F437875
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 412 | 216 | 412 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0005826|Ga0466960_0005826_1802_2605 |
| Length | 251 |
| Sequence | MATLAETETARVYSQSNDDRFFVRGAVIMALTIVVGFSFQYAMGRSTFMAPPLVHAHAIVFMGWVVIFLTQNLLVGAGRVDIHRRLGWIALGWIFPMVLLGCLVTLAMVRRGQVPFFFRPLQFAAVALRRQTDWHRRLHFCGMTLLMGPAFGRLLPGPLLQPWAWEAVFAACLLFPVAGVVADLRRAGRVHPAWRVGIGALLGCFVLVEAITYSPVGAALYRIVTAGSPGASVPPLEFAPPPAGPLMTGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 175 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 182 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 183 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 205 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 209 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 210 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 211 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 212 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 213 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 214 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 215 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 216 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.64 |
| Nodule | 0 |
| Rhizoplane | 3.64 |
| Rhizosphere | 91.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1001180 | 3300001978 | Bacteria | 1904 |
| 2 | JGI24739J22299_10003916 | 3300001989 | Bacteria | 5691 |
| 3 | JGI24737J22298_10038300 | 3300001990 | Unclassified | 1476 |
| 4 | JGI24743J22301_10025569 | 3300001991 | Unclassified | 1145 |
| 5 | JGI24745J21846_1006716 | 3300002073 | Unclassified | 1282 |
| 6 | JGI24749J21850_1002290 | 3300002076 | Bacteria | 2694 |
| 7 | JGI24744J21845_10002622 | 3300002077 | Bacteria | 3673 |
| 8 | JGI24751J29686_10022859 | 3300002459 | Unclassified | 1296 |
| 9 | rootH1_10124416 | 3300003316 | Bacteria | 2719 |
| 10 | rootH2_10055396 | 3300003320 | Bacteria | 1451 |
| 11 | Ga0055530_10003447 | 3300003791 | Bacteria | 8991 |
| 12 | Ga0055531_10002083 | 3300003794 | Bacteria | 13739 |
| 13 | Ga0065165_1001018 | 3300005262 | Bacteria | 34062 |
| 14 | Ga0065712_10110584 | 3300005290 | Bacteria | 1833 |
| 15 | Ga0065715_10007970 | 3300005293 | Bacteria | 2973 |
| 16 | Ga0070658_10104150 | 3300005327 | Bacteria | 2347 |
| 17 | Ga0070658_10535080 | 3300005327 | Bacteria | 1013 |
| 18 | Ga0070676_10016631 | 3300005328 | Bacteria | 4068 |
| 19 | Ga0070676_10171969 | 3300005328 | Bacteria | 1402 |
| 20 | Ga0070676_10207817 | 3300005328 | Unclassified | 1286 |
| 21 | Ga0070683_100196388 | 3300005329 | Bacteria | 1916 |
| 22 | Ga0070690_100001926 | 3300005330 | Bacteria | 11028 |
| 23 | Ga0070690_100060321 | 3300005330 | Bacteria | 2441 |
| 24 | Ga0070670_100004030 | 3300005331 | Bacteria | 12267 |
| 25 | Ga0070670_100006696 | 3300005331 | Bacteria | 9765 |
| 26 | Ga0070670_100039862 | 3300005331 | Bacteria | 4039 |
| 27 | Ga0070670_100189438 | 3300005331 | Unclassified | 1787 |
| 28 | Ga0070670_100575826 | 3300005331 | Bacteria | 1006 |
| 29 | Ga0070677_10001322 | 3300005333 | Bacteria | 7922 |
| 30 | Ga0068869_100087118 | 3300005334 | Bacteria | 2342 |
| 31 | Ga0070666_10040106 | 3300005335 | Bacteria | 3124 |
| 32 | Ga0070666_10092191 | 3300005335 | Bacteria | 2082 |
| 33 | Ga0070680_100006408 | 3300005336 | Bacteria | 8941 |
| 34 | Ga0068868_100002343 | 3300005338 | Bacteria | 13104 |
| 35 | Ga0068868_100044527 | 3300005338 | Bacteria | 3469 |
| 36 | Ga0068868_100048979 | 3300005338 | Bacteria | 3316 |
| 37 | Ga0070660_100023131 | 3300005339 | Bacteria | 4602 |
| 38 | Ga0070660_100411870 | 3300005339 | Bacteria | 1119 |
| 39 | Ga0070689_100315643 | 3300005340 | Bacteria | 1304 |
| 40 | Ga0070661_100032607 | 3300005344 | Bacteria | 3770 |
| 41 | Ga0070661_100377395 | 3300005344 | Unclassified | 1117 |
| 42 | Ga0070668_100014711 | 3300005347 | Bacteria | 5848 |
| 43 | Ga0070668_100231981 | 3300005347 | Unclassified | 1526 |
| 44 | Ga0070669_100016896 | 3300005353 | Bacteria | 5209 |
| 45 | Ga0070675_100107085 | 3300005354 | Bacteria | 2360 |
| 46 | Ga0070675_100162556 | 3300005354 | Bacteria | 1921 |
| 47 | Ga0070675_100327380 | 3300005354 | Bacteria | 1354 |
| 48 | Ga0070671_100002744 | 3300005355 | Bacteria | 13674 |
| 49 | Ga0070671_100002863 | 3300005355 | Bacteria | 13424 |
| 50 | Ga0070671_100019098 | 3300005355 | Bacteria | 5574 |
| 51 | Ga0070671_100026172 | 3300005355 | Bacteria | 4793 |
| 52 | Ga0070671_100086487 | 3300005355 | Bacteria | 2623 |
| 53 | Ga0070671_100106361 | 3300005355 | Bacteria | 2355 |
| 54 | Ga0070671_100124225 | 3300005355 | Bacteria | 2172 |
| 55 | Ga0070674_100023094 | 3300005356 | Bacteria | 4019 |
| 56 | Ga0070674_100033005 | 3300005356 | Bacteria | 3442 |
| 57 | Ga0070673_100003651 | 3300005364 | Bacteria | 9636 |
| 58 | Ga0070673_100010276 | 3300005364 | Bacteria | 6330 |
| 59 | Ga0070673_100019876 | 3300005364 | Bacteria | 4831 |
| 60 | Ga0070673_100562956 | 3300005364 | Unclassified | 1036 |
| 61 | Ga0070659_100001753 | 3300005366 | Bacteria | 15585 |
| 62 | Ga0070659_100171658 | 3300005366 | Bacteria | 1777 |
| 63 | Ga0070659_100207125 | 3300005366 | Unclassified | 1615 |
| 64 | Ga0070659_100237590 | 3300005366 | Unclassified | 1507 |
| 65 | Ga0070659_100285937 | 3300005366 | Unclassified | 1372 |
| 66 | Ga0070667_100002750 | 3300005367 | Bacteria | 15219 |
| 67 | Ga0070667_100031906 | 3300005367 | Bacteria | 4392 |
| 68 | Ga0070667_100309768 | 3300005367 | Bacteria | 1423 |
| 69 | Ga0070714_100098763 | 3300005435 | Unclassified | 2569 |
| 70 | Ga0070714_100117842 | 3300005435 | Bacteria | 2359 |
| 71 | Ga0070713_100013582 | 3300005436 | Bacteria | 6020 |
| 72 | Ga0070713_100225189 | 3300005436 | Bacteria | 1703 |
| 73 | Ga0070711_100009061 | 3300005439 | Bacteria | 6113 |
| 74 | Ga0070700_100020567 | 3300005441 | Bacteria | 3825 |
| 75 | Ga0070663_100022403 | 3300005455 | Bacteria | 4224 |
| 76 | Ga0070663_100067151 | 3300005455 | Bacteria | 2600 |
| 77 | Ga0070663_100124022 | 3300005455 | Bacteria | 1954 |
| 78 | Ga0070663_100401525 | 3300005455 | Bacteria | 1120 |
| 79 | Ga0070678_100014954 | 3300005456 | Bacteria | 4916 |
| 80 | Ga0070678_100019307 | 3300005456 | Bacteria | 4440 |
| 81 | Ga0070678_100151636 | 3300005456 | Bacteria | 1868 |
| 82 | Ga0070678_100218140 | 3300005456 | Bacteria | 1584 |
| 83 | Ga0070662_100002083 | 3300005457 | Bacteria | 12267 |
| 84 | Ga0070662_100046983 | 3300005457 | Bacteria | 3103 |
| 85 | Ga0070662_100227171 | 3300005457 | Unclassified | 1492 |
| 86 | Ga0070681_10201978 | 3300005458 | Unclassified | 1906 |
| 87 | Ga0068867_100003061 | 3300005459 | Bacteria | 11788 |
| 88 | Ga0068867_100009786 | 3300005459 | Bacteria | 6756 |
| 89 | Ga0068867_100111192 | 3300005459 | Bacteria | 2105 |
| 90 | Ga0070679_100012027 | 3300005530 | Bacteria | 8260 |
| 91 | Ga0070679_100170696 | 3300005530 | Bacteria | 2148 |
| 92 | Ga0068853_100198946 | 3300005539 | Bacteria | 1823 |
| 93 | Ga0068853_100219605 | 3300005539 | Bacteria | 1735 |
| 94 | Ga0068853_100624053 | 3300005539 | Unclassified | 1025 |
| 95 | Ga0070672_100013662 | 3300005543 | Bacteria | 5741 |
| 96 | Ga0070672_100016832 | 3300005543 | Bacteria | 5244 |
| 97 | Ga0070672_100046292 | 3300005543 | Bacteria | 3370 |
