470
89 Ga0068852_100010990 3300005616 Bacteria 6790
90 Ga0068852_100021593 3300005616 Bacteria 5145
91 Ga0068852_100095213 3300005616 Bacteria 2673
92 Ga0068852_100574833 3300005616 Bacteria 1129
93 Ga0068859_100000025 3300005617 Bacteria 191679
94 Ga0068859_100104039 3300005617 Unclassified 2898
95 Ga0068859_100235180 3300005617 Bacteria 1921
96 Ga0068864_100003634 3300005618 Bacteria 12753
97 Ga0068864_100022043 3300005618 Bacteria 5339
98 Ga0068864_100068102 3300005618 Unclassified 3092
99 Ga0068861_100031464 3300005719 Unclassified 3899
100 Ga0068851_10008849 3300005834 Bacteria 4668
101 Ga0068851_10014501 3300005834 Bacteria 3743
102 Ga0068863_100004621 3300005841 Bacteria 13561
103 Ga0068863_100073971 3300005841 Bacteria 3223
104 Ga0068863_100122595 3300005841 Bacteria 2479
105 Ga0068863_100223010 3300005841 Bacteria 1817
106 Ga0068858_100002230 3300005842 Bacteria 19589
107 Ga0068858_100031891 3300005842 Bacteria 4897
108 Ga0068860_100005741 3300005843 Bacteria 12516
109 Ga0068860_100009926 3300005843 Bacteria 9437
110 Ga0068860_100020727 3300005843 Bacteria 6368
111 Ga0068860_100065652 3300005843 Bacteria 3446
112 Ga0081540_1007246 3300005983 Bacteria 7948
113 Ga0081539_10033353 3300005985 Bacteria 3137
114 Ga0075366_10052263 3300006195 Unclassified 2428
115 Ga0075366_10127494 3300006195 Bacteria 1535
116 Ga0097621_100006001 3300006237 Bacteria 8588
117 Ga0097621_100035851 3300006237 Bacteria 3965
118 Ga0097621_100075446 3300006237 Unclassified 2795
119 Ga0068871_100022451 3300006358 Bacteria 4864
120 Ga0068871_100197825 3300006358 Bacteria 1734
121 Ga0097620_100000025 3300006931 Bacteria 191679
122 Ga0097620_100104030 3300006931 Unclassified 2898
123 Ga0097620_100235178 3300006931 Bacteria 1921
124 Ga0105240_10000190 3300009093 Bacteria 125290
125 Ga0105240_10000198 3300009093 Bacteria 122388
126 Ga0105240_10000226 3300009093 Bacteria 112655
127 Ga0105240_10008582 3300009093 Bacteria 14603
128 Ga0105240_10009820 3300009093 Bacteria 13509
129 Ga0105240_10021172 3300009093 Bacteria 8656
130 Ga0105240_10030921 3300009093 Bacteria 6953
131 Ga0105240_10035557 3300009093 Bacteria 6418
132 Ga0111539_10121700 3300009094 Bacteria 3057
133 Ga0111539_10137863 3300009094 Unclassified 2857
134 Ga0105247_10009781 3300009101 Bacteria 5811
135 Ga0105241_10000137 3300009174 Bacteria 52153
136 Ga0105241_10005503 3300009174 Bacteria 9367
137 Ga0105241_10032788 3300009174 Unclassified 3897
138 Ga0105242_10000158 3300009176 Bacteria 50486
139 Ga0105242_10004271 3300009176 Bacteria 11141
140 Ga0105237_10000577 3300009545 Bacteria 51264
141 Ga0105237_10000781 3300009545 Bacteria 43601
142 Ga0105237_10001142 3300009545 Bacteria 35679
143 Ga0105237_10001894 3300009545 Bacteria 26706
144 Ga0105237_10003571 3300009545 Bacteria 18415
145 Ga0105237_10010083 3300009545 Bacteria 10077
146 Ga0105237_10048693 3300009545 Bacteria 4259
147 Ga0105237_10215683 3300009545 Bacteria 1919
148 Ga0105237_10388297 3300009545 Bacteria 1401
149 Ga0105238_10002115 3300009551 Bacteria 20057
150 Ga0105238_10049051 3300009551 Bacteria 4254
151 Ga0105238_10126900 3300009551 Bacteria 2529
152 Ga0105238_10269405 3300009551 Bacteria 1683
153 Ga0105238_10351855 3300009551 Unclassified 1462
154 Ga0105249_10024616 3300009553 Bacteria 5411
155 Ga0105249_10036184 3300009553 Bacteria 4479
156 Ga0105239_10000019 3300010375 Bacteria 273836