| 98 | Ga0070672_100324285 | 3300005543 | Bacteria | 1309 |
| 99 | Ga0070672_100696340 | 3300005543 | Bacteria | 890 |
| 100 | Ga0070686_100001629 | 3300005544 | Bacteria | 12554 |
| 101 | Ga0070686_100120476 | 3300005544 | Bacteria | 1801 |
| 102 | Ga0070693_100086749 | 3300005547 | Unclassified | 1878 |
| 103 | Ga0068855_100020174 | 3300005563 | Bacteria | 8004 |
| 104 | Ga0068855_100133080 | 3300005563 | Bacteria | 2838 |
| 105 | Ga0070664_100022170 | 3300005564 | Bacteria | 5239 |
| 106 | Ga0070664_100150498 | 3300005564 | Bacteria | 2054 |
| 107 | Ga0070664_100274303 | 3300005564 | Unclassified | 1520 |
| 108 | Ga0068854_100044304 | 3300005578 | Bacteria | 3157 |
| 109 | Ga0068854_100137287 | 3300005578 | Bacteria | 1873 |
| 110 | Ga0068854_100158378 | 3300005578 | Bacteria | 1751 |
| 111 | Ga0068856_100033822 | 3300005614 | Bacteria | 5006 |
| 112 | Ga0070702_100291977 | 3300005615 | Bacteria | 1124 |
| 113 | Ga0068852_100080917 | 3300005616 | Bacteria | 2882 |
| 114 | Ga0068852_100130534 | 3300005616 | Bacteria | 2313 |
| 115 | Ga0068852_100173967 | 3300005616 | Bacteria | 2020 |
| 116 | Ga0068859_100028314 | 3300005617 | Bacteria | 5617 |
| 117 | Ga0068859_100569775 | 3300005617 | Bacteria | 1226 |
| 118 | Ga0068864_100204765 | 3300005618 | Unclassified | 1814 |
| 119 | Ga0068866_10010865 | 3300005718 | Bacteria | 3918 |
| 120 | Ga0068866_10033220 | 3300005718 | Bacteria | 2501 |
| 121 | Ga0068866_10036053 | 3300005718 | Bacteria | 2421 |
| 122 | Ga0068861_100230916 | 3300005719 | Bacteria | 1569 |
| 123 | Ga0068851_10007579 | 3300005834 | Bacteria | 4989 |
| 124 | Ga0068851_10029461 | 3300005834 | Bacteria | 2718 |
| 125 | Ga0068851_10058502 | 3300005834 | Bacteria | 1970 |
| 126 | Ga0068863_100007458 | 3300005841 | Bacteria | 10707 |
| 127 | Ga0068863_100012971 | 3300005841 | Bacteria | 8036 |
| 128 | Ga0068858_100019228 | 3300005842 | Bacteria | 6387 |
| 129 | Ga0068858_100038694 | 3300005842 | Bacteria | 4424 |
| 130 | Ga0068858_100275886 | 3300005842 | Bacteria | 1600 |
| 131 | Ga0068860_100081369 | 3300005843 | Bacteria | 3080 |
| 132 | Ga0068862_100039491 | 3300005844 | Bacteria | 4008 |
| 133 | Ga0070717_10204982 | 3300006028 | Bacteria | 1729 |
| 134 | Ga0070716_100134398 | 3300006173 | Bacteria | 1568 |
| 135 | Ga0070712_100002029 | 3300006175 | Bacteria | 12408 |
| 136 | Ga0097621_100324452 | 3300006237 | Bacteria | 1364 |
| 137 | Ga0068871_100042864 | 3300006358 | Bacteria | 3635 |
| 138 | Ga0075434_100017710 | 3300006871 | Bacteria | 6867 |
| 139 | Ga0068865_100001641 | 3300006881 | Bacteria | 13103 |
| 140 | Ga0068865_100084848 | 3300006881 | Bacteria | 2283 |
| 141 | Ga0097620_100028315 | 3300006931 | Bacteria | 5617 |
| 142 | Ga0097620_100569740 | 3300006931 | Bacteria | 1226 |
| 143 | Ga0111539_10017987 | 3300009094 | Bacteria | 8754 |
| 144 | Ga0105245_10272375 | 3300009098 | Bacteria | 1652 |
| 145 | Ga0105245_10492127 | 3300009098 | Bacteria | 1241 |
| 146 | Ga0105243_10139388 | 3300009148 | Bacteria | 2067 |
| 147 | Ga0105241_10454881 | 3300009174 | Unclassified | 1133 |
| 148 | Ga0105242_10108164 | 3300009176 | Bacteria | 2366 |
| 149 | Ga0105242_10406839 | 3300009176 | Bacteria | 1272 |
| 150 | Ga0105248_10002097 | 3300009177 | Bacteria | 22084 |
| 151 | Ga0105248_10170772 | 3300009177 | Bacteria | 2451 |
| 152 | Ga0105248_10180218 | 3300009177 | Bacteria | 2381 |
| 153 | Ga0105238_10202893 | 3300009551 | Bacteria | 1959 |
| 154 | Ga0105238_10283952 | 3300009551 | Bacteria | 1637 |
| 155 | Ga0105249_10011888 | 3300009553 | Bacteria | 7656 |
| 156 | Ga0105239_10836702 | 3300010375 | Bacteria | 1055 |
| 157 | Ga0105246_10420746 | 3300011119 | Unclassified | 1115 |
| 158 | Ga0157373_10075106 | 3300013100 | Bacteria | 2385 |
| 159 | Ga0157373_10107003 | 3300013100 | Bacteria | 1966 |
| 160 | Ga0157373_10122605 | 3300013100 | Bacteria | 1827 |
| 161 | Ga0157371_10091138 | 3300013102 | Bacteria | 2159 |
| 162 | Ga0157374_10004363 | 3300013296 | Bacteria | 11905 |
| 163 | Ga0157374_10326809 | 3300013296 | Bacteria | 1521 |
| 164 | Ga0157374_10605356 | 3300013296 | Bacteria | 1106 |
| 165 | Ga0157378_10041421 | 3300013297 | Bacteria | 4085 |
| 166 | Ga0157378_10177673 | 3300013297 | Unclassified | 2001 |
| 167 | Ga0157378_10203313 | 3300013297 | Bacteria | 1874 |
| 168 | Ga0163162_10021164 | 3300013306 | Bacteria | 6398 |
| 169 | Ga0163162_10275056 | 3300013306 | Unclassified | 1816 |
| 170 | Ga0163162_10296108 | 3300013306 | Bacteria | 1750 |
| 171 | Ga0163162_10413911 | 3300013306 | Bacteria | 1480 |
| 172 | Ga0163162_10802160 | 3300013306 | Unclassified | 1059 |
| 173 | Ga0157372_10003383 | 3300013307 | Bacteria | 17209 |
| 174 | Ga0157375_10035094 | 3300013308 | Bacteria | 4784 |
| 175 | Ga0163163_10069868 | 3300014325 | Bacteria | 3497 |
| 176 | Ga0157377_10194393 | 3300014745 | Bacteria | 1284 |
| 177 | Ga0157379_10048726 | 3300014968 | Bacteria | 3782 |
| 178 | Ga0157379_10202016 | 3300014968 | Bacteria | 1797 |
| 179 | Ga0157376_10032581 | 3300014969 | Bacteria | 4185 |
| 180 | Ga0163161_10109436 | 3300017792 | Bacteria | 2064 |
| 181 | Ga0206353_11297066 | 3300020082 | Bacteria | 5173 |
| 182 | Ga0213876_10017463 | 3300021384 | Bacteria | 3789 |
| 183 | Ga0209758_1000331 | 3300025297 | Bacteria | 88922 |
| 184 | Ga0209050_1000130 | 3300025298 | Bacteria | 186070 |
| 185 | Ga0207426_1075726 | 3300025302 | Bacteria | 926 |
| 186 | Ga0209257_1000059 | 3300025304 | Bacteria | 378097 |
| 187 | Ga0207697_10001211 | 3300025315 | Bacteria | 14101 |
| 188 | Ga0207656_10015391 | 3300025321 | Bacteria | 2960 |
| 189 | Ga0207656_10058456 | 3300025321 | Bacteria | 1684 |
| 190 | Ga0207682_10002048 | 3300025893 | Bacteria | 9129 |
| 191 | Ga0207682_10019312 | 3300025893 | Bacteria | 2668 |
| 192 | Ga0207642_10008084 | 3300025899 | Bacteria | 3589 |
| 193 | Ga0207688_10005782 | 3300025901 | Bacteria | 6734 |
| 194 | Ga0207688_10010987 | 3300025901 | Bacteria | 4926 |
| 195 | Ga0207688_10216640 | 3300025901 | Bacteria | 1152 |
| 196 | Ga0207680_10003501 | 3300025903 | Bacteria | 7397 |
| 197 | Ga0207680_10081644 | 3300025903 | Bacteria | 2033 |
| 198 | Ga0207647_10002329 | 3300025904 | Bacteria | 14424 |
| 199 | Ga0207699_10030056 | 3300025906 | Bacteria | 3036 |
| 200 | Ga0207645_10012759 | 3300025907 | Bacteria | 5696 |
| 201 | Ga0207645_10085645 | 3300025907 | Bacteria | 2024 |
| 202 | Ga0207645_10194097 | 3300025907 | Bacteria | 1335 |
| 203 | Ga0207705_10005796 | 3300025909 | Bacteria | 9203 |
| 204 | Ga0207705_10014786 | 3300025909 | Bacteria | 5612 |
| 205 | Ga0207705_10073102 | 3300025909 | Bacteria | 2487 |
| 206 | Ga0207707_10200113 | 3300025912 | Unclassified | 1742 |
| 207 | Ga0207695_10284321 | 3300025913 | Bacteria | 1547 |
| 208 | Ga0207693_10001789 | 3300025915 | Bacteria | 18831 |
| 209 | Ga0207660_10000059 | 3300025917 | Bacteria | 56766 |
| 210 | Ga0207657_10048342 | 3300025919 | Bacteria | 3715 |
| 211 | Ga0207657_10437398 | 3300025919 | Bacteria | 1027 |
| 212 | Ga0207649_10373378 | 3300025920 | Unclassified | 1061 |
| 213 | Ga0207652_10070525 | 3300025921 | Unclassified | 3035 |
| 214 | Ga0207681_10052753 | 3300025923 | Bacteria | 2758 |
| 215 | Ga0207681_10350889 | 3300025923 | Bacteria | 1181 |
| 216 | Ga0207681_10533424 | 3300025923 | Unclassified | 964 |
| 217 | Ga0207694_10293870 | 3300025924 | Bacteria | 1336 |
| 218 | Ga0207650_10008487 | 3300025925 | Bacteria | 7014 |
| 219 | Ga0207650_10010159 | 3300025925 | Bacteria | 6450 |
| 220 | Ga0207650_10254873 | 3300025925 | Bacteria | 1422 |
| 221 | Ga0207659_10015649 | 3300025926 | Bacteria | 4922 |
| 222 | Ga0207659_10287322 | 3300025926 | Bacteria | 1346 |
| 223 | Ga0207687_10079831 | 3300025927 | Bacteria | 2360 |
| 224 | Ga0207700_10231694 | 3300025928 | Bacteria | 1570 |
| 225 | Ga0207664_10046513 | 3300025929 | Bacteria | 3406 |
| 226 | Ga0207644_10001058 | 3300025931 | Bacteria | 17593 |
| 227 | Ga0207644_10005246 | 3300025931 | Bacteria | 8458 |
| 228 | Ga0207644_10005523 | 3300025931 | Bacteria | 8230 |
| 229 | Ga0207644_10039990 | 3300025931 | Bacteria | 3312 |
| 230 | Ga0207644_10075333 | 3300025931 | Unclassified | 2479 |
| 231 | Ga0207690_10283759 | 3300025932 | Unclassified | 1290 |
| 232 | Ga0207690_10375297 | 3300025932 | Bacteria | 1129 |
| 233 | Ga0207706_10003386 | 3300025933 | Bacteria | 15246 |
| 234 | Ga0207706_10028855 | 3300025933 | Bacteria | 4953 |
| 235 | Ga0207706_10034457 | 3300025933 | Bacteria | 4504 |
| 236 | Ga0207706_10082458 | 3300025933 | Bacteria | 2826 |
| 237 | Ga0207706_10167693 | 3300025933 | Bacteria | 1930 |
| 238 | Ga0207706_10289100 | 3300025933 | Unclassified | 1429 |
| 239 | Ga0207686_10072982 | 3300025934 | Bacteria | 2213 |
| 240 | Ga0207670_10213025 | 3300025936 | Unclassified | 1474 |
| 241 | Ga0207669_10017150 | 3300025937 | Bacteria | 3705 |
| 242 | Ga0207704_10108308 | 3300025938 | Bacteria | 1871 |
| 243 | Ga0207704_10216973 | 3300025938 | Unclassified | 1412 |
| 244 | Ga0207691_10000954 | 3300025940 | Bacteria | 28639 |
| 245 | Ga0207691_10001164 | 3300025940 | Bacteria | 26132 |
| 246 | Ga0207691_10042803 | 3300025940 | Bacteria | 4174 |
| 247 | Ga0207711_10002646 | 3300025941 | Bacteria | 15840 |
| 248 | Ga0207711_10003374 | 3300025941 | Bacteria | 13834 |
| 249 | Ga0207711_10003982 | 3300025941 | Bacteria | 12694 |
| 250 | Ga0207711_10022177 | 3300025941 | Bacteria | 5309 |
| 251 | Ga0207711_10226876 | 3300025941 | Bacteria | 1710 |
| 252 | Ga0207711_10300016 | 3300025941 | Bacteria | 1482 |
| 253 | Ga0207689_10034458 | 3300025942 | Bacteria | 4206 |
| 254 | Ga0207679_10205731 | 3300025945 | Bacteria | 1647 |
| 255 | Ga0207667_10097203 | 3300025949 | Bacteria | 3040 |
| 256 | Ga0207667_10570194 | 3300025949 | Unclassified | 1143 |
| 257 | Ga0207651_10000289 | 3300025960 | Bacteria | 21606 |
| 258 | Ga0207651_10011519 | 3300025960 | Bacteria | 4954 |
| 259 | Ga0207651_10021611 | 3300025960 | Bacteria | 3914 |
| 260 | Ga0207651_10054187 | 3300025960 | Bacteria | 2746 |
| 261 | Ga0207651_10193554 | 3300025960 | Unclassified | 1624 |
| 262 | Ga0207651_10203539 | 3300025960 | Unclassified | 1588 |
| 263 | Ga0207668_10039075 | 3300025972 | Bacteria | 3190 |
| 264 | Ga0207668_10537599 | 3300025972 | Bacteria | 1011 |
| 265 | Ga0207640_10211727 | 3300025981 | Unclassified | 1477 |
| 266 | Ga0207640_10347504 | 3300025981 | Bacteria | 1190 |
| 267 | Ga0207658_10004081 | 3300025986 | Bacteria | 10191 |
| 268 | Ga0207658_10005082 | 3300025986 | Bacteria | 9050 |
| 269 | Ga0207677_10013871 | 3300026023 | Bacteria | 4684 |
| 270 | Ga0207677_10483640 | 3300026023 | Bacteria | 1067 |
| 271 | Ga0207703_10002884 | 3300026035 | Bacteria | 14642 |
| 272 | Ga0207703_10005616 | 3300026035 | Bacteria | 10071 |
| 273 | Ga0207639_10200929 | 3300026041 | Bacteria | 1709 |
| 274 | Ga0207639_10511396 | 3300026041 | Unclassified | 1099 |
| 275 | Ga0207678_10002442 | 3300026067 | Bacteria | 16892 |
| 276 | Ga0207678_10018673 | 3300026067 | Bacteria | 6088 |
| 277 | Ga0207678_10025154 | 3300026067 | Bacteria | 5197 |
| 278 | Ga0207702_10041944 | 3300026078 | Bacteria | 3837 |
| 279 | Ga0207641_10005418 | 3300026088 | Bacteria | 10895 |
| 280 | Ga0207641_10176376 | 3300026088 | Bacteria | 1954 |
| 281 | Ga0207648_10005820 | 3300026089 | Bacteria | 12349 |
| 282 | Ga0207648_10010845 | 3300026089 | Bacteria | 8612 |
| 283 | Ga0207648_10095986 | 3300026089 | Bacteria | 2594 |
| 284 | Ga0207648_10146402 | 3300026089 | Bacteria | 2083 |
| 285 | Ga0207676_10009780 | 3300026095 | Bacteria | 6818 |
| 286 | Ga0207676_10422319 | 3300026095 | Unclassified | 1251 |
| 287 | Ga0207675_100015318 | 3300026118 | Bacteria | 7153 |
| 288 | Ga0207683_10001453 | 3300026121 | Bacteria | 21380 |
| 289 | Ga0207683_10007924 | 3300026121 | Bacteria | 9091 |
| 290 | Ga0207683_10017922 | 3300026121 | Bacteria | 6038 |
| 291 | Ga0207683_10188625 | 3300026121 | Bacteria | 1871 |
| 292 | Ga0207698_10419282 | 3300026142 | Bacteria | 1284 |
| 293 | Ga0207698_10570614 | 3300026142 | Bacteria | 1112 |
| 294 | Ga0268265_10030633 | 3300028380 | Bacteria | 3877 |
| 295 | Ga0268264_10227764 | 3300028381 | Bacteria | 1719 |
| 296 | Ga0307408_100161899 | 3300031548 | Bacteria | 1778 |
| 297 | Ga0307405_10070079 | 3300031731 | Bacteria | 2250 |
| 298 | Ga0307405_10079735 | 3300031731 | Bacteria | 2135 |
| 299 | Ga0307405_10140727 | 3300031731 | Bacteria | 1682 |
| 300 | Ga0307405_10455697 | 3300031731 | Unclassified | 1015 |
| 301 | Ga0307413_10165586 | 3300031824 | Bacteria | 1559 |
| 302 | Ga0307413_10200361 | 3300031824 | Bacteria | 1441 |
| 303 | Ga0307410_10128192 | 3300031852 | Bacteria | 1860 |
| 304 | Ga0307410_10179372 | 3300031852 | Bacteria | 1602 |
| 305 | Ga0307406_10062543 | 3300031901 | Bacteria | 2408 |
| 306 | Ga0307407_10029968 | 3300031903 | Bacteria | 2929 |
| 307 | Ga0307407_10079893 | 3300031903 | Bacteria | 1974 |
| 308 | Ga0307412_10040754 | 3300031911 | Bacteria | 3006 |
| 309 | Ga0307412_10049489 | 3300031911 | Bacteria | 2769 |
| 310 | Ga0307412_10213451 | 3300031911 | Bacteria | 1474 |
| 311 | Ga0307412_10250665 | 3300031911 | Bacteria | 1374 |
| 312 | Ga0307409_100025719 | 3300031995 | Bacteria | 4135 |
| 313 | Ga0307409_100029771 | 3300031995 | Bacteria | 3912 |
| 314 | Ga0307409_100051465 | 3300031995 | Bacteria | 3152 |
| 315 | Ga0307409_100119667 | 3300031995 | Bacteria | 2227 |
| 316 | Ga0307409_100415897 | 3300031995 | Bacteria | 1288 |
| 317 | Ga0307409_100425198 | 3300031995 | Bacteria | 1275 |
| 318 | Ga0307416_100005614 | 3300032002 | Bacteria | 7736 |
| 319 | Ga0307416_100017166 | 3300032002 | Bacteria | 5054 |
| 320 | Ga0307416_100052491 | 3300032002 | Bacteria | 3264 |
| 321 | Ga0307416_100217347 | 3300032002 | Bacteria | 1829 |
| 322 | Ga0307414_10030404 | 3300032004 | Bacteria | 3527 |
| 323 | Ga0307414_10206129 | 3300032004 | Bacteria | 1603 |
| 324 | Ga0307411_10013052 | 3300032005 | Bacteria | 4564 |
| 325 | Ga0307411_10081410 | 3300032005 | Bacteria | 2230 |
| 326 | Ga0307415_100013525 | 3300032126 | Bacteria | 4767 |
| 327 | Ga0307415_100356469 | 3300032126 | Bacteria | 1233 |
| 328 | Ga0307415_100455249 | 3300032126 | Bacteria | 1107 |
| 329 | Ga0373935_0073883 | 3300035692 | Bacteria | 2203 |
| 330 | Ga0373937_0022899 | 3300036401 | Bacteria | 5618 |
| 331 | Ga0395899_0000365 | 3300037312 | Bacteria | 54914 |
| 332 | Ga0395899_0002975 | 3300037312 | Bacteria | 13557 |
| 333 | Ga0395899_0027690 | 3300037312 | Unclassified | 4271 |
| 334 | Ga0395899_0027991 | 3300037312 | Plasmid | 4244 |