157 Ga0105239_10000659 3300010375 Bacteria 49123
158 Ga0105239_10002556 3300010375 Bacteria 23076
159 Ga0105239_10004869 3300010375 Bacteria 15891
160 Ga0105239_10006826 3300010375 Bacteria 13167
161 Ga0105239_10122843 3300010375 Bacteria 2885
162 Ga0105246_10000236 3300011119 Bacteria 28442
163 Ga0105246_10375646 3300011119 Bacteria 1173
164 Ga0157373_10000387 3300013100 Bacteria 35264
165 Ga0157371_10000970 3300013102 Bacteria 31856
166 Ga0157371_10103693 3300013102 Bacteria 2018
167 Ga0157370_10002540 3300013104 Bacteria 21935
168 Ga0157370_10005587 3300013104 Bacteria 14084
169 Ga0157370_10014608 3300013104 Bacteria 8024
170 Ga0157370_10051900 3300013104 Unclassified 3916
171 Ga0157370_10096477 3300013104 Unclassified 2774
172 Ga0157370_10136595 3300013104 Bacteria 2285
173 Ga0157370_10226446 3300013104 Bacteria 1731
174 Ga0157369_10039844 3300013105 Bacteria 5133
175 Ga0157369_10153750 3300013105 Bacteria 2431
176 Ga0157374_10000002 3300013296 Bacteria 1054226
177 Ga0157374_10000929 3300013296 Bacteria 25481
178 Ga0157374_10001648 3300013296 Bacteria 18694
179 Ga0157374_10096695 3300013296 Bacteria 2825
180 Ga0157374_10196165 3300013296 Bacteria 1976
181 Ga0157378_10000370 3300013297 Bacteria 44420
182 Ga0157378_10006898 3300013297 Bacteria 9912
183 Ga0157378_10152096 3300013297 Unclassified 2157
184 Ga0157378_10176062 3300013297 Bacteria 2009
185 Ga0163162_10000151 3300013306 Bacteria 64454
186 Ga0163162_10000427 3300013306 Bacteria 38811
187 Ga0163162_10002883 3300013306 Bacteria 16376
188 Ga0163162_10003022 3300013306 Bacteria 16075
189 Ga0163162_10195199 3300013306 Bacteria 2153
190 Ga0163162_10242894 3300013306 Bacteria 1932
191 Ga0157372_10003107 3300013307 Bacteria 17895
192 Ga0157372_10008163 3300013307 Bacteria 11127
193 Ga0157372_10053912 3300013307 Bacteria 4484
194 Ga0157372_10159637 3300013307 Bacteria 2605
195 Ga0157372_10173026 3300013307 Bacteria 2498
196 Ga0157375_10002078 3300013308 Bacteria 17319
197 Ga0157375_10003683 3300013308 Bacteria 13305
198 Ga0157375_10491315 3300013308 Bacteria 1392
199 Ga0163163_10003995 3300014325 Bacteria 12584
200 Ga0157380_10000672 3300014326 Bacteria 21179
201 Ga0157380_10072222 3300014326 Unclassified 2794
202 Ga0157380_10122441 3300014326 Bacteria 2205
203 Ga0157380_10262914 3300014326 Bacteria 1568
204 Ga0157379_10013001 3300014968 Bacteria 7285
205 Ga0157379_10079542 3300014968 Bacteria 2935
206 Ga0157376_10002256 3300014969 Bacteria 13003
207 Ga0157376_10003050 3300014969 Bacteria 11476
208 Ga0157376_10005761 3300014969 Bacteria 8679
209 Ga0157376_10020462 3300014969 Bacteria 5118
210 Ga0157376_10024973 3300014969 Bacteria 4701
211 Ga0157376_10143292 3300014969 Bacteria 2146
212 Ga0209646_1000367 3300025246 Bacteria 29985
213 Ga0207656_10110498 3300025321 Bacteria 1270
214 Ga0207682_10125342 3300025893 Bacteria 1143
215 Ga0207710_10008562 3300025900 Unclassified 4312
216 Ga0207680_10000032 3300025903 Bacteria 77485
217 Ga0207680_10009253 3300025903 Bacteria 4876
218 Ga0207680_10011664 3300025903 Unclassified 4449
219 Ga0207680_10017386 3300025903 Bacteria 3799
220 Ga0207680_10182283 3300025903 Bacteria 1421
221 Ga0207647_10000631 3300025904 Bacteria 27434
222 Ga0207647_10113996 3300025904 Bacteria 1597
223 Ga0207645_10097888 3300025907 Bacteria 1891
224 Ga0207654_10000335 3300025911 Bacteria 28259
225 Ga0207654_10002471 3300025911 Bacteria 9396