| 335 | Ga0395900_0000093 | 3300037418 | Bacteria | 166505 |
| 336 | Ga0395900_0003959 | 3300037418 | Bacteria | 15811 |
| 337 | Ga0395900_0017884 | 3300037418 | Bacteria | 7235 |
| 338 | Ga0395900_0084067 | 3300037418 | Bacteria | 3270 |
| 339 | Ga0395900_0097702 | 3300037418 | Bacteria | 3017 |
| 340 | Ga0395900_0542144 | 3300037418 | Bacteria | 1109 |
| 341 | Ga0395898_0000053 | 3300037466 | Bacteria | 279600 |
| 342 | Ga0395898_0001859 | 3300037466 | Bacteria | 27053 |
| 343 | Ga0395898_0113696 | 3300037466 | Bacteria | 2594 |
| 344 | Ga0395898_0327756 | 3300037466 | Archaea | 1460 |
| 345 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 346 | Ga0395905_0012904 | 3300037471 | Bacteria | 8032 |
| 347 | Ga0395905_0036724 | 3300037471 | Bacteria | 4602 |
| 348 | Ga0395905_0041683 | 3300037471 | Bacteria | 4308 |
| 349 | Ga0395905_0050489 | 3300037471 | Bacteria | 3897 |
| 350 | Ga0395905_0064255 | 3300037471 | Bacteria | 3434 |
| 351 | Ga0395905_0074543 | 3300037471 | Bacteria | 3180 |
| 352 | Ga0395905_0089780 | 3300037471 | Bacteria | 2880 |
| 353 | Ga0395901_0005161 | 3300038443 | Bacteria | 13180 |
| 354 | Ga0395901_0005379 | 3300038443 | Bacteria | 12950 |
| 355 | Ga0395901_0394554 | 3300038443 | Bacteria | 1422 |
| 356 | Ga0395901_0448482 | 3300038443 | Bacteria | 1320 |
| 357 | Ga0395901_0587000 | 3300038443 | Bacteria | 1125 |
| 358 | Ga0436365_1506208 | 3300039437 | Bacteria | 4114 |
| 359 | Ga0439458_0000172 | 3300042157 | Bacteria | 14580 |
| 360 | Ga0466972_0053021 | 3300044658 | Bacteria | 1954 |
| 361 | Ga0466965_0099513 | 3300044683 | Unclassified | 1486 |
| 362 | Ga0466966_0006278 | 3300044684 | Bacteria | 7863 |
| 363 | Ga0466971_0054556 | 3300044719 | Unclassified | 1801 |
| 364 | Ga0466957_0011733 | 3300044842 | Bacteria | 5064 |
| 365 | Ga0466957_0143142 | 3300044842 | Bacteria | 1542 |
| 366 | Ga0466960_0005826 | 3300044901 | Bacteria | 4909 |
| 367 | Ga0466959_0017840 | 3300045049 | Bacteria | 5207 |
| 368 | Ga0466958_0038496 | 3300045836 | Bacteria | 2870 |
| 369 | Ga0466958_0151380 | 3300045836 | Bacteria | 1463 |
| 370 | Ga0466958_0206369 | 3300045836 | Bacteria | 1251 |
| 371 | Ga0466967_0007633 | 3300045976 | Bacteria | 7827 |
| 372 | Ga0466967_0272814 | 3300045976 | Unclassified | 1621 |
| 373 | Ga0466967_0330043 | 3300045976 | Bacteria | 1473 |
| 374 | Ga0495643_0090277 | 3300046522 | Bacteria | 1581 |
| 375 | Ga0495598_0003795 | 3300046537 | Bacteria | 3231 |
| 376 | Ga0495621_0000574 | 3300046539 | Bacteria | 9164 |
| 377 | Ga0495668_0078289 | 3300046616 | Bacteria | 1815 |
| 378 | Ga0495668_0277441 | 3300046616 | Bacteria | 918 |
| 379 | Ga0495659_0101539 | 3300046664 | Bacteria | 1115 |
| 380 | Ga0495670_0000783 | 3300046691 | Bacteria | 15269 |
| 381 | Ga0495670_0002390 | 3300046691 | Bacteria | 9251 |
| 382 | Ga0495672_0050753 | 3300047320 | Bacteria | 2447 |
| 383 | Ga0495686_0003429 | 3300047472 | Bacteria | 13750 |
| 384 | Ga0496100_0007338 | 3300048903 | Bacteria | 6072 |
| 385 | Ga0496101_0001522 | 3300048904 | Bacteria | 13884 |
| 386 | Ga0496102_0587822 | 3300048905 | Unclassified | 1036 |
| 387 | Ga0496104_0515897 | 3300048907 | Bacteria | 1106 |
| 388 | Ga0496107_0003637 | 3300048910 | Bacteria | 10355 |
| 389 | Ga0496108_0001452 | 3300048911 | Bacteria | 18729 |
| 390 | Ga0496109_0008419 | 3300048912 | Bacteria | 8767 |
| 391 | Ga0496109_0339386 | 3300048912 | Bacteria | 1419 |
| 392 | Ga0496110_0456386 | 3300048913 | Bacteria | 1164 |
| 393 | Ga0496112_0040663 | 3300048915 | Bacteria | 4546 |
| 394 | Ga0496112_0155958 | 3300048915 | Bacteria | 2250 |
| 395 | Ga0496112_0320045 | 3300048915 | Bacteria | 1495 |
| 396 | Ga0496112_0343009 | 3300048915 | Unclassified | 1437 |
| 397 | Ga0496113_0413288 | 3300048916 | Bacteria | 1083 |
| 398 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 399 | Ga0496125_0067121 | 3300048928 | Bacteria | 2829 |
| 400 | Ga0501074_0036715 | 3300049590 | Bacteria | 3549 |
| 401 | nmdc:mga08y16_294206_c1 | 3300050511 | Bacteria | 1674 |
| 402 | nmdc:mga0n895_153659_c1 | 3300050512 | Bacteria | 2332 |
| 403 | Ga0500651_0029867 | 3300053093 | Bacteria | 3429 |
| 404 | Ga0500562_000231 | 3300053108 | Bacteria | 14654 |
| 405 | Ga0500642_0108703 | 3300053130 | Bacteria | 1294 |
| 406 | Ga0500655_001314 | 3300053133 | Bacteria | 4711 |
| 407 | Ga0500590_003445 | 3300053148 | Bacteria | 7294 |
| 408 | Ga0500622_0022326 | 3300053156 | Bacteria | 3356 |
| 409 | Ga0500639_017617 | 3300053163 | Bacteria | 3770 |
| 410 | Ga0500636_0097388 | 3300053177 | Bacteria | 1677 |
| 411 | Ga0466962_0036699 | 3300061719 | Bacteria | 2347 |
| 412 | Ga0466962_0079820 | 3300061719 | Bacteria | 1564 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0099513 | Ga0466965_0099513_790_1467 | 225 |
| 2 | 3300046616 | Ga0495668_0277441 | Ga0495668_0277441_207_893 | 225 |
| 3 | 3300048916 | Ga0496113_0413288 | Ga0496113_0413288_18_695 | 225 |
| 4 | 3300037418 | Ga0395900_0542144 | Ga0395900_0542144_65_769 | 234 |
| 5 | 3300038443 | Ga0395901_0587000 | Ga0395901_0587000_298_1002 | 234 |
| 6 | 3300005347 | Ga0070668_100231981 | Ga0070668_1002319811 | 238 |
| 7 | 3300025933 | Ga0207706_10034457 | Ga0207706_100344573 | 238 |
| 8 | 3300013306 | Ga0163162_10021164 | Ga0163162_100211642 | 239 |
| 9 | 3300025901 | Ga0207688_10216640 | Ga0207688_102166402 | 239 |
| 10 | 3300026142 | Ga0207698_10419282 | Ga0207698_104192822 | 239 |
| 11 | 3300035692 | Ga0373935_0073883 | Ga0373935_0073883_1468_2187 | 239 |
| 12 | 3300048907 | Ga0496104_0515897 | Ga0496104_0515897_71_793 | 239 |
| 13 | 3300005355 | Ga0070671_100019098 | Ga0070671_1000190981 | 245 |
| 14 | 3300005618 | Ga0068864_100204765 | Ga0068864_1002047652 | 245 |
| 15 | 3300025933 | Ga0207706_10167693 | Ga0207706_101676931 | 245 |
| 16 | 3300053177 | Ga0500636_0097388 | Ga0500636_0097388_441_1211 | 245 |
| 17 | 3300053130 | Ga0500642_0108703 | Ga0500642_0108703_525_1265 | 246 |
| 18 | 3300044658 | Ga0466972_0053021 | Ga0466972_0053021_823_1626 | 248 |
| 19 | 3300044901 | Ga0466960_0005826 | Ga0466960_0005826_1802_2605 | 248 |
| 20 | 3300046691 | Ga0495670_0002390 | Ga0495670_0002390_3722_4489 | 252 |
| 21 | 3300003791 | Ga0055530_10003447 | Ga0055530_100034477 | 253 |
| 22 | 3300003794 | Ga0055531_10002083 | Ga0055531_1000208312 | 253 |
| 23 | 3300005262 | Ga0065165_1001018 | Ga0065165_10010187 | 253 |
| 24 | 3300025297 | Ga0209758_1000331 | Ga0209758_100033168 | 253 |
| 25 | 3300025298 | Ga0209050_1000130 | Ga0209050_100013042 | 253 |
| 26 | 3300025302 | Ga0207426_1075726 | Ga0207426_10757262 | 253 |
| 27 | 3300025304 | Ga0209257_1000059 | Ga0209257_1000059237 | 253 |
| 28 | 3300005615 | Ga0070702_100291977 | Ga0070702_1002919772 | 254 |
| 29 | 3300009094 | Ga0111539_10017987 | Ga0111539_1001798710 | 254 |
| 30 | 3300009176 | Ga0105242_10108164 | Ga0105242_101081642 | 254 |
| 31 | 3300009177 | Ga0105248_10170772 | Ga0105248_101707722 | 254 |
| 32 | 3300013308 | Ga0157375_10035094 | Ga0157375_100350943 | 254 |
| 33 | 3300050511 | nmdc:mga08y16_294206_c1 | nmdc:mga08y16_294206_c1_25_789 | 254 |
| 34 | 3300046522 | Ga0495643_0090277 | Ga0495643_0090277_444_1214 | 255 |
| 35 | 3300046616 | Ga0495668_0078289 | Ga0495668_0078289_648_1418 | 255 |
| 36 | 3300048928 | Ga0496125_0067121 | Ga0496125_0067121_1212_1982 | 255 |
| 37 | 3300053093 | Ga0500651_0029867 | Ga0500651_0029867_671_1441 | 255 |
| 38 | 3300053133 | Ga0500655_001314 | Ga0500655_001314_1961_2731 | 255 |
| 39 | 3300053148 | Ga0500590_003445 | Ga0500590_003445_2941_3711 | 255 |
| 40 | 3300053156 | Ga0500622_0022326 | Ga0500622_0022326_1866_2636 | 255 |
| 41 | 3300053163 | Ga0500639_017617 | Ga0500639_017617_185_955 | 255 |
| 42 | 3300001989 | JGI24739J22299_10003916 | JGI24739J22299_100039163 | 258 |
| 43 | 3300042157 | Ga0439458_0000172 | Ga0439458_0000172_11328_12104 | 258 |
| 44 | 3300053108 | Ga0500562_000231 | Ga0500562_000231_8168_8956 | 258 |
| 45 | 3300009176 | Ga0105242_10406839 | Ga0105242_104068391 | 259 |
| 46 | 3300025934 | Ga0207686_10072982 | Ga0207686_100729823 | 259 |
| 47 | 3300025941 | Ga0207711_10226876 | Ga0207711_102268761 | 260 |
| 48 | 3300037471 | Ga0395905_0089780 | Ga0395905_0089780_772_1557 | 260 |
| 49 | 3300049590 | Ga0501074_0036715 | Ga0501074_0036715_2738_3529 | 261 |
| 50 | 3300005439 | Ga0070711_100009061 | Ga0070711_1000090614 | 262 |
| 51 | 3300036401 | Ga0373937_0022899 | Ga0373937_0022899_1476_2267 | 262 |
| 52 | 3300044684 | Ga0466966_0006278 | Ga0466966_0006278_5669_6460 | 262 |
| 53 | 3300045049 | Ga0466959_0017840 | Ga0466959_0017840_3388_4179 | 262 |
| 54 | 3300045836 | Ga0466958_0206369 | Ga0466958_0206369_21_812 | 262 |
| 55 | 3300002076 | JGI24749J21850_1002290 | JGI24749J21850_10022901 | 263 |
| 56 | 3300002459 | JGI24751J29686_10022859 | JGI24751J29686_100228592 | 263 |
| 57 | 3300003320 | rootH2_10055396 | rootH2_100553962 | 263 |
| 58 | 3300005290 | Ga0065712_10110584 | Ga0065712_101105843 | 263 |
| 59 | 3300005293 | Ga0065715_10007970 | Ga0065715_100079704 | 263 |
| 60 | 3300005328 | Ga0070676_10016631 | Ga0070676_100166312 | 263 |
| 61 | 3300005329 | Ga0070683_100196388 | Ga0070683_1001963882 | 263 |
| 62 | 3300005331 | Ga0070670_100006696 | Ga0070670_1000066966 | 263 |
| 63 | 3300005331 | Ga0070670_100039862 | Ga0070670_1000398625 | 263 |
| 64 | 3300005331 | Ga0070670_100189438 | Ga0070670_1001894381 | 263 |
| 65 | 3300005333 | Ga0070677_10001322 | Ga0070677_100013229 | 263 |
| 66 | 3300005336 | Ga0070680_100006408 | Ga0070680_1000064087 | 263 |
| 67 | 3300005339 | Ga0070660_100023131 | Ga0070660_1000231313 | 263 |
| 68 | 3300005344 | Ga0070661_100032607 | Ga0070661_1000326073 | 263 |
| 69 | 3300005344 | Ga0070661_100377395 | Ga0070661_1003773951 | 263 |
| 70 | 3300005353 | Ga0070669_100016896 | Ga0070669_1000168966 | 263 |
| 71 | 3300005355 | Ga0070671_100026172 | Ga0070671_1000261725 | 263 |
| 72 | 3300005366 | Ga0070659_100171658 | Ga0070659_1001716582 | 263 |
| 73 | 3300005366 | Ga0070659_100237590 | Ga0070659_1002375901 | 263 |
| 74 | 3300005367 | Ga0070667_100031906 | Ga0070667_1000319062 | 263 |
| 75 | 3300005435 | Ga0070714_100098763 | Ga0070714_1000987633 | 263 |
| 76 | 3300005435 | Ga0070714_100117842 | Ga0070714_1001178423 | 263 |
| 77 | 3300005436 | Ga0070713_100225189 | Ga0070713_1002251892 | 263 |
| 78 | 3300005441 | Ga0070700_100020567 | Ga0070700_1000205673 | 263 |
| 79 | 3300005455 | Ga0070663_100022403 | Ga0070663_1000224033 | 263 |
| 80 | 3300005455 | Ga0070663_100067151 | Ga0070663_1000671512 | 263 |
| 81 | 3300005456 | Ga0070678_100218140 | Ga0070678_1002181401 | 263 |
| 82 | 3300005457 | Ga0070662_100002083 | Ga0070662_10000208313 | 263 |
| 83 | 3300005457 | Ga0070662_100227171 | Ga0070662_1002271712 | 263 |
| 84 | 3300005459 | Ga0068867_100111192 | Ga0068867_1001111924 | 263 |
| 85 | 3300005530 | Ga0070679_100012027 | Ga0070679_1000120274 | 263 |
| 86 | 3300005530 | Ga0070679_100170696 | Ga0070679_1001706961 | 263 |
| 87 | 3300005539 | Ga0068853_100198946 | Ga0068853_1001989462 | 263 |
| 88 | 3300005539 | Ga0068853_100624053 | Ga0068853_1006240531 | 263 |
| 89 | 3300005543 | Ga0070672_100013662 | Ga0070672_1000136627 | 263 |
| 90 | 3300005563 | Ga0068855_100020174 | Ga0068855_1000201746 | 263 |
| 91 | 3300005564 | Ga0070664_100022170 | Ga0070664_1000221702 | 263 |
| 92 | 3300005564 | Ga0070664_100274303 | Ga0070664_1002743032 | 263 |
| 93 | 3300005578 | Ga0068854_100044304 | Ga0068854_1000443043 | 263 |
| 94 | 3300005578 | Ga0068854_100137287 | Ga0068854_1001372871 | 263 |
| 95 | 3300005616 | Ga0068852_100080917 | Ga0068852_1000809172 | 263 |
| 96 | 3300005616 | Ga0068852_100130534 | Ga0068852_1001305343 | 263 |
| 97 | 3300005617 | Ga0068859_100569775 | Ga0068859_1005697751 | 263 |
| 98 | 3300005834 | Ga0068851_10007579 | Ga0068851_100075795 | 263 |
| 99 | 3300005834 | Ga0068851_10029461 | Ga0068851_100294616 | 263 |
| 100 | 3300005844 | Ga0068862_100039491 | Ga0068862_1000394913 | 263 |
| 101 | 3300006175 | Ga0070712_100002029 | Ga0070712_10000202911 | 263 |
| 102 | 3300006881 | Ga0068865_100084848 | Ga0068865_1000848483 | 263 |
| 103 | 3300006931 | Ga0097620_100569740 | Ga0097620_1005697401 | 263 |
| 104 | 3300009551 | Ga0105238_10283952 | Ga0105238_102839522 | 263 |
| 105 | 3300009553 | Ga0105249_10011888 | Ga0105249_1001188810 | 263 |
| 106 | 3300013100 | Ga0157373_10107003 | Ga0157373_101070031 | 263 |
| 107 | 3300013306 | Ga0163162_10296108 | Ga0163162_102961081 | 263 |
| 108 | 3300013306 | Ga0163162_10802160 | Ga0163162_108021602 | 263 |
| 109 | 3300013307 | Ga0157372_10003383 | Ga0157372_100033836 | 263 |
| 110 | 3300014968 | Ga0157379_10202016 | Ga0157379_102020163 | 263 |
| 111 | 3300017792 | Ga0163161_10109436 | Ga0163161_101094361 | 263 |
| 112 | 3300025315 | Ga0207697_10001211 | Ga0207697_100012115 | 263 |
| 113 | 3300025321 | Ga0207656_10015391 | Ga0207656_100153916 | 263 |
| 114 | 3300025321 | Ga0207656_10058456 | Ga0207656_100584562 | 263 |
| 115 | 3300025893 | Ga0207682_10002048 | Ga0207682_1000204814 | 263 |
| 116 | 3300025901 | Ga0207688_10010987 | Ga0207688_100109874 | 263 |
| 117 | 3300025907 | Ga0207645_10085645 | Ga0207645_100856453 | 263 |
| 118 | 3300025909 | Ga0207705_10005796 | Ga0207705_100057966 | 263 |
| 119 | 3300025915 | Ga0207693_10001789 | Ga0207693_100017898 | 263 |
| 120 | 3300025917 | Ga0207660_10000059 | Ga0207660_1000005928 | 263 |
| 121 | 3300025919 | Ga0207657_10048342 | Ga0207657_100483422 | 263 |
| 122 | 3300025920 | Ga0207649_10373378 | Ga0207649_103733781 | 263 |
| 123 | 3300025921 | Ga0207652_10070525 | Ga0207652_100705251 | 263 |
| 124 | 3300025923 | Ga0207681_10052753 | Ga0207681_100527534 | 263 |
| 125 | 3300025923 | Ga0207681_10533424 | Ga0207681_105334241 | 263 |
| 126 | 3300025925 | Ga0207650_10008487 | Ga0207650_100084879 | 263 |
| 127 | 3300025926 | Ga0207659_10015649 | Ga0207659_100156494 | 263 |
| 128 | 3300025928 | Ga0207700_10231694 | Ga0207700_102316941 | 263 |
| 129 | 3300025931 | Ga0207644_10039990 | Ga0207644_100399906 | 263 |
| 130 | 3300025931 | Ga0207644_10075333 | Ga0207644_100753333 | 263 |
| 131 | 3300025933 | Ga0207706_10003386 | Ga0207706_100033864 | 263 |
| 132 | 3300025940 | Ga0207691_10001164 | Ga0207691_1000116410 | 263 |
| 133 | 3300025941 | Ga0207711_10003982 | Ga0207711_100039823 | 263 |
| 134 | 3300025941 | Ga0207711_10022177 | Ga0207711_100221778 | 263 |
| 135 | 3300025945 | Ga0207679_10205731 | Ga0207679_102057312 | 263 |
| 136 | 3300025949 | Ga0207667_10097203 | Ga0207667_100972035 | 263 |