226 Ga0207654_10089316 3300025911 Unclassified 1874
227 Ga0207707_10001581 3300025912 Bacteria 20970
228 Ga0207707_10007428 3300025912 Bacteria 9548
229 Ga0207695_10000212 3300025913 Bacteria 156450
230 Ga0207695_10000276 3300025913 Bacteria 128924
231 Ga0207695_10000313 3300025913 Bacteria 117072
232 Ga0207695_10000346 3300025913 Bacteria 107028
233 Ga0207695_10013567 3300025913 Bacteria 9705
234 Ga0207695_10026317 3300025913 Bacteria 6494
235 Ga0207695_10046967 3300025913 Bacteria 4573
236 Ga0207695_10054993 3300025913 Bacteria 4151
237 Ga0207671_10000802 3300025914 Bacteria 39861
238 Ga0207671_10001020 3300025914 Bacteria 34167
239 Ga0207671_10001317 3300025914 Bacteria 29052
240 Ga0207671_10001415 3300025914 Bacteria 27869
241 Ga0207671_10058186 3300025914 Bacteria 2865
242 Ga0207671_10134987 3300025914 Bacteria 1896
243 Ga0207660_10009000 3300025917 Bacteria 6461
244 Ga0207660_10060626 3300025917 Bacteria 2721
245 Ga0207662_10006991 3300025918 Bacteria 6127
246 Ga0207652_10000563 3300025921 Bacteria 37468
247 Ga0207652_10010117 3300025921 Bacteria 7598
248 Ga0207694_10043476 3300025924 Bacteria 3468
249 Ga0207694_10059125 3300025924 Bacteria 2982
250 Ga0207694_10301225 3300025924 Unclassified 1320
251 Ga0207650_10036796 3300025925 Bacteria 3562
252 Ga0207650_10049831 3300025925 Bacteria 3094
253 Ga0207650_10067211 3300025925 Bacteria 2690
254 Ga0207650_10316662 3300025925 Bacteria 1277
255 Ga0207686_10000611 3300025934 Bacteria 22256
256 Ga0207686_10243414 3300025934 Bacteria 1310
257 Ga0207669_10034928 3300025937 Unclassified 2855
258 Ga0207669_10190662 3300025937 Bacteria 1478
259 Ga0207704_10142736 3300025938 Bacteria 1678
260 Ga0207691_10014273 3300025940 Bacteria 7577
261 Ga0207691_10229543 3300025940 Bacteria 1608
262 Ga0207689_10002782 3300025942 Bacteria 16167
263 Ga0207661_10006750 3300025944 Bacteria 8126
264 Ga0207667_10000908 3300025949 Bacteria 37716
265 Ga0207667_10001585 3300025949 Bacteria 28607
266 Ga0207667_10021547 3300025949 Bacteria 7140
267 Ga0207667_10051307 3300025949 Unclassified 4350
268 Ga0207667_10088789 3300025949 Bacteria 3196
269 Ga0207651_10046582 3300025960 Bacteria 2917
270 Ga0207651_10182164 3300025960 Bacteria 1667
271 Ga0207651_10319926 3300025960 Bacteria 1297
272 Ga0207640_10137990 3300025981 Bacteria 1773
273 Ga0207658_10006644 3300025986 Bacteria 7879
274 Ga0207658_10006692 3300025986 Bacteria 7856
275 Ga0207677_10041685 3300026023 Bacteria 3038
276 Ga0207677_10172082 3300026023 Bacteria 1694
277 Ga0207639_10026229 3300026041 Bacteria 4234
278 Ga0207639_10199520 3300026041 Bacteria 1715
279 Ga0207639_10225270 3300026041 Bacteria 1622
280 Ga0207708_10103487 3300026075 Bacteria 2206
281 Ga0207702_10319772 3300026078 Bacteria 1478
282 Ga0207641_10009452 3300026088 Bacteria 8033
283 Ga0207641_10017328 3300026088 Bacteria 5895
284 Ga0207676_10012807 3300026095 Bacteria 6019
285 Ga0207676_10022940 3300026095 Bacteria 4596
286 Ga0207676_10421533 3300026095 Unclassified 1252
287 Ga0207674_10116292 3300026116 Bacteria 2646
288 Ga0207674_10202984 3300026116 Bacteria 1932
289 Ga0207675_100006353 3300026118 Bacteria 11203
290 Ga0207683_10041344 3300026121 Bacteria 4025
291 Ga0207698_10084827 3300026142 Bacteria 2569
292 Ga0207698_10086022 3300026142 Unclassified 2555
293 Ga0207698_10101924 3300026142 Bacteria 2382
294 Ga0207698_10102657 3300026142 Bacteria 2374