| 137 | 3300025960 | Ga0207651_10193554 | Ga0207651_101935541 | 263 |
| 138 | 3300025960 | Ga0207651_10203539 | Ga0207651_102035391 | 263 |
| 139 | 3300025972 | Ga0207668_10039075 | Ga0207668_100390752 | 263 |
| 140 | 3300026041 | Ga0207639_10511396 | Ga0207639_105113961 | 263 |
| 141 | 3300026067 | Ga0207678_10002442 | Ga0207678_100024426 | 263 |
| 142 | 3300026067 | Ga0207678_10025154 | Ga0207678_100251547 | 263 |
| 143 | 3300026089 | Ga0207648_10095986 | Ga0207648_100959866 | 263 |
| 144 | 3300026089 | Ga0207648_10146402 | Ga0207648_101464021 | 263 |
| 145 | 3300026095 | Ga0207676_10422319 | Ga0207676_104223191 | 263 |
| 146 | 3300026118 | Ga0207675_100015318 | Ga0207675_1000153186 | 263 |
| 147 | 3300026121 | Ga0207683_10007924 | Ga0207683_100079243 | 263 |
| 148 | 3300028380 | Ga0268265_10030633 | Ga0268265_100306337 | 263 |
| 149 | 3300031548 | Ga0307408_100161899 | Ga0307408_1001618992 | 263 |
| 150 | 3300031731 | Ga0307405_10070079 | Ga0307405_100700792 | 263 |
| 151 | 3300031731 | Ga0307405_10079735 | Ga0307405_100797351 | 263 |
| 152 | 3300031731 | Ga0307405_10140727 | Ga0307405_101407272 | 263 |
| 153 | 3300031731 | Ga0307405_10455697 | Ga0307405_104556971 | 263 |
| 154 | 3300031824 | Ga0307413_10165586 | Ga0307413_101655862 | 263 |
| 155 | 3300031824 | Ga0307413_10200361 | Ga0307413_102003612 | 263 |
| 156 | 3300031852 | Ga0307410_10128192 | Ga0307410_101281921 | 263 |
| 157 | 3300031852 | Ga0307410_10179372 | Ga0307410_101793721 | 263 |
| 158 | 3300031901 | Ga0307406_10062543 | Ga0307406_100625431 | 263 |
| 159 | 3300031903 | Ga0307407_10029968 | Ga0307407_100299682 | 263 |
| 160 | 3300031903 | Ga0307407_10079893 | Ga0307407_100798931 | 263 |
| 161 | 3300031911 | Ga0307412_10040754 | Ga0307412_100407541 | 263 |
| 162 | 3300031911 | Ga0307412_10049489 | Ga0307412_100494893 | 263 |
| 163 | 3300031911 | Ga0307412_10213451 | Ga0307412_102134512 | 263 |
| 164 | 3300031911 | Ga0307412_10250665 | Ga0307412_102506652 | 263 |
| 165 | 3300031995 | Ga0307409_100025719 | Ga0307409_1000257192 | 263 |
| 166 | 3300031995 | Ga0307409_100029771 | Ga0307409_1000297716 | 263 |
| 167 | 3300031995 | Ga0307409_100051465 | Ga0307409_1000514652 | 263 |
| 168 | 3300031995 | Ga0307409_100119667 | Ga0307409_1001196672 | 263 |
| 169 | 3300031995 | Ga0307409_100415897 | Ga0307409_1004158972 | 263 |
| 170 | 3300031995 | Ga0307409_100425198 | Ga0307409_1004251981 | 263 |
| 171 | 3300032002 | Ga0307416_100005614 | Ga0307416_10000561411 | 263 |
| 172 | 3300032002 | Ga0307416_100017166 | Ga0307416_1000171663 | 263 |
| 173 | 3300032002 | Ga0307416_100052491 | Ga0307416_1000524912 | 263 |
| 174 | 3300032002 | Ga0307416_100217347 | Ga0307416_1002173471 | 263 |
| 175 | 3300032004 | Ga0307414_10030404 | Ga0307414_100304043 | 263 |
| 176 | 3300032004 | Ga0307414_10206129 | Ga0307414_102061292 | 263 |
| 177 | 3300032005 | Ga0307411_10013052 | Ga0307411_100130522 | 263 |
| 178 | 3300032005 | Ga0307411_10081410 | Ga0307411_100814102 | 263 |
| 179 | 3300032126 | Ga0307415_100013525 | Ga0307415_1000135252 | 263 |
| 180 | 3300032126 | Ga0307415_100356469 | Ga0307415_1003564692 | 263 |
| 181 | 3300032126 | Ga0307415_100455249 | Ga0307415_1004552491 | 263 |
| 182 | 3300037312 | Ga0395899_0000365 | Ga0395899_0000365_52760_53554 | 263 |
| 183 | 3300037312 | Ga0395899_0002975 | Ga0395899_0002975_10765_11559 | 263 |
| 184 | 3300037312 | Ga0395899_0027991 | Ga0395899_0027991_1260_2099 | 263 |
| 185 | 3300037418 | Ga0395900_0000093 | Ga0395900_0000093_1118_1912 | 263 |
| 186 | 3300037418 | Ga0395900_0003959 | Ga0395900_0003959_3690_4484 | 263 |
| 187 | 3300037418 | Ga0395900_0084067 | Ga0395900_0084067_791_1585 | 263 |
| 188 | 3300037466 | Ga0395898_0000053 | Ga0395898_0000053_1118_1912 | 263 |
| 189 | 3300037466 | Ga0395898_0001859 | Ga0395898_0001859_24117_24911 | 263 |
| 190 | 3300037466 | Ga0395898_0113696 | Ga0395898_0113696_1714_2553 | 263 |
| 191 | 3300037471 | Ga0395905_0000031 | Ga0395905_0000031_284846_285640 | 263 |
| 192 | 3300037471 | Ga0395905_0036724 | Ga0395905_0036724_1877_2671 | 263 |
| 193 | 3300037471 | Ga0395905_0041683 | Ga0395905_0041683_1811_2605 | 263 |
| 194 | 3300037471 | Ga0395905_0050489 | Ga0395905_0050489_2416_3210 | 263 |
| 195 | 3300038443 | Ga0395901_0005161 | Ga0395901_0005161_12224_13018 | 263 |
| 196 | 3300038443 | Ga0395901_0005379 | Ga0395901_0005379_11039_11833 | 263 |
| 197 | 3300038443 | Ga0395901_0448482 | Ga0395901_0448482_441_1235 | 263 |
| 198 | 3300044719 | Ga0466971_0054556 | Ga0466971_0054556_133_927 | 263 |
| 199 | 3300044842 | Ga0466957_0011733 | Ga0466957_0011733_1802_2596 | 263 |
| 200 | 3300044842 | Ga0466957_0143142 | Ga0466957_0143142_484_1275 | 263 |
| 201 | 3300045836 | Ga0466958_0038496 | Ga0466958_0038496_688_1482 | 263 |
| 202 | 3300045836 | Ga0466958_0151380 | Ga0466958_0151380_196_990 | 263 |
| 203 | 3300045976 | Ga0466967_0007633 | Ga0466967_0007633_4082_4876 | 263 |
| 204 | 3300045976 | Ga0466967_0272814 | Ga0466967_0272814_246_1040 | 263 |
| 205 | 3300045976 | Ga0466967_0330043 | Ga0466967_0330043_260_1054 | 263 |
| 206 | 3300048912 | Ga0496109_0339386 | Ga0496109_0339386_502_1296 | 263 |
| 207 | 3300048915 | Ga0496112_0040663 | Ga0496112_0040663_742_1536 | 263 |
| 208 | 3300048915 | Ga0496112_0343009 | Ga0496112_0343009_244_1038 | 263 |
| 209 | 3300061719 | Ga0466962_0036699 | Ga0466962_0036699_539_1333 | 263 |
| 210 | 3300061719 | Ga0466962_0079820 | Ga0466962_0079820_675_1469 | 263 |
| 211 | 3300001978 | JGI24747J21853_1001180 | JGI24747J21853_10011802 | 264 |
| 212 | 3300001990 | JGI24737J22298_10038300 | JGI24737J22298_100383001 | 264 |
| 213 | 3300001991 | JGI24743J22301_10025569 | JGI24743J22301_100255692 | 264 |
| 214 | 3300002073 | JGI24745J21846_1006716 | JGI24745J21846_10067161 | 264 |
| 215 | 3300002077 | JGI24744J21845_10002622 | JGI24744J21845_100026224 | 264 |
| 216 | 3300003316 | rootH1_10124416 | rootH1_101244162 | 264 |
| 217 | 3300005327 | Ga0070658_10104150 | Ga0070658_101041503 | 264 |
| 218 | 3300005327 | Ga0070658_10535080 | Ga0070658_105350801 | 264 |
| 219 | 3300005328 | Ga0070676_10171969 | Ga0070676_101719692 | 264 |
| 220 | 3300005328 | Ga0070676_10207817 | Ga0070676_102078172 | 264 |
| 221 | 3300005330 | Ga0070690_100001926 | Ga0070690_1000019266 | 264 |
| 222 | 3300005330 | Ga0070690_100060321 | Ga0070690_1000603211 | 264 |
| 223 | 3300005331 | Ga0070670_100004030 | Ga0070670_1000040306 | 264 |
| 224 | 3300005331 | Ga0070670_100575826 | Ga0070670_1005758262 | 264 |
| 225 | 3300005334 | Ga0068869_100087118 | Ga0068869_1000871184 | 264 |
| 226 | 3300005335 | Ga0070666_10040106 | Ga0070666_100401063 | 264 |
| 227 | 3300005335 | Ga0070666_10092191 | Ga0070666_100921911 | 264 |
| 228 | 3300005338 | Ga0068868_100002343 | Ga0068868_10000234318 | 264 |
| 229 | 3300005338 | Ga0068868_100044527 | Ga0068868_1000445274 | 264 |
| 230 | 3300005338 | Ga0068868_100048979 | Ga0068868_1000489794 | 264 |
| 231 | 3300005339 | Ga0070660_100411870 | Ga0070660_1004118702 | 264 |
| 232 | 3300005340 | Ga0070689_100315643 | Ga0070689_1003156432 | 264 |
| 233 | 3300005347 | Ga0070668_100014711 | Ga0070668_1000147115 | 264 |
| 234 | 3300005354 | Ga0070675_100107085 | Ga0070675_1001070851 | 264 |
| 235 | 3300005354 | Ga0070675_100162556 | Ga0070675_1001625562 | 264 |
| 236 | 3300005354 | Ga0070675_100327380 | Ga0070675_1003273802 | 264 |
| 237 | 3300005355 | Ga0070671_100002744 | Ga0070671_1000027448 | 264 |
| 238 | 3300005355 | Ga0070671_100002863 | Ga0070671_10000286317 | 264 |
| 239 | 3300005355 | Ga0070671_100086487 | Ga0070671_1000864872 | 264 |
| 240 | 3300005355 | Ga0070671_100106361 | Ga0070671_1001063613 | 264 |
| 241 | 3300005355 | Ga0070671_100124225 | Ga0070671_1001242251 | 264 |
| 242 | 3300005356 | Ga0070674_100023094 | Ga0070674_1000230944 | 264 |
| 243 | 3300005356 | Ga0070674_100033005 | Ga0070674_1000330052 | 264 |
| 244 | 3300005364 | Ga0070673_100003651 | Ga0070673_1000036515 | 264 |
| 245 | 3300005364 | Ga0070673_100010276 | Ga0070673_1000102761 | 264 |
| 246 | 3300005364 | Ga0070673_100019876 | Ga0070673_1000198762 | 264 |
| 247 | 3300005364 | Ga0070673_100562956 | Ga0070673_1005629561 | 264 |
| 248 | 3300005366 | Ga0070659_100001753 | Ga0070659_1000017531 | 264 |
| 249 | 3300005366 | Ga0070659_100207125 | Ga0070659_1002071252 | 264 |
| 250 | 3300005366 | Ga0070659_100285937 | Ga0070659_1002859372 | 264 |
| 251 | 3300005367 | Ga0070667_100002750 | Ga0070667_10000275011 | 264 |
| 252 | 3300005367 | Ga0070667_100309768 | Ga0070667_1003097681 | 264 |
| 253 | 3300005436 | Ga0070713_100013582 | Ga0070713_1000135825 | 264 |
| 254 | 3300005455 | Ga0070663_100124022 | Ga0070663_1001240224 | 264 |
| 255 | 3300005455 | Ga0070663_100401525 | Ga0070663_1004015252 | 264 |
| 256 | 3300005456 | Ga0070678_100014954 | Ga0070678_1000149546 | 264 |
| 257 | 3300005456 | Ga0070678_100019307 | Ga0070678_1000193071 | 264 |
| 258 | 3300005456 | Ga0070678_100151636 | Ga0070678_1001516362 | 264 |
| 259 | 3300005457 | Ga0070662_100046983 | Ga0070662_1000469832 | 264 |
| 260 | 3300005458 | Ga0070681_10201978 | Ga0070681_102019782 | 264 |
| 261 | 3300005459 | Ga0068867_100003061 | Ga0068867_1000030614 | 264 |
| 262 | 3300005459 | Ga0068867_100009786 | Ga0068867_1000097864 | 264 |
| 263 | 3300005539 | Ga0068853_100219605 | Ga0068853_1002196052 | 264 |
| 264 | 3300005543 | Ga0070672_100016832 | Ga0070672_1000168325 | 264 |
| 265 | 3300005543 | Ga0070672_100046292 | Ga0070672_1000462922 | 264 |
| 266 | 3300005543 | Ga0070672_100324285 | Ga0070672_1003242852 | 264 |
| 267 | 3300005543 | Ga0070672_100696340 | Ga0070672_1006963401 | 264 |
| 268 | 3300005544 | Ga0070686_100001629 | Ga0070686_1000016296 | 264 |
| 269 | 3300005544 | Ga0070686_100120476 | Ga0070686_1001204762 | 264 |
| 270 | 3300005547 | Ga0070693_100086749 | Ga0070693_1000867492 | 264 |
| 271 | 3300005563 | Ga0068855_100133080 | Ga0068855_1001330803 | 264 |
| 272 | 3300005564 | Ga0070664_100150498 | Ga0070664_1001504981 | 264 |
| 273 | 3300005578 | Ga0068854_100158378 | Ga0068854_1001583781 | 264 |
| 274 | 3300005614 | Ga0068856_100033822 | Ga0068856_1000338225 | 264 |
| 275 | 3300005616 | Ga0068852_100173967 | Ga0068852_1001739672 | 264 |
| 276 | 3300005617 | Ga0068859_100028314 | Ga0068859_1000283146 | 264 |
| 277 | 3300005718 | Ga0068866_10010865 | Ga0068866_100108653 | 264 |
| 278 | 3300005718 | Ga0068866_10033220 | Ga0068866_100332204 | 264 |
| 279 | 3300005718 | Ga0068866_10036053 | Ga0068866_100360534 | 264 |
| 280 | 3300005719 | Ga0068861_100230916 | Ga0068861_1002309162 | 264 |
| 281 | 3300005834 | Ga0068851_10058502 | Ga0068851_100585024 | 264 |
| 282 | 3300005841 | Ga0068863_100007458 | Ga0068863_1000074585 | 264 |
| 283 | 3300005841 | Ga0068863_100012971 | Ga0068863_1000129712 | 264 |
| 284 | 3300005842 | Ga0068858_100019228 | Ga0068858_1000192286 | 264 |
| 285 | 3300005842 | Ga0068858_100038694 | Ga0068858_1000386945 | 264 |
| 286 | 3300005842 | Ga0068858_100275886 | Ga0068858_1002758862 | 264 |
| 287 | 3300005843 | Ga0068860_100081369 | Ga0068860_1000813693 | 264 |
| 288 | 3300006028 | Ga0070717_10204982 | Ga0070717_102049822 | 264 |
| 289 | 3300006173 | Ga0070716_100134398 | Ga0070716_1001343982 | 264 |
| 290 | 3300006237 | Ga0097621_100324452 | Ga0097621_1003244521 | 264 |
| 291 | 3300006358 | Ga0068871_100042864 | Ga0068871_1000428643 | 264 |
| 292 | 3300006871 | Ga0075434_100017710 | Ga0075434_1000177103 | 264 |
| 293 | 3300006881 | Ga0068865_100001641 | Ga0068865_1000016419 | 264 |
| 294 | 3300006931 | Ga0097620_100028315 | Ga0097620_1000283152 | 264 |
| 295 | 3300009098 | Ga0105245_10272375 | Ga0105245_102723753 | 264 |
| 296 | 3300009098 | Ga0105245_10492127 | Ga0105245_104921271 | 264 |
| 297 | 3300009148 | Ga0105243_10139388 | Ga0105243_101393882 | 264 |
| 298 | 3300009174 | Ga0105241_10454881 | Ga0105241_104548812 | 264 |
| 299 | 3300009177 | Ga0105248_10002097 | Ga0105248_1000209722 | 264 |
| 300 | 3300009177 | Ga0105248_10180218 | Ga0105248_101802182 | 264 |
| 301 | 3300009551 | Ga0105238_10202893 | Ga0105238_102028932 | 264 |
| 302 | 3300010375 | Ga0105239_10836702 | Ga0105239_108367022 | 264 |
| 303 | 3300011119 | Ga0105246_10420746 | Ga0105246_104207462 | 264 |
| 304 | 3300013100 | Ga0157373_10075106 | Ga0157373_100751062 | 264 |
| 305 | 3300013100 | Ga0157373_10122605 | Ga0157373_101226051 | 264 |
| 306 | 3300013102 | Ga0157371_10091138 | Ga0157371_100911381 | 264 |
| 307 | 3300013296 | Ga0157374_10004363 | Ga0157374_100043637 | 264 |
| 308 | 3300013296 | Ga0157374_10326809 | Ga0157374_103268092 | 264 |
| 309 | 3300013296 | Ga0157374_10605356 | Ga0157374_106053561 | 264 |
| 310 | 3300013297 | Ga0157378_10041421 | Ga0157378_100414213 | 264 |
| 311 | 3300013297 | Ga0157378_10177673 | Ga0157378_101776732 | 264 |
| 312 | 3300013297 | Ga0157378_10203313 | Ga0157378_102033133 | 264 |
| 313 | 3300013306 | Ga0163162_10275056 | Ga0163162_102750562 | 264 |
| 314 | 3300013306 | Ga0163162_10413911 | Ga0163162_104139111 | 264 |
| 315 | 3300014325 | Ga0163163_10069868 | Ga0163163_100698681 | 264 |
| 316 | 3300014745 | Ga0157377_10194393 | Ga0157377_101943931 | 264 |
| 317 | 3300014968 | Ga0157379_10048726 | Ga0157379_100487263 | 264 |
| 318 | 3300014969 | Ga0157376_10032581 | Ga0157376_100325811 | 264 |
| 319 | 3300020082 | Ga0206353_11297066 | Ga0206353_112970662 | 264 |
| 320 | 3300021384 | Ga0213876_10017463 | Ga0213876_100174632 | 264 |
| 321 | 3300025893 | Ga0207682_10019312 | Ga0207682_100193122 | 264 |
| 322 | 3300025899 | Ga0207642_10008084 | Ga0207642_100080843 | 264 |
| 323 | 3300025901 | Ga0207688_10005782 | Ga0207688_100057827 | 264 |
| 324 | 3300025903 | Ga0207680_10003501 | Ga0207680_100035014 | 264 |
| 325 | 3300025903 | Ga0207680_10081644 | Ga0207680_100816442 | 264 |
| 326 | 3300025904 | Ga0207647_10002329 | Ga0207647_100023298 | 264 |
| 327 | 3300025906 | Ga0207699_10030056 | Ga0207699_100300561 | 264 |
| 328 | 3300025907 | Ga0207645_10012759 | Ga0207645_100127594 | 264 |
| 329 | 3300025907 | Ga0207645_10194097 | Ga0207645_101940972 | 264 |
| 330 | 3300025909 | Ga0207705_10014786 | Ga0207705_100147866 | 264 |
| 331 | 3300025909 | Ga0207705_10073102 | Ga0207705_100731022 | 264 |
| 332 | 3300025912 | Ga0207707_10200113 | Ga0207707_102001132 | 264 |
| 333 | 3300025913 | Ga0207695_10284321 | Ga0207695_102843212 | 264 |
| 334 | 3300025919 | Ga0207657_10437398 | Ga0207657_104373981 | 264 |
| 335 | 3300025923 | Ga0207681_10350889 | Ga0207681_103508891 | 264 |
| 336 | 3300025924 | Ga0207694_10293870 | Ga0207694_102938702 | 264 |