295 Ga0207698_10194468 3300026142 Bacteria 1810
296 Ga0268266_10000068 3300028379 Bacteria 241100
297 Ga0268266_10307881 3300028379 Bacteria 1479
298 Ga0268264_10006998 3300028381 Bacteria 9465
299 Ga0268264_10018924 3300028381 Bacteria 5630
300 Ga0268264_10027102 3300028381 Bacteria 4681
301 Ga0268264_10036863 3300028381 Bacteria 4029
302 Ga0268264_10049724 3300028381 Bacteria 3489
303 Ga0265337_1003096 3300028556 Bacteria 7333
304 Ga0265326_10002482 3300028558 Bacteria 6214
305 Ga0265319_1000252 3300028563 Bacteria 40367
306 Ga0265319_1000930 3300028563 Bacteria 18326
307 Ga0265334_10000517 3300028573 Bacteria 19766
308 Ga0265334_10046155 3300028573 Unclassified 1685
309 Ga0265318_10003486 3300028577 Bacteria 7888
310 Ga0265323_10000192 3300028653 Bacteria 36786
311 Ga0265322_10002280 3300028654 Bacteria 5942
312 Ga0265336_10000411 3300028666 Bacteria 26555
313 Ga0307515_10000162 3300028794 Bacteria 163720
314 Ga0307515_10001093 3300028794 Bacteria 62142
315 Ga0307515_10153342 3300028794 Bacteria 2395
316 Ga0265338_10000260 3300028800 Bacteria 96243
317 Ga0265338_10000922 3300028800 Bacteria 49568
318 Ga0265324_10002269 3300029957 Bacteria 10021
319 Ga0265324_10003500 3300029957 Bacteria 7426
320 Ga0265324_10026661 3300029957 Bacteria 2045
321 Ga0265330_10000665 3300031235 Bacteria 22036
322 Ga0265332_10063681 3300031238 Bacteria 1575
323 Ga0265320_10000505 3300031240 Bacteria 30391
324 Ga0265320_10053111 3300031240 Unclassified 1959
325 Ga0265325_10010865 3300031241 Bacteria 5248
326 Ga0265329_10002178 3300031242 Bacteria 9065
327 Ga0265340_10019617 3300031247 Bacteria 3481
328 Ga0265340_10075389 3300031247 Bacteria 1594
329 Ga0265339_10001647 3300031249 Bacteria 16468
330 Ga0265331_10019305 3300031250 Unclassified 3521
331 Ga0265327_10000199 3300031251 Bacteria 125838
332 Ga0265327_10000837 3300031251 Bacteria 45956
333 Ga0265327_10017287 3300031251 Unclassified 4535
334 Ga0265316_10006453 3300031344 Bacteria 11206
335 Ga0265316_10073800 3300031344 Unclassified 2627
336 Ga0307509_10056165 3300031507 Unclassified 4180
337 Ga0307509_10109617 3300031507 Bacteria 2769
338 Ga0265313_10002625 3300031595 Bacteria 15290
339 Ga0265313_10041664 3300031595 Bacteria 2260
340 Ga0307508_10002524 3300031616 Bacteria 19290
341 Ga0265314_10000775 3300031711 Bacteria 37934
342 Ga0265314_10151765 3300031711 Unclassified 1420
343 Ga0265342_10000939 3300031712 Bacteria 28992
344 Ga0265342_10008673 3300031712 Bacteria 7258
345 Ga0307414_10091605 3300032004 Bacteria 2260
346 Ga0307507_10140382 3300033179 Bacteria 1854
347 Ga0307510_10000152 3300033180 Bacteria 57328
348 Ga0373960_0009589 3300035121 Bacteria 2349
349 Ga0373947_0098165 3300035725 Bacteria 1837
350 Ga0395899_0002461 3300037312 Bacteria 15037
351 Ga0395899_0010393 3300037312 Bacteria 7132
352 Ga0395900_0005475 3300037418 Bacteria 13292
353 Ga0395900_0010294 3300037418 Bacteria 9568
354 Ga0395898_0004370 3300037466 Bacteria 15465
355 Ga0395905_0001963 3300037471 Bacteria 23525
356 Ga0395901_0003584 3300038443 Bacteria 15660
357 Ga0395901_0010497 3300038443 Bacteria 9382
358 Ga0400483_189893 3300039062 Bacteria 1568
359 Ga0451577_0024290 3300042876 Bacteria 5515
360 Ga0466969_0000398 3300044656 Bacteria 23847
361 Ga0466972_0000047 3300044658 Bacteria 122901
362 Ga0466972_0003993 3300044658 Bacteria 7349
363 Ga0453683_0000115 3300044673 Bacteria 118577
364 Ga0466966_0000047 3300044684 Bacteria 91962
365 Ga0466966_0084139 3300044684 Bacteria 1979
366 Ga0453684_0119049 3300044712 Bacteria 3192
367 Ga0453684_0232790 3300044712 Bacteria 2126
368 Ga0466968_0006102 3300044735 Bacteria 4526
369 Ga0466968_0037752 3300044735 Unclassified 2028
370 Ga0466970_0162800 3300044765 Unclassified 1234
371 Ga0466957_0018760 3300044842 Bacteria 4064
372 Ga0466959_0000065 3300045049 Bacteria 73931
373 Ga0466959_0050600 3300045049 Bacteria 3050
374 Ga0451576_0000308 3300045051 Bacteria 118556
375 Ga0451576_0001155 3300045051 Bacteria 47648
376 Ga0451576_0008532 3300045051 Bacteria 12015
377 Ga0495664_0108805 3300046477 Bacteria 1672
378 Ga0495606_0006426 3300046507 Bacteria 10844
379 Ga0495668_0001368 3300046616 Bacteria 23908
380 Ga0495668_0009204 3300046616 Bacteria 6077
381 Ga0495611_0000026 3300046648 Bacteria 118428
382 Ga0495649_0028845 3300046694 Bacteria 3076
383 Ga0495687_004762 3300047443 Bacteria 8965
384 Ga0495686_0000005 3300047472 Bacteria 827143
385 Ga0501290_004786 3300049513 Bacteria 1690
386 Ga0501047_0013098 3300049581 Bacteria 7854
387 Ga0501047_0305241 3300049581 Bacteria 1433
388 Ga0501077_0074983 3300049593 Unclassified 2142
389 Ga0501257_010609 3300049686 Bacteria 2095
390 Ga0501219_000861 3300049703 Bacteria 3825
391 Ga0501044_0003509 3300049823 Bacteria 17650
392 Ga0501284_00023 3300050005 Bacteria 78607
393 nmdc:mga0k408_118486_c1 3300050493 Bacteria 1567
394 nmdc:mga0k408_49682_c1 3300050493 Unclassified 2428
395 nmdc:mga08y16_118761_c1 3300050511 Bacteria 2752
396 Ga0500578_0000060 3300053086 Bacteria 118274
397 Ga0500578_0023317 3300053086 Bacteria 3974
398 Ga0500646_0000534 3300053090 Bacteria 11120
399 Ga0500646_0001087 3300053090 Bacteria 7392
400 Ga0500583_0000003 3300053092 Bacteria 229587
401 Ga0500583_0009804 3300053092 Bacteria 3522
402 Ga0500592_002599 3300053116 Bacteria 2899
403 Ga0500568_0005601 3300053139 Bacteria 6466
404 Ga0500588_0001898 3300053146 Unclassified 4102
405 Ga0500604_0004831 3300053151 Unclassified 3572
406 Ga0500622_0000113 3300053156 Bacteria 83196
407 Ga0500622_0000133 3300053156 Bacteria 78532
408 Ga0500622_0002797 3300053156 Bacteria 12259
409 Ga0500622_0094240 3300053156 Bacteria 1482
410 Ga0501082_0084620 3300060353 Unclassified 2735
411 2740033246 2739367866 Bacteria 4215900
412 2840678433 2840677318 Bacteria 2664183
413 2896086250 2896085136 Bacteria 6129793
414 2914763275 2914759650 Bacteria 4701441
415 Ga0157376_10416439
416 rootH2_10000025
417 rootH2_10054339
418 rootH2_10076991
419 rootL2_10045720
420 rootL2_10254590
421 rootL2_10257508
422 rootL2_10273633
423 rootH1_10000940
424 rootH1_10007743
425 rootH1_10012052
426 rootH1_10228255
427 rootH1_10339790
428 Ga0065704_10086458
429 Ga0065704_10098741
430 Ga0065712_10078704
431 Ga0070676_10014631
432 Ga0070683_100003295
433 Ga0070683_100393582
434 Ga0070690_100024736
435 Ga0070670_100038016
436 Ga0070670_100065657
437 Ga0070670_100125137
438 Ga0070677_10032157
439 Ga0068869_100052098
440 Ga0070666_10000050
441 Ga0070666_10014478
442 Ga0070666_10015101
443 Ga0070666_10015863
444 Ga0070680_100008773
445 Ga0070680_100022805
446 Ga0070682_100000530
447 Ga0070682_100027419
448 Ga0068868_100004333
449 Ga0068868_100058558
450 Ga0068868_100063229
451 Ga0068868_100117513
452 Ga0070689_100038627
453 Ga0070687_100008693
454 Ga0070668_100000609
455 Ga0070668_100008373
456 Ga0070675_100035447
457 Ga0070671_100007972
458 Ga0070671_100225572
459 Ga0070674_100043217
460 Ga0070674_100405899
461 Ga0070673_100180376
462 Ga0070673_100244039
463 Ga0070667_100005272
464 Ga0070667_100008313
465 Ga0070711_100412006
466 Ga0070700_100115900
467 Ga0070678_100051103
468 Ga0070681_10003377
469 Ga0070681_10200033
470 Ga0068867_100067365
471 Ga0070698_100000434
472 Ga0070698_100005248
473 Ga0070679_100001311
474 Ga0070679_100004697
475 Ga0070684_100008889
476 Ga0068853_100159712
477 Ga0068853_100231599
478 Ga0068853_100267183
479 Ga0068853_100268579
480 Ga0068853_100324902
481 Ga0070672_100113101
482 Ga0070672_100278595
483 Ga0070693_100093298
484 Ga0070665_100000014
485 Ga0070665_100011201
486 Ga0070665_100216058
487 Ga0068855_100001688
488 Ga0068855_100003459
489 Ga0068855_100008672
490 Ga0068855_100021302
491 Ga0068855_100060090
492 Ga0068855_100237497
493 Ga0070664_100191296
494 Ga0068857_100037732
495 Ga0068857_100057094
496 Ga0068854_100077134
497 Ga0068854_100140429
498 Ga0068854_100151716
499 Ga0068856_100152273
500 Ga0070702_100006709
501 Ga0068852_100010990
502 Ga0068852_100021593
503 Ga0068852_100095213
504 Ga0068852_100574833
505 Ga0068859_100000025
506 Ga0068859_100104039
507 Ga0068859_100235180
508 Ga0068864_100003634
509 Ga0068864_100022043
510 Ga0068864_100068102
511 Ga0068861_100031464
512 Ga0068851_10008849
513 Ga0068851_10014501
514 Ga0068863_100004621
515 Ga0068863_100073971
516 Ga0068863_100122595
517 Ga0068863_100223010
518 Ga0068858_100002230
519 Ga0068858_100031891
520 Ga0068860_100005741
521 Ga0068860_100009926
522 Ga0068860_100020727
523 Ga0068860_100065652
524 Ga0081540_1007246
525 Ga0081539_10033353
526 Ga0075366_10052263
527 Ga0075366_10127494
528 Ga0097621_100006001
529 Ga0097621_100035851
530 Ga0097621_100075446
531 Ga0068871_100022451
532 Ga0068871_100197825
533 Ga0097620_100000025
534 Ga0097620_100104030
535 Ga0097620_100235178
536 Ga0105240_10000190
537 Ga0105240_10000198
538 Ga0105240_10000226
539 Ga0105240_10008582
540 Ga0105240_10009820
541 Ga0105240_10021172
542 Ga0105240_10030921
543 Ga0105240_10035557
544 Ga0111539_10121700
545 Ga0111539_10137863
546 Ga0105247_10009781
547 Ga0105241_10000137
548 Ga0105241_10005503
549 Ga0105241_10032788
550 Ga0105242_10000158
551 Ga0105242_10004271
552 Ga0105237_10000577
553 Ga0105237_10000781
554 Ga0105237_10001142
555 Ga0105237_10001894
556 Ga0105237_10003571
557 Ga0105237_10010083
558 Ga0105237_10048693
559 Ga0105237_10215683
560 Ga0105237_10388297
561 Ga0105238_10002115
562 Ga0105238_10049051
563 Ga0105238_10126900
564 Ga0105238_10269405
565 Ga0105238_10351855
566 Ga0105249_10024616
567 Ga0105249_10036184
568 Ga0105239_10000019
569 Ga0105239_10000659
570 Ga0105239_10002556
571 Ga0105239_10004869
572 Ga0105239_10006826
573 Ga0105239_10122843
574 Ga0105246_10000236
575 Ga0105246_10375646
576 Ga0157373_10000387
577 Ga0157371_10000970
578 Ga0157371_10103693
579 Ga0157370_10002540
580 Ga0157370_10005587
581 Ga0157370_10014608
582 Ga0157370_10051900
583 Ga0157370_10096477
584 Ga0157370_10136595
585 Ga0157370_10226446
586 Ga0157369_10039844
587 Ga0157369_10153750
588 Ga0157374_10000002
589 Ga0157374_10000929
590 Ga0157374_10001648
591 Ga0157374_10096695
592 Ga0157374_10196165
593 Ga0157378_10000370
594 Ga0157378_10006898
595 Ga0157378_10152096
596 Ga0157378_10176062
597 Ga0163162_10000151
598 Ga0163162_10000427
599 Ga0163162_10002883
600 Ga0163162_10003022
601 Ga0163162_10195199
602 Ga0163162_10242894
603 Ga0157372_10003107
604 Ga0157372_10008163
605 Ga0157372_10053912
606 Ga0157372_10159637
607 Ga0157372_10173026
608 Ga0157375_10002078
609 Ga0157375_10003683
610 Ga0157375_10491315
611 Ga0163163_10003995
612 Ga0157380_10000672
613 Ga0157380_10072222
614 Ga0157380_10122441
615 Ga0157380_10262914
616 Ga0157379_10013001
617 Ga0157379_10079542
618 Ga0157376_10002256
619 Ga0157376_10003050
620 Ga0157376_10005761
621 Ga0157376_10020462
622 Ga0157376_10024973
623 Ga0157376_10143292
624 Ga0209646_1000367
625 Ga0207656_10110498
626 Ga0207682_10125342
627 Ga0207710_10008562
628 Ga0207680_10000032
629 Ga0207680_10009253
630 Ga0207680_10011664
631 Ga0207680_10017386
632 Ga0207680_10182283
633 Ga0207647_10000631
634 Ga0207647_10113996
635 Ga0207645_10097888
636 Ga0207654_10000335
637 Ga0207654_10002471
638 Ga0207654_10089316
639 Ga0207707_10001581
640 Ga0207707_10007428
641 Ga0207695_10000212
642 Ga0207695_10000276
643 Ga0207695_10000313
644 Ga0207695_10000346
645 Ga0207695_10013567
646 Ga0207695_10026317
647 Ga0207695_10046967
648 Ga0207695_10054993
649 Ga0207671_10000802
650 Ga0207671_10001020
651 Ga0207671_10001317
652 Ga0207671_10001415
653 Ga0207671_10058186
654 Ga0207671_10134987
655 Ga0207660_10009000
656 Ga0207660_10060626
657 Ga0207662_10006991
658 Ga0207652_10000563
659 Ga0207652_10010117
660 Ga0207694_10043476
661 Ga0207694_10059125
662 Ga0207694_10301225
663 Ga0207650_10036796
664 Ga0207650_10049831
665 Ga0207650_10067211
666 Ga0207650_10316662
667 Ga0207686_10000611
668 Ga0207686_10243414
669 Ga0207669_10034928
670 Ga0207669_10190662
671 Ga0207704_10142736
672 Ga0207691_10014273
673 Ga0207691_10229543
674 Ga0207689_10002782
675 Ga0207661_10006750
676 Ga0207667_10000908
677 Ga0207667_10001585
678 Ga0207667_10021547
679 Ga0207667_10051307
680 Ga0207667_10088789
681 Ga0207651_10046582
682 Ga0207651_10182164
683 Ga0207651_10319926
684 Ga0207640_10137990
685 Ga0207658_10006644
686 Ga0207658_10006692
687 Ga0207677_10041685
688 Ga0207677_10172082
689 Ga0207639_10026229
690 Ga0207639_10199520
691 Ga0207639_10225270
692 Ga0207708_10103487
693 Ga0207702_10319772
694 Ga0207641_10009452
695 Ga0207641_10017328
696 Ga0207676_10012807
697 Ga0207676_10022940
698 Ga0207676_10421533
699 Ga0207674_10116292
700 Ga0207674_10202984
701 Ga0207675_100006353
702 Ga0207683_10041344
703 Ga0207698_10084827
704 Ga0207698_10086022
705 Ga0207698_10101924
706 Ga0207698_10102657
707 Ga0207698_10194468
708 Ga0268266_10000068
709 Ga0268266_10307881
710 Ga0268264_10006998
711 Ga0268264_10018924
712 Ga0268264_10027102
713 Ga0268264_10036863
714 Ga0268264_10049724
715 Ga0265337_1003096
716 Ga0265326_10002482
717 Ga0265319_1000252
718 Ga0265319_1000930
719 Ga0265334_10000517
720 Ga0265334_10046155
721 Ga0265318_10003486
722 Ga0265323_10000192
723 Ga0265322_10002280
724 Ga0265336_10000411
725 Ga0307515_10000162
726 Ga0307515_10001093
727 Ga0307515_10153342
728 Ga0265338_10000260
729 Ga0265338_10000922
730 Ga0265324_10002269
731 Ga0265324_10003500
732 Ga0265324_10026661
733 Ga0265330_10000665
734 Ga0265332_10063681
735 Ga0265320_10000505
736 Ga0265320_10053111
737 Ga0265325_10010865
738 Ga0265329_10002178
739 Ga0265340_10019617
740 Ga0265340_10075389
741 Ga0265339_10001647
742 Ga0265331_10019305
743 Ga0265327_10000199
744 Ga0265327_10000837
745 Ga0265327_10017287
746 Ga0265316_10006453
747 Ga0265316_10073800
748 Ga0307509_10056165
749 Ga0307509_10109617
750 Ga0265313_10002625
751 Ga0265313_10041664
752 Ga0307508_10002524
753 Ga0265314_10000775
754 Ga0265314_10151765
755 Ga0265342_10000939
756 Ga0265342_10008673
757 Ga0307414_10091605
758 Ga0307507_10140382
759 Ga0307510_10000152
760 Ga0373960_0009589
761 Ga0373947_0098165
762 Ga0395899_0002461
763 Ga0395899_0010393
764 Ga0395900_0005475
765 Ga0395900_0010294
766 Ga0395898_0004370
767 Ga0395905_0001963
768 Ga0395901_0003584
769 Ga0395901_0010497
770 Ga0400483_189893
771 Ga0451577_0024290
772 Ga0466969_0000398
773 Ga0466972_0000047
774 Ga0466972_0003993
775 Ga0453683_0000115
776 Ga0466966_0000047
777 Ga0466966_0084139
778 Ga0453684_0119049
779 Ga0453684_0232790
780 Ga0466968_0006102
781 Ga0466968_0037752
782 Ga0466970_0162800
783 Ga0466957_0018760
784 Ga0466959_0000065
785 Ga0466959_0050600
786 Ga0451576_0000308
787 Ga0451576_0001155
788 Ga0451576_0008532
789 Ga0495664_0108805
790 Ga0495606_0006426
791 Ga0495668_0001368
792 Ga0495668_0009204
793 Ga0495611_0000026
794 Ga0495649_0028845
795 Ga0495687_004762
796 Ga0495686_0000005
797 Ga0501290_004786
798 Ga0501047_0013098
799 Ga0501047_0305241
800 Ga0501077_0074983
801 Ga0501257_010609
802 Ga0501219_000861
803 Ga0501044_0003509
804 Ga0501284_00023
805 nmdc:mga0k408_118486_c1
806 nmdc:mga0k408_49682_c1
807 nmdc:mga08y16_118761_c1
808 Ga0500578_0000060
809 Ga0500578_0023317
810 Ga0500646_0000534
811 Ga0500646_0001087
812 Ga0500583_0000003
813 Ga0500583_0009804
814 Ga0500592_002599
815 Ga0500568_0005601
816 Ga0500588_0001898
817 Ga0500604_0004831
818 Ga0500622_0000113
819 Ga0500622_0000133
820 Ga0500622_0002797
821 Ga0500622_0094240
822 Ga0501082_0084620
823 2740033246
824 2840678433
825 2896086250
826 2914763275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

146

271

0.97

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

20

138

0.94

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

150

355

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q2k-assembly2.cif.gz_L crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9613 3 332
3q2k-assembly2.cif.gz_P crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9577 3 332
3q2k-assembly1.cif.gz_E crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9552 3 332
3q2k-assembly1.cif.gz_F crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9401 3 332
3q2k-assembly1.cif.gz_B crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9342 3 332
ID Description Score Start End Superfamily
3q2kD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9692 130 261 3.30.360.10
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9489 4 120 3.30.360.10
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.944 4 120 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 4 117 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 4 117 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A011QT55-F1-model_v4 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.1.1.312) 0.9593 2 120 GO:0000166
GO:0050606
AF-A0A4Q3RX11-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9525 2 125 GO:0000166
GO:0003824
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9506 2 143 GO:0000166
AF-A0A0A2F273-F1-model_v4 Oxidoreductase 0.944 1 332 GO:0000166
GO:0016491
AF-A0A151BEY2-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9401 1 143 GO:0000166

Map