| 337 | 3300025925 | Ga0207650_10010159 | Ga0207650_100101598 | 264 |
| 338 | 3300025925 | Ga0207650_10254873 | Ga0207650_102548732 | 264 |
| 339 | 3300025926 | Ga0207659_10287322 | Ga0207659_102873222 | 264 |
| 340 | 3300025927 | Ga0207687_10079831 | Ga0207687_100798311 | 264 |
| 341 | 3300025929 | Ga0207664_10046513 | Ga0207664_100465133 | 264 |
| 342 | 3300025931 | Ga0207644_10001058 | Ga0207644_1000105820 | 264 |
| 343 | 3300025931 | Ga0207644_10005246 | Ga0207644_100052466 | 264 |
| 344 | 3300025931 | Ga0207644_10005523 | Ga0207644_100055234 | 264 |
| 345 | 3300025932 | Ga0207690_10283759 | Ga0207690_102837592 | 264 |
| 346 | 3300025932 | Ga0207690_10375297 | Ga0207690_103752972 | 264 |
| 347 | 3300025933 | Ga0207706_10028855 | Ga0207706_100288552 | 264 |
| 348 | 3300025933 | Ga0207706_10082458 | Ga0207706_100824582 | 264 |
| 349 | 3300025933 | Ga0207706_10289100 | Ga0207706_102891001 | 264 |
| 350 | 3300025936 | Ga0207670_10213025 | Ga0207670_102130252 | 264 |
| 351 | 3300025937 | Ga0207669_10017150 | Ga0207669_100171504 | 264 |
| 352 | 3300025938 | Ga0207704_10108308 | Ga0207704_101083082 | 264 |
| 353 | 3300025938 | Ga0207704_10216973 | Ga0207704_102169731 | 264 |
| 354 | 3300025940 | Ga0207691_10000954 | Ga0207691_1000095416 | 264 |
| 355 | 3300025940 | Ga0207691_10042803 | Ga0207691_100428035 | 264 |
| 356 | 3300025941 | Ga0207711_10002646 | Ga0207711_1000264610 | 264 |
| 357 | 3300025941 | Ga0207711_10003374 | Ga0207711_100033749 | 264 |
| 358 | 3300025941 | Ga0207711_10300016 | Ga0207711_103000162 | 264 |
| 359 | 3300025942 | Ga0207689_10034458 | Ga0207689_100344582 | 264 |
| 360 | 3300025949 | Ga0207667_10570194 | Ga0207667_105701941 | 264 |
| 361 | 3300025960 | Ga0207651_10000289 | Ga0207651_1000028920 | 264 |
| 362 | 3300025960 | Ga0207651_10011519 | Ga0207651_100115192 | 264 |
| 363 | 3300025960 | Ga0207651_10021611 | Ga0207651_100216112 | 264 |
| 364 | 3300025960 | Ga0207651_10054187 | Ga0207651_100541872 | 264 |
| 365 | 3300025972 | Ga0207668_10537599 | Ga0207668_105375991 | 264 |
| 366 | 3300025981 | Ga0207640_10211727 | Ga0207640_102117272 | 264 |
| 367 | 3300025981 | Ga0207640_10347504 | Ga0207640_103475042 | 264 |
| 368 | 3300025986 | Ga0207658_10004081 | Ga0207658_100040817 | 264 |
| 369 | 3300025986 | Ga0207658_10005082 | Ga0207658_100050822 | 264 |
| 370 | 3300026023 | Ga0207677_10013871 | Ga0207677_100138715 | 264 |
| 371 | 3300026023 | Ga0207677_10483640 | Ga0207677_104836401 | 264 |
| 372 | 3300026035 | Ga0207703_10002884 | Ga0207703_100028849 | 264 |
| 373 | 3300026035 | Ga0207703_10005616 | Ga0207703_100056167 | 264 |
| 374 | 3300026041 | Ga0207639_10200929 | Ga0207639_102009292 | 264 |
| 375 | 3300026067 | Ga0207678_10018673 | Ga0207678_100186734 | 264 |
| 376 | 3300026078 | Ga0207702_10041944 | Ga0207702_100419442 | 264 |
| 377 | 3300026088 | Ga0207641_10005418 | Ga0207641_100054188 | 264 |
| 378 | 3300026088 | Ga0207641_10176376 | Ga0207641_101763762 | 264 |
| 379 | 3300026089 | Ga0207648_10005820 | Ga0207648_1000582015 | 264 |
| 380 | 3300026089 | Ga0207648_10010845 | Ga0207648_100108454 | 264 |
| 381 | 3300026095 | Ga0207676_10009780 | Ga0207676_100097809 | 264 |
| 382 | 3300026121 | Ga0207683_10001453 | Ga0207683_1000145311 | 264 |
| 383 | 3300026121 | Ga0207683_10017922 | Ga0207683_100179224 | 264 |
| 384 | 3300026121 | Ga0207683_10188625 | Ga0207683_101886252 | 264 |
| 385 | 3300026142 | Ga0207698_10570614 | Ga0207698_105706141 | 264 |
| 386 | 3300028381 | Ga0268264_10227764 | Ga0268264_102277643 | 264 |
| 387 | 3300037312 | Ga0395899_0027690 | Ga0395899_0027690_385_1179 | 264 |
| 388 | 3300037418 | Ga0395900_0017884 | Ga0395900_0017884_4388_5182 | 264 |
| 389 | 3300037418 | Ga0395900_0097702 | Ga0395900_0097702_588_1382 | 264 |
| 390 | 3300037466 | Ga0395898_0327756 | Ga0395898_0327756_282_1076 | 264 |
| 391 | 3300037471 | Ga0395905_0012904 | Ga0395905_0012904_1579_2373 | 264 |
| 392 | 3300037471 | Ga0395905_0064255 | Ga0395905_0064255_1042_1836 | 264 |
| 393 | 3300037471 | Ga0395905_0074543 | Ga0395905_0074543_1734_2528 | 264 |
| 394 | 3300038443 | Ga0395901_0394554 | Ga0395901_0394554_144_938 | 264 |
| 395 | 3300039437 | Ga0436365_1506208 | Ga0436365_1506208_854_1657 | 264 |
| 396 | 3300046537 | Ga0495598_0003795 | Ga0495598_0003795_480_1274 | 264 |
| 397 | 3300046539 | Ga0495621_0000574 | Ga0495621_0000574_353_1147 | 264 |
| 398 | 3300046664 | Ga0495659_0101539 | Ga0495659_0101539_221_1015 | 264 |
| 399 | 3300046691 | Ga0495670_0000783 | Ga0495670_0000783_10800_11594 | 264 |
| 400 | 3300047320 | Ga0495672_0050753 | Ga0495672_0050753_422_1225 | 264 |
| 401 | 3300047472 | Ga0495686_0003429 | Ga0495686_0003429_5161_5967 | 264 |
| 402 | 3300048903 | Ga0496100_0007338 | Ga0496100_0007338_503_1300 | 264 |
| 403 | 3300048904 | Ga0496101_0001522 | Ga0496101_0001522_11375_12172 | 264 |
| 404 | 3300048905 | Ga0496102_0587822 | Ga0496102_0587822_97_891 | 264 |
| 405 | 3300048910 | Ga0496107_0003637 | Ga0496107_0003637_5942_6739 | 264 |
| 406 | 3300048911 | Ga0496108_0001452 | Ga0496108_0001452_14000_14797 | 264 |
| 407 | 3300048912 | Ga0496109_0008419 | Ga0496109_0008419_1966_2763 | 264 |
| 408 | 3300048913 | Ga0496110_0456386 | Ga0496110_0456386_223_1020 | 264 |
| 409 | 3300048915 | Ga0496112_0155958 | Ga0496112_0155958_191_985 | 264 |
| 410 | 3300048915 | Ga0496112_0320045 | Ga0496112_0320045_504_1301 | 264 |
| 411 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_278890_279684 | 264 |
| 412 | 3300050512 | nmdc:mga0n895_153659_c1 | nmdc:mga0n895_153659_c1_518_1324 | 264 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kav-assembly1.cif.gz_A | crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 | 0.4401 | 118 | 222 |
| 3kav-assembly1.cif.gz_A | crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 | 0.4258 | 118 | 222 |
| 3kaw-assembly1.cif.gz_A | crystal structure of pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 | 0.4113 | 146 | 221 |
| 2c63-assembly2.cif.gz_D | 14-3-3 protein eta (human) complexed to peptide | 0.3645 | 50 | 223 |
| 6q6b-assembly1.cif.gz_A | structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents | 0.3637 | 88 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6YZ04_1_129_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.6021 | 13 | 97 | 1.20.140.40 |
| af_B6U3T4_15_155_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.57 | 18 | 100 | 1.20.1250.20 |
| af_I1MHL2_72_227_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.4963 | 7 | 98 | 1.20.140.40 |
| af_Q8MZ67_1_133_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4655 | 118 | 236 | 1.20.140.150 |
| af_C0HEA1_38_187_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.4473 | 93 | 221 | 1.20.140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4YWN1-F1-model_v4 | DUF2306 domain-containing protein | 0.9856 | 27 | 258 |
GO:0016020
|
| AF-A0A6N0X514-F1-model_v4 | DUF2306 domain-containing protein | 0.9853 | 27 | 255 |
GO:0016020
|
| AF-A0A2S8B4K7-F1-model_v4 | Uncharacterized protein | 0.9839 | 27 | 255 |
GO:0016020
|
| AF-A0A7U1E9B7-F1-model_v4 | deleted | 0.9816 | 27 | 169 |
|
| AF-A0A0Q4KJR6-F1-model_v4 | Uncharacterized protein | 0.9812 | 12 | 257 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar