metagRoot

F437875

General Info

Members	Datasets	Scaffolds	Average Seq Length
412	216	412	263

Family's Representative Sequence

Representative Sequence	3300044901\|Ga0466960_0005826\|Ga0466960_0005826_1802_2605
Length	251
Sequence	MATLAETETARVYSQSNDDRFFVRGAVIMALTIVVGFSFQYAMGRSTFMAPPLVHAHAIVFMGWVVIFLTQNLLVGAGRVDIHRRLGWIALGWIFPMVLLGCLVTLAMVRRGQVPFFFRPLQFAAVALRRQTDWHRRLHFCGMTLLMGPAFGRLLPGPLLQPWAWEAVFAACLLFPVAGVVADLRRAGRVHPAWRVGIGALLGCFVLVEAITYSPVGAALYRIVTAGSPGASVPPLEFAPPPAGPLMTGRG

Samples

	Sample ID	Description	Type	Environment
1	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
4	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
5	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
6	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
7	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
8	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
9	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
10	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
11	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
12	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
13	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
14	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
15	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
16	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
17	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
18	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
19	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
20	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
21	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
22	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
23	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
24	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
25	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
26	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
27	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
28	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
29	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
30	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
31	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
32	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
33	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
34	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
35	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
36	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
37	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
38	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
39	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
40	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
41	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
42	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
43	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
44	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
45	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
46	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
49	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
50	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
54	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
55	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
60	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
61	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
62	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
63	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
64	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
65	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
66	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
67	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
68	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
69	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
76	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
79	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
80	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
81	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
84	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
85	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
86	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
87	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
88	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
89	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
90	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
91	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
92	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
93	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
94	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
95	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
96	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
97	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
98	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
156	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
157	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
158	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
159	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
160	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
161	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
162	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
163	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
164	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
165	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
166	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
167	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
168	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
169	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
170	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
171	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
172	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
173	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
174	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
175	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
176	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
177	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
178	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
179	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
180	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
181	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
182	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
183	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
184	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
185	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
186	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
187	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
188	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
189	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
190	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
191	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
192	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
193	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
194	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
195	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
196	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
197	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
198	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
199	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
200	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
201	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
202	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
203	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
204	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
205	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
206	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
207	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
208	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
209	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
210	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
211	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
212	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
213	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
214	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
215	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
216	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.76
Metatranscriptomes	0.24
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.64
Nodule	0
Rhizoplane	3.64
Rhizosphere	91.5
Stem	0
Stem Tuber	0
Unclassified	1.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24747J21853_1001180	3300001978	Bacteria	1904
2	JGI24739J22299_10003916	3300001989	Bacteria	5691
3	JGI24737J22298_10038300	3300001990	Unclassified	1476
4	JGI24743J22301_10025569	3300001991	Unclassified	1145
5	JGI24745J21846_1006716	3300002073	Unclassified	1282
6	JGI24749J21850_1002290	3300002076	Bacteria	2694
7	JGI24744J21845_10002622	3300002077	Bacteria	3673
8	JGI24751J29686_10022859	3300002459	Unclassified	1296
9	rootH1_10124416	3300003316	Bacteria	2719
10	rootH2_10055396	3300003320	Bacteria	1451
11	Ga0055530_10003447	3300003791	Bacteria	8991
12	Ga0055531_10002083	3300003794	Bacteria	13739
13	Ga0065165_1001018	3300005262	Bacteria	34062
14	Ga0065712_10110584	3300005290	Bacteria	1833
15	Ga0065715_10007970	3300005293	Bacteria	2973
16	Ga0070658_10104150	3300005327	Bacteria	2347
17	Ga0070658_10535080	3300005327	Bacteria	1013
18	Ga0070676_10016631	3300005328	Bacteria	4068
19	Ga0070676_10171969	3300005328	Bacteria	1402
20	Ga0070676_10207817	3300005328	Unclassified	1286
21	Ga0070683_100196388	3300005329	Bacteria	1916
22	Ga0070690_100001926	3300005330	Bacteria	11028
23	Ga0070690_100060321	3300005330	Bacteria	2441
24	Ga0070670_100004030	3300005331	Bacteria	12267
25	Ga0070670_100006696	3300005331	Bacteria	9765
26	Ga0070670_100039862	3300005331	Bacteria	4039
27	Ga0070670_100189438	3300005331	Unclassified	1787
28	Ga0070670_100575826	3300005331	Bacteria	1006
29	Ga0070677_10001322	3300005333	Bacteria	7922
30	Ga0068869_100087118	3300005334	Bacteria	2342
31	Ga0070666_10040106	3300005335	Bacteria	3124
32	Ga0070666_10092191	3300005335	Bacteria	2082
33	Ga0070680_100006408	3300005336	Bacteria	8941
34	Ga0068868_100002343	3300005338	Bacteria	13104
35	Ga0068868_100044527	3300005338	Bacteria	3469
36	Ga0068868_100048979	3300005338	Bacteria	3316
37	Ga0070660_100023131	3300005339	Bacteria	4602
38	Ga0070660_100411870	3300005339	Bacteria	1119
39	Ga0070689_100315643	3300005340	Bacteria	1304
40	Ga0070661_100032607	3300005344	Bacteria	3770
41	Ga0070661_100377395	3300005344	Unclassified	1117
42	Ga0070668_100014711	3300005347	Bacteria	5848
43	Ga0070668_100231981	3300005347	Unclassified	1526
44	Ga0070669_100016896	3300005353	Bacteria	5209
45	Ga0070675_100107085	3300005354	Bacteria	2360
46	Ga0070675_100162556	3300005354	Bacteria	1921
47	Ga0070675_100327380	3300005354	Bacteria	1354
48	Ga0070671_100002744	3300005355	Bacteria	13674
49	Ga0070671_100002863	3300005355	Bacteria	13424
50	Ga0070671_100019098	3300005355	Bacteria	5574
51	Ga0070671_100026172	3300005355	Bacteria	4793
52	Ga0070671_100086487	3300005355	Bacteria	2623
53	Ga0070671_100106361	3300005355	Bacteria	2355
54	Ga0070671_100124225	3300005355	Bacteria	2172
55	Ga0070674_100023094	3300005356	Bacteria	4019
56	Ga0070674_100033005	3300005356	Bacteria	3442
57	Ga0070673_100003651	3300005364	Bacteria	9636
58	Ga0070673_100010276	3300005364	Bacteria	6330
59	Ga0070673_100019876	3300005364	Bacteria	4831
60	Ga0070673_100562956	3300005364	Unclassified	1036
61	Ga0070659_100001753	3300005366	Bacteria	15585
62	Ga0070659_100171658	3300005366	Bacteria	1777
63	Ga0070659_100207125	3300005366	Unclassified	1615
64	Ga0070659_100237590	3300005366	Unclassified	1507
65	Ga0070659_100285937	3300005366	Unclassified	1372
66	Ga0070667_100002750	3300005367	Bacteria	15219
67	Ga0070667_100031906	3300005367	Bacteria	4392
68	Ga0070667_100309768	3300005367	Bacteria	1423
69	Ga0070714_100098763	3300005435	Unclassified	2569
70	Ga0070714_100117842	3300005435	Bacteria	2359
71	Ga0070713_100013582	3300005436	Bacteria	6020
72	Ga0070713_100225189	3300005436	Bacteria	1703
73	Ga0070711_100009061	3300005439	Bacteria	6113
74	Ga0070700_100020567	3300005441	Bacteria	3825
75	Ga0070663_100022403	3300005455	Bacteria	4224
76	Ga0070663_100067151	3300005455	Bacteria	2600
77	Ga0070663_100124022	3300005455	Bacteria	1954
78	Ga0070663_100401525	3300005455	Bacteria	1120
79	Ga0070678_100014954	3300005456	Bacteria	4916
80	Ga0070678_100019307	3300005456	Bacteria	4440
81	Ga0070678_100151636	3300005456	Bacteria	1868
82	Ga0070678_100218140	3300005456	Bacteria	1584
83	Ga0070662_100002083	3300005457	Bacteria	12267
84	Ga0070662_100046983	3300005457	Bacteria	3103
85	Ga0070662_100227171	3300005457	Unclassified	1492
86	Ga0070681_10201978	3300005458	Unclassified	1906
87	Ga0068867_100003061	3300005459	Bacteria	11788
88	Ga0068867_100009786	3300005459	Bacteria	6756
89	Ga0068867_100111192	3300005459	Bacteria	2105
90	Ga0070679_100012027	3300005530	Bacteria	8260
91	Ga0070679_100170696	3300005530	Bacteria	2148
92	Ga0068853_100198946	3300005539	Bacteria	1823
93	Ga0068853_100219605	3300005539	Bacteria	1735
94	Ga0068853_100624053	3300005539	Unclassified	1025
95	Ga0070672_100013662	3300005543	Bacteria	5741
96	Ga0070672_100016832	3300005543	Bacteria	5244
97	Ga0070672_100046292	3300005543	Bacteria	3370
98	Ga0070672_100324285	3300005543	Bacteria	1309
99	Ga0070672_100696340	3300005543	Bacteria	890
100	Ga0070686_100001629	3300005544	Bacteria	12554
101	Ga0070686_100120476	3300005544	Bacteria	1801
102	Ga0070693_100086749	3300005547	Unclassified	1878
103	Ga0068855_100020174	3300005563	Bacteria	8004
104	Ga0068855_100133080	3300005563	Bacteria	2838
105	Ga0070664_100022170	3300005564	Bacteria	5239
106	Ga0070664_100150498	3300005564	Bacteria	2054
107	Ga0070664_100274303	3300005564	Unclassified	1520
108	Ga0068854_100044304	3300005578	Bacteria	3157
109	Ga0068854_100137287	3300005578	Bacteria	1873
110	Ga0068854_100158378	3300005578	Bacteria	1751
111	Ga0068856_100033822	3300005614	Bacteria	5006
112	Ga0070702_100291977	3300005615	Bacteria	1124
113	Ga0068852_100080917	3300005616	Bacteria	2882
114	Ga0068852_100130534	3300005616	Bacteria	2313
115	Ga0068852_100173967	3300005616	Bacteria	2020
116	Ga0068859_100028314	3300005617	Bacteria	5617
117	Ga0068859_100569775	3300005617	Bacteria	1226
118	Ga0068864_100204765	3300005618	Unclassified	1814
119	Ga0068866_10010865	3300005718	Bacteria	3918
120	Ga0068866_10033220	3300005718	Bacteria	2501
121	Ga0068866_10036053	3300005718	Bacteria	2421
122	Ga0068861_100230916	3300005719	Bacteria	1569
123	Ga0068851_10007579	3300005834	Bacteria	4989
124	Ga0068851_10029461	3300005834	Bacteria	2718
125	Ga0068851_10058502	3300005834	Bacteria	1970
126	Ga0068863_100007458	3300005841	Bacteria	10707
127	Ga0068863_100012971	3300005841	Bacteria	8036
128	Ga0068858_100019228	3300005842	Bacteria	6387
129	Ga0068858_100038694	3300005842	Bacteria	4424
130	Ga0068858_100275886	3300005842	Bacteria	1600
131	Ga0068860_100081369	3300005843	Bacteria	3080
132	Ga0068862_100039491	3300005844	Bacteria	4008
133	Ga0070717_10204982	3300006028	Bacteria	1729
134	Ga0070716_100134398	3300006173	Bacteria	1568
135	Ga0070712_100002029	3300006175	Bacteria	12408
136	Ga0097621_100324452	3300006237	Bacteria	1364
137	Ga0068871_100042864	3300006358	Bacteria	3635
138	Ga0075434_100017710	3300006871	Bacteria	6867
139	Ga0068865_100001641	3300006881	Bacteria	13103
140	Ga0068865_100084848	3300006881	Bacteria	2283
141	Ga0097620_100028315	3300006931	Bacteria	5617
142	Ga0097620_100569740	3300006931	Bacteria	1226
143	Ga0111539_10017987	3300009094	Bacteria	8754
144	Ga0105245_10272375	3300009098	Bacteria	1652
145	Ga0105245_10492127	3300009098	Bacteria	1241
146	Ga0105243_10139388	3300009148	Bacteria	2067
147	Ga0105241_10454881	3300009174	Unclassified	1133
148	Ga0105242_10108164	3300009176	Bacteria	2366
149	Ga0105242_10406839	3300009176	Bacteria	1272
150	Ga0105248_10002097	3300009177	Bacteria	22084
151	Ga0105248_10170772	3300009177	Bacteria	2451
152	Ga0105248_10180218	3300009177	Bacteria	2381
153	Ga0105238_10202893	3300009551	Bacteria	1959
154	Ga0105238_10283952	3300009551	Bacteria	1637
155	Ga0105249_10011888	3300009553	Bacteria	7656
156	Ga0105239_10836702	3300010375	Bacteria	1055
157	Ga0105246_10420746	3300011119	Unclassified	1115
158	Ga0157373_10075106	3300013100	Bacteria	2385
159	Ga0157373_10107003	3300013100	Bacteria	1966
160	Ga0157373_10122605	3300013100	Bacteria	1827
161	Ga0157371_10091138	3300013102	Bacteria	2159
162	Ga0157374_10004363	3300013296	Bacteria	11905
163	Ga0157374_10326809	3300013296	Bacteria	1521
164	Ga0157374_10605356	3300013296	Bacteria	1106
165	Ga0157378_10041421	3300013297	Bacteria	4085
166	Ga0157378_10177673	3300013297	Unclassified	2001
167	Ga0157378_10203313	3300013297	Bacteria	1874
168	Ga0163162_10021164	3300013306	Bacteria	6398
169	Ga0163162_10275056	3300013306	Unclassified	1816
170	Ga0163162_10296108	3300013306	Bacteria	1750
171	Ga0163162_10413911	3300013306	Bacteria	1480
172	Ga0163162_10802160	3300013306	Unclassified	1059
173	Ga0157372_10003383	3300013307	Bacteria	17209
174	Ga0157375_10035094	3300013308	Bacteria	4784
175	Ga0163163_10069868	3300014325	Bacteria	3497
176	Ga0157377_10194393	3300014745	Bacteria	1284
177	Ga0157379_10048726	3300014968	Bacteria	3782
178	Ga0157379_10202016	3300014968	Bacteria	1797
179	Ga0157376_10032581	3300014969	Bacteria	4185
180	Ga0163161_10109436	3300017792	Bacteria	2064
181	Ga0206353_11297066	3300020082	Bacteria	5173
182	Ga0213876_10017463	3300021384	Bacteria	3789
183	Ga0209758_1000331	3300025297	Bacteria	88922
184	Ga0209050_1000130	3300025298	Bacteria	186070
185	Ga0207426_1075726	3300025302	Bacteria	926
186	Ga0209257_1000059	3300025304	Bacteria	378097
187	Ga0207697_10001211	3300025315	Bacteria	14101
188	Ga0207656_10015391	3300025321	Bacteria	2960
189	Ga0207656_10058456	3300025321	Bacteria	1684
190	Ga0207682_10002048	3300025893	Bacteria	9129
191	Ga0207682_10019312	3300025893	Bacteria	2668
192	Ga0207642_10008084	3300025899	Bacteria	3589
193	Ga0207688_10005782	3300025901	Bacteria	6734
194	Ga0207688_10010987	3300025901	Bacteria	4926
195	Ga0207688_10216640	3300025901	Bacteria	1152
196	Ga0207680_10003501	3300025903	Bacteria	7397
197	Ga0207680_10081644	3300025903	Bacteria	2033
198	Ga0207647_10002329	3300025904	Bacteria	14424
199	Ga0207699_10030056	3300025906	Bacteria	3036
200	Ga0207645_10012759	3300025907	Bacteria	5696
201	Ga0207645_10085645	3300025907	Bacteria	2024
202	Ga0207645_10194097	3300025907	Bacteria	1335
203	Ga0207705_10005796	3300025909	Bacteria	9203
204	Ga0207705_10014786	3300025909	Bacteria	5612
205	Ga0207705_10073102	3300025909	Bacteria	2487
206	Ga0207707_10200113	3300025912	Unclassified	1742
207	Ga0207695_10284321	3300025913	Bacteria	1547
208	Ga0207693_10001789	3300025915	Bacteria	18831
209	Ga0207660_10000059	3300025917	Bacteria	56766
210	Ga0207657_10048342	3300025919	Bacteria	3715
211	Ga0207657_10437398	3300025919	Bacteria	1027
212	Ga0207649_10373378	3300025920	Unclassified	1061
213	Ga0207652_10070525	3300025921	Unclassified	3035
214	Ga0207681_10052753	3300025923	Bacteria	2758
215	Ga0207681_10350889	3300025923	Bacteria	1181
216	Ga0207681_10533424	3300025923	Unclassified	964
217	Ga0207694_10293870	3300025924	Bacteria	1336
218	Ga0207650_10008487	3300025925	Bacteria	7014
219	Ga0207650_10010159	3300025925	Bacteria	6450
220	Ga0207650_10254873	3300025925	Bacteria	1422
221	Ga0207659_10015649	3300025926	Bacteria	4922
222	Ga0207659_10287322	3300025926	Bacteria	1346
223	Ga0207687_10079831	3300025927	Bacteria	2360
224	Ga0207700_10231694	3300025928	Bacteria	1570
225	Ga0207664_10046513	3300025929	Bacteria	3406
226	Ga0207644_10001058	3300025931	Bacteria	17593
227	Ga0207644_10005246	3300025931	Bacteria	8458
228	Ga0207644_10005523	3300025931	Bacteria	8230
229	Ga0207644_10039990	3300025931	Bacteria	3312
230	Ga0207644_10075333	3300025931	Unclassified	2479
231	Ga0207690_10283759	3300025932	Unclassified	1290
232	Ga0207690_10375297	3300025932	Bacteria	1129
233	Ga0207706_10003386	3300025933	Bacteria	15246
234	Ga0207706_10028855	3300025933	Bacteria	4953
235	Ga0207706_10034457	3300025933	Bacteria	4504
236	Ga0207706_10082458	3300025933	Bacteria	2826
237	Ga0207706_10167693	3300025933	Bacteria	1930
238	Ga0207706_10289100	3300025933	Unclassified	1429
239	Ga0207686_10072982	3300025934	Bacteria	2213
240	Ga0207670_10213025	3300025936	Unclassified	1474
241	Ga0207669_10017150	3300025937	Bacteria	3705
242	Ga0207704_10108308	3300025938	Bacteria	1871
243	Ga0207704_10216973	3300025938	Unclassified	1412
244	Ga0207691_10000954	3300025940	Bacteria	28639
245	Ga0207691_10001164	3300025940	Bacteria	26132
246	Ga0207691_10042803	3300025940	Bacteria	4174
247	Ga0207711_10002646	3300025941	Bacteria	15840
248	Ga0207711_10003374	3300025941	Bacteria	13834
249	Ga0207711_10003982	3300025941	Bacteria	12694
250	Ga0207711_10022177	3300025941	Bacteria	5309
251	Ga0207711_10226876	3300025941	Bacteria	1710
252	Ga0207711_10300016	3300025941	Bacteria	1482
253	Ga0207689_10034458	3300025942	Bacteria	4206
254	Ga0207679_10205731	3300025945	Bacteria	1647
255	Ga0207667_10097203	3300025949	Bacteria	3040
256	Ga0207667_10570194	3300025949	Unclassified	1143
257	Ga0207651_10000289	3300025960	Bacteria	21606
258	Ga0207651_10011519	3300025960	Bacteria	4954
259	Ga0207651_10021611	3300025960	Bacteria	3914
260	Ga0207651_10054187	3300025960	Bacteria	2746
261	Ga0207651_10193554	3300025960	Unclassified	1624
262	Ga0207651_10203539	3300025960	Unclassified	1588
263	Ga0207668_10039075	3300025972	Bacteria	3190
264	Ga0207668_10537599	3300025972	Bacteria	1011
265	Ga0207640_10211727	3300025981	Unclassified	1477
266	Ga0207640_10347504	3300025981	Bacteria	1190
267	Ga0207658_10004081	3300025986	Bacteria	10191
268	Ga0207658_10005082	3300025986	Bacteria	9050
269	Ga0207677_10013871	3300026023	Bacteria	4684
270	Ga0207677_10483640	3300026023	Bacteria	1067
271	Ga0207703_10002884	3300026035	Bacteria	14642
272	Ga0207703_10005616	3300026035	Bacteria	10071
273	Ga0207639_10200929	3300026041	Bacteria	1709
274	Ga0207639_10511396	3300026041	Unclassified	1099
275	Ga0207678_10002442	3300026067	Bacteria	16892
276	Ga0207678_10018673	3300026067	Bacteria	6088
277	Ga0207678_10025154	3300026067	Bacteria	5197
278	Ga0207702_10041944	3300026078	Bacteria	3837
279	Ga0207641_10005418	3300026088	Bacteria	10895
280	Ga0207641_10176376	3300026088	Bacteria	1954
281	Ga0207648_10005820	3300026089	Bacteria	12349
282	Ga0207648_10010845	3300026089	Bacteria	8612
283	Ga0207648_10095986	3300026089	Bacteria	2594
284	Ga0207648_10146402	3300026089	Bacteria	2083
285	Ga0207676_10009780	3300026095	Bacteria	6818
286	Ga0207676_10422319	3300026095	Unclassified	1251
287	Ga0207675_100015318	3300026118	Bacteria	7153
288	Ga0207683_10001453	3300026121	Bacteria	21380
289	Ga0207683_10007924	3300026121	Bacteria	9091
290	Ga0207683_10017922	3300026121	Bacteria	6038
291	Ga0207683_10188625	3300026121	Bacteria	1871
292	Ga0207698_10419282	3300026142	Bacteria	1284
293	Ga0207698_10570614	3300026142	Bacteria	1112
294	Ga0268265_10030633	3300028380	Bacteria	3877
295	Ga0268264_10227764	3300028381	Bacteria	1719
296	Ga0307408_100161899	3300031548	Bacteria	1778
297	Ga0307405_10070079	3300031731	Bacteria	2250
298	Ga0307405_10079735	3300031731	Bacteria	2135
299	Ga0307405_10140727	3300031731	Bacteria	1682
300	Ga0307405_10455697	3300031731	Unclassified	1015
301	Ga0307413_10165586	3300031824	Bacteria	1559
302	Ga0307413_10200361	3300031824	Bacteria	1441
303	Ga0307410_10128192	3300031852	Bacteria	1860
304	Ga0307410_10179372	3300031852	Bacteria	1602
305	Ga0307406_10062543	3300031901	Bacteria	2408
306	Ga0307407_10029968	3300031903	Bacteria	2929
307	Ga0307407_10079893	3300031903	Bacteria	1974
308	Ga0307412_10040754	3300031911	Bacteria	3006
309	Ga0307412_10049489	3300031911	Bacteria	2769
310	Ga0307412_10213451	3300031911	Bacteria	1474
311	Ga0307412_10250665	3300031911	Bacteria	1374
312	Ga0307409_100025719	3300031995	Bacteria	4135
313	Ga0307409_100029771	3300031995	Bacteria	3912
314	Ga0307409_100051465	3300031995	Bacteria	3152
315	Ga0307409_100119667	3300031995	Bacteria	2227
316	Ga0307409_100415897	3300031995	Bacteria	1288
317	Ga0307409_100425198	3300031995	Bacteria	1275
318	Ga0307416_100005614	3300032002	Bacteria	7736
319	Ga0307416_100017166	3300032002	Bacteria	5054
320	Ga0307416_100052491	3300032002	Bacteria	3264
321	Ga0307416_100217347	3300032002	Bacteria	1829
322	Ga0307414_10030404	3300032004	Bacteria	3527
323	Ga0307414_10206129	3300032004	Bacteria	1603
324	Ga0307411_10013052	3300032005	Bacteria	4564
325	Ga0307411_10081410	3300032005	Bacteria	2230
326	Ga0307415_100013525	3300032126	Bacteria	4767
327	Ga0307415_100356469	3300032126	Bacteria	1233
328	Ga0307415_100455249	3300032126	Bacteria	1107
329	Ga0373935_0073883	3300035692	Bacteria	2203
330	Ga0373937_0022899	3300036401	Bacteria	5618
331	Ga0395899_0000365	3300037312	Bacteria	54914
332	Ga0395899_0002975	3300037312	Bacteria	13557
333	Ga0395899_0027690	3300037312	Unclassified	4271
334	Ga0395899_0027991	3300037312	Plasmid	4244
335	Ga0395900_0000093	3300037418	Bacteria	166505
336	Ga0395900_0003959	3300037418	Bacteria	15811
337	Ga0395900_0017884	3300037418	Bacteria	7235
338	Ga0395900_0084067	3300037418	Bacteria	3270
339	Ga0395900_0097702	3300037418	Bacteria	3017
340	Ga0395900_0542144	3300037418	Bacteria	1109
341	Ga0395898_0000053	3300037466	Bacteria	279600
342	Ga0395898_0001859	3300037466	Bacteria	27053
343	Ga0395898_0113696	3300037466	Bacteria	2594
344	Ga0395898_0327756	3300037466	Archaea	1460
345	Ga0395905_0000031	3300037471	Bacteria	286757
346	Ga0395905_0012904	3300037471	Bacteria	8032
347	Ga0395905_0036724	3300037471	Bacteria	4602
348	Ga0395905_0041683	3300037471	Bacteria	4308
349	Ga0395905_0050489	3300037471	Bacteria	3897
350	Ga0395905_0064255	3300037471	Bacteria	3434
351	Ga0395905_0074543	3300037471	Bacteria	3180
352	Ga0395905_0089780	3300037471	Bacteria	2880
353	Ga0395901_0005161	3300038443	Bacteria	13180
354	Ga0395901_0005379	3300038443	Bacteria	12950
355	Ga0395901_0394554	3300038443	Bacteria	1422
356	Ga0395901_0448482	3300038443	Bacteria	1320
357	Ga0395901_0587000	3300038443	Bacteria	1125
358	Ga0436365_1506208	3300039437	Bacteria	4114
359	Ga0439458_0000172	3300042157	Bacteria	14580
360	Ga0466972_0053021	3300044658	Bacteria	1954
361	Ga0466965_0099513	3300044683	Unclassified	1486
362	Ga0466966_0006278	3300044684	Bacteria	7863
363	Ga0466971_0054556	3300044719	Unclassified	1801
364	Ga0466957_0011733	3300044842	Bacteria	5064
365	Ga0466957_0143142	3300044842	Bacteria	1542
366	Ga0466960_0005826	3300044901	Bacteria	4909
367	Ga0466959_0017840	3300045049	Bacteria	5207
368	Ga0466958_0038496	3300045836	Bacteria	2870
369	Ga0466958_0151380	3300045836	Bacteria	1463
370	Ga0466958_0206369	3300045836	Bacteria	1251
371	Ga0466967_0007633	3300045976	Bacteria	7827
372	Ga0466967_0272814	3300045976	Unclassified	1621
373	Ga0466967_0330043	3300045976	Bacteria	1473
374	Ga0495643_0090277	3300046522	Bacteria	1581
375	Ga0495598_0003795	3300046537	Bacteria	3231
376	Ga0495621_0000574	3300046539	Bacteria	9164
377	Ga0495668_0078289	3300046616	Bacteria	1815
378	Ga0495668_0277441	3300046616	Bacteria	918
379	Ga0495659_0101539	3300046664	Bacteria	1115
380	Ga0495670_0000783	3300046691	Bacteria	15269
381	Ga0495670_0002390	3300046691	Bacteria	9251
382	Ga0495672_0050753	3300047320	Bacteria	2447
383	Ga0495686_0003429	3300047472	Bacteria	13750
384	Ga0496100_0007338	3300048903	Bacteria	6072
385	Ga0496101_0001522	3300048904	Bacteria	13884
386	Ga0496102_0587822	3300048905	Unclassified	1036
387	Ga0496104_0515897	3300048907	Bacteria	1106
388	Ga0496107_0003637	3300048910	Bacteria	10355
389	Ga0496108_0001452	3300048911	Bacteria	18729
390	Ga0496109_0008419	3300048912	Bacteria	8767
391	Ga0496109_0339386	3300048912	Bacteria	1419
392	Ga0496110_0456386	3300048913	Bacteria	1164
393	Ga0496112_0040663	3300048915	Bacteria	4546
394	Ga0496112_0155958	3300048915	Bacteria	2250
395	Ga0496112_0320045	3300048915	Bacteria	1495
396	Ga0496112_0343009	3300048915	Unclassified	1437
397	Ga0496113_0413288	3300048916	Bacteria	1083
398	Ga0496114_0000006	3300048917	Bacteria	472921
399	Ga0496125_0067121	3300048928	Bacteria	2829
400	Ga0501074_0036715	3300049590	Bacteria	3549
401	nmdc:mga08y16_294206_c1	3300050511	Bacteria	1674
402	nmdc:mga0n895_153659_c1	3300050512	Bacteria	2332
403	Ga0500651_0029867	3300053093	Bacteria	3429
404	Ga0500562_000231	3300053108	Bacteria	14654
405	Ga0500642_0108703	3300053130	Bacteria	1294
406	Ga0500655_001314	3300053133	Bacteria	4711
407	Ga0500590_003445	3300053148	Bacteria	7294
408	Ga0500622_0022326	3300053156	Bacteria	3356
409	Ga0500639_017617	3300053163	Bacteria	3770
410	Ga0500636_0097388	3300053177	Bacteria	1677
411	Ga0466962_0036699	3300061719	Bacteria	2347
412	Ga0466962_0079820	3300061719	Bacteria	1564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044683	Ga0466965_0099513	Ga0466965_0099513_790_1467	225
2	3300046616	Ga0495668_0277441	Ga0495668_0277441_207_893	225
3	3300048916	Ga0496113_0413288	Ga0496113_0413288_18_695	225
4	3300037418	Ga0395900_0542144	Ga0395900_0542144_65_769	234
5	3300038443	Ga0395901_0587000	Ga0395901_0587000_298_1002	234
6	3300005347	Ga0070668_100231981	Ga0070668_1002319811	238
7	3300025933	Ga0207706_10034457	Ga0207706_100344573	238
8	3300013306	Ga0163162_10021164	Ga0163162_100211642	239
9	3300025901	Ga0207688_10216640	Ga0207688_102166402	239
10	3300026142	Ga0207698_10419282	Ga0207698_104192822	239
11	3300035692	Ga0373935_0073883	Ga0373935_0073883_1468_2187	239
12	3300048907	Ga0496104_0515897	Ga0496104_0515897_71_793	239
13	3300005355	Ga0070671_100019098	Ga0070671_1000190981	245
14	3300005618	Ga0068864_100204765	Ga0068864_1002047652	245
15	3300025933	Ga0207706_10167693	Ga0207706_101676931	245
16	3300053177	Ga0500636_0097388	Ga0500636_0097388_441_1211	245
17	3300053130	Ga0500642_0108703	Ga0500642_0108703_525_1265	246
18	3300044658	Ga0466972_0053021	Ga0466972_0053021_823_1626	248
19	3300044901	Ga0466960_0005826	Ga0466960_0005826_1802_2605	248
20	3300046691	Ga0495670_0002390	Ga0495670_0002390_3722_4489	252
21	3300003791	Ga0055530_10003447	Ga0055530_100034477	253
22	3300003794	Ga0055531_10002083	Ga0055531_1000208312	253
23	3300005262	Ga0065165_1001018	Ga0065165_10010187	253
24	3300025297	Ga0209758_1000331	Ga0209758_100033168	253
25	3300025298	Ga0209050_1000130	Ga0209050_100013042	253
26	3300025302	Ga0207426_1075726	Ga0207426_10757262	253
27	3300025304	Ga0209257_1000059	Ga0209257_1000059237	253
28	3300005615	Ga0070702_100291977	Ga0070702_1002919772	254
29	3300009094	Ga0111539_10017987	Ga0111539_1001798710	254
30	3300009176	Ga0105242_10108164	Ga0105242_101081642	254
31	3300009177	Ga0105248_10170772	Ga0105248_101707722	254
32	3300013308	Ga0157375_10035094	Ga0157375_100350943	254
33	3300050511	nmdc:mga08y16_294206_c1	nmdc:mga08y16_294206_c1_25_789	254
34	3300046522	Ga0495643_0090277	Ga0495643_0090277_444_1214	255
35	3300046616	Ga0495668_0078289	Ga0495668_0078289_648_1418	255
36	3300048928	Ga0496125_0067121	Ga0496125_0067121_1212_1982	255
37	3300053093	Ga0500651_0029867	Ga0500651_0029867_671_1441	255
38	3300053133	Ga0500655_001314	Ga0500655_001314_1961_2731	255
39	3300053148	Ga0500590_003445	Ga0500590_003445_2941_3711	255
40	3300053156	Ga0500622_0022326	Ga0500622_0022326_1866_2636	255
41	3300053163	Ga0500639_017617	Ga0500639_017617_185_955	255
42	3300001989	JGI24739J22299_10003916	JGI24739J22299_100039163	258
43	3300042157	Ga0439458_0000172	Ga0439458_0000172_11328_12104	258
44	3300053108	Ga0500562_000231	Ga0500562_000231_8168_8956	258
45	3300009176	Ga0105242_10406839	Ga0105242_104068391	259
46	3300025934	Ga0207686_10072982	Ga0207686_100729823	259
47	3300025941	Ga0207711_10226876	Ga0207711_102268761	260
48	3300037471	Ga0395905_0089780	Ga0395905_0089780_772_1557	260
49	3300049590	Ga0501074_0036715	Ga0501074_0036715_2738_3529	261
50	3300005439	Ga0070711_100009061	Ga0070711_1000090614	262
51	3300036401	Ga0373937_0022899	Ga0373937_0022899_1476_2267	262
52	3300044684	Ga0466966_0006278	Ga0466966_0006278_5669_6460	262
53	3300045049	Ga0466959_0017840	Ga0466959_0017840_3388_4179	262
54	3300045836	Ga0466958_0206369	Ga0466958_0206369_21_812	262
55	3300002076	JGI24749J21850_1002290	JGI24749J21850_10022901	263
56	3300002459	JGI24751J29686_10022859	JGI24751J29686_100228592	263
57	3300003320	rootH2_10055396	rootH2_100553962	263
58	3300005290	Ga0065712_10110584	Ga0065712_101105843	263
59	3300005293	Ga0065715_10007970	Ga0065715_100079704	263
60	3300005328	Ga0070676_10016631	Ga0070676_100166312	263
61	3300005329	Ga0070683_100196388	Ga0070683_1001963882	263
62	3300005331	Ga0070670_100006696	Ga0070670_1000066966	263
63	3300005331	Ga0070670_100039862	Ga0070670_1000398625	263
64	3300005331	Ga0070670_100189438	Ga0070670_1001894381	263
65	3300005333	Ga0070677_10001322	Ga0070677_100013229	263
66	3300005336	Ga0070680_100006408	Ga0070680_1000064087	263
67	3300005339	Ga0070660_100023131	Ga0070660_1000231313	263
68	3300005344	Ga0070661_100032607	Ga0070661_1000326073	263
69	3300005344	Ga0070661_100377395	Ga0070661_1003773951	263
70	3300005353	Ga0070669_100016896	Ga0070669_1000168966	263
71	3300005355	Ga0070671_100026172	Ga0070671_1000261725	263
72	3300005366	Ga0070659_100171658	Ga0070659_1001716582	263
73	3300005366	Ga0070659_100237590	Ga0070659_1002375901	263
74	3300005367	Ga0070667_100031906	Ga0070667_1000319062	263
75	3300005435	Ga0070714_100098763	Ga0070714_1000987633	263
76	3300005435	Ga0070714_100117842	Ga0070714_1001178423	263
77	3300005436	Ga0070713_100225189	Ga0070713_1002251892	263
78	3300005441	Ga0070700_100020567	Ga0070700_1000205673	263
79	3300005455	Ga0070663_100022403	Ga0070663_1000224033	263
80	3300005455	Ga0070663_100067151	Ga0070663_1000671512	263
81	3300005456	Ga0070678_100218140	Ga0070678_1002181401	263
82	3300005457	Ga0070662_100002083	Ga0070662_10000208313	263
83	3300005457	Ga0070662_100227171	Ga0070662_1002271712	263
84	3300005459	Ga0068867_100111192	Ga0068867_1001111924	263
85	3300005530	Ga0070679_100012027	Ga0070679_1000120274	263
86	3300005530	Ga0070679_100170696	Ga0070679_1001706961	263
87	3300005539	Ga0068853_100198946	Ga0068853_1001989462	263
88	3300005539	Ga0068853_100624053	Ga0068853_1006240531	263
89	3300005543	Ga0070672_100013662	Ga0070672_1000136627	263
90	3300005563	Ga0068855_100020174	Ga0068855_1000201746	263
91	3300005564	Ga0070664_100022170	Ga0070664_1000221702	263
92	3300005564	Ga0070664_100274303	Ga0070664_1002743032	263
93	3300005578	Ga0068854_100044304	Ga0068854_1000443043	263
94	3300005578	Ga0068854_100137287	Ga0068854_1001372871	263
95	3300005616	Ga0068852_100080917	Ga0068852_1000809172	263
96	3300005616	Ga0068852_100130534	Ga0068852_1001305343	263
97	3300005617	Ga0068859_100569775	Ga0068859_1005697751	263
98	3300005834	Ga0068851_10007579	Ga0068851_100075795	263
99	3300005834	Ga0068851_10029461	Ga0068851_100294616	263
100	3300005844	Ga0068862_100039491	Ga0068862_1000394913	263
101	3300006175	Ga0070712_100002029	Ga0070712_10000202911	263
102	3300006881	Ga0068865_100084848	Ga0068865_1000848483	263
103	3300006931	Ga0097620_100569740	Ga0097620_1005697401	263
104	3300009551	Ga0105238_10283952	Ga0105238_102839522	263
105	3300009553	Ga0105249_10011888	Ga0105249_1001188810	263
106	3300013100	Ga0157373_10107003	Ga0157373_101070031	263
107	3300013306	Ga0163162_10296108	Ga0163162_102961081	263
108	3300013306	Ga0163162_10802160	Ga0163162_108021602	263
109	3300013307	Ga0157372_10003383	Ga0157372_100033836	263
110	3300014968	Ga0157379_10202016	Ga0157379_102020163	263
111	3300017792	Ga0163161_10109436	Ga0163161_101094361	263
112	3300025315	Ga0207697_10001211	Ga0207697_100012115	263
113	3300025321	Ga0207656_10015391	Ga0207656_100153916	263
114	3300025321	Ga0207656_10058456	Ga0207656_100584562	263
115	3300025893	Ga0207682_10002048	Ga0207682_1000204814	263
116	3300025901	Ga0207688_10010987	Ga0207688_100109874	263
117	3300025907	Ga0207645_10085645	Ga0207645_100856453	263
118	3300025909	Ga0207705_10005796	Ga0207705_100057966	263
119	3300025915	Ga0207693_10001789	Ga0207693_100017898	263
120	3300025917	Ga0207660_10000059	Ga0207660_1000005928	263
121	3300025919	Ga0207657_10048342	Ga0207657_100483422	263
122	3300025920	Ga0207649_10373378	Ga0207649_103733781	263
123	3300025921	Ga0207652_10070525	Ga0207652_100705251	263
124	3300025923	Ga0207681_10052753	Ga0207681_100527534	263
125	3300025923	Ga0207681_10533424	Ga0207681_105334241	263
126	3300025925	Ga0207650_10008487	Ga0207650_100084879	263
127	3300025926	Ga0207659_10015649	Ga0207659_100156494	263
128	3300025928	Ga0207700_10231694	Ga0207700_102316941	263
129	3300025931	Ga0207644_10039990	Ga0207644_100399906	263
130	3300025931	Ga0207644_10075333	Ga0207644_100753333	263
131	3300025933	Ga0207706_10003386	Ga0207706_100033864	263
132	3300025940	Ga0207691_10001164	Ga0207691_1000116410	263
133	3300025941	Ga0207711_10003982	Ga0207711_100039823	263
134	3300025941	Ga0207711_10022177	Ga0207711_100221778	263
135	3300025945	Ga0207679_10205731	Ga0207679_102057312	263
136	3300025949	Ga0207667_10097203	Ga0207667_100972035	263
137	3300025960	Ga0207651_10193554	Ga0207651_101935541	263
138	3300025960	Ga0207651_10203539	Ga0207651_102035391	263
139	3300025972	Ga0207668_10039075	Ga0207668_100390752	263
140	3300026041	Ga0207639_10511396	Ga0207639_105113961	263
141	3300026067	Ga0207678_10002442	Ga0207678_100024426	263
142	3300026067	Ga0207678_10025154	Ga0207678_100251547	263
143	3300026089	Ga0207648_10095986	Ga0207648_100959866	263
144	3300026089	Ga0207648_10146402	Ga0207648_101464021	263
145	3300026095	Ga0207676_10422319	Ga0207676_104223191	263
146	3300026118	Ga0207675_100015318	Ga0207675_1000153186	263
147	3300026121	Ga0207683_10007924	Ga0207683_100079243	263
148	3300028380	Ga0268265_10030633	Ga0268265_100306337	263
149	3300031548	Ga0307408_100161899	Ga0307408_1001618992	263
150	3300031731	Ga0307405_10070079	Ga0307405_100700792	263
151	3300031731	Ga0307405_10079735	Ga0307405_100797351	263
152	3300031731	Ga0307405_10140727	Ga0307405_101407272	263
153	3300031731	Ga0307405_10455697	Ga0307405_104556971	263
154	3300031824	Ga0307413_10165586	Ga0307413_101655862	263
155	3300031824	Ga0307413_10200361	Ga0307413_102003612	263
156	3300031852	Ga0307410_10128192	Ga0307410_101281921	263
157	3300031852	Ga0307410_10179372	Ga0307410_101793721	263
158	3300031901	Ga0307406_10062543	Ga0307406_100625431	263
159	3300031903	Ga0307407_10029968	Ga0307407_100299682	263
160	3300031903	Ga0307407_10079893	Ga0307407_100798931	263
161	3300031911	Ga0307412_10040754	Ga0307412_100407541	263
162	3300031911	Ga0307412_10049489	Ga0307412_100494893	263
163	3300031911	Ga0307412_10213451	Ga0307412_102134512	263
164	3300031911	Ga0307412_10250665	Ga0307412_102506652	263
165	3300031995	Ga0307409_100025719	Ga0307409_1000257192	263
166	3300031995	Ga0307409_100029771	Ga0307409_1000297716	263
167	3300031995	Ga0307409_100051465	Ga0307409_1000514652	263
168	3300031995	Ga0307409_100119667	Ga0307409_1001196672	263
169	3300031995	Ga0307409_100415897	Ga0307409_1004158972	263
170	3300031995	Ga0307409_100425198	Ga0307409_1004251981	263
171	3300032002	Ga0307416_100005614	Ga0307416_10000561411	263
172	3300032002	Ga0307416_100017166	Ga0307416_1000171663	263
173	3300032002	Ga0307416_100052491	Ga0307416_1000524912	263
174	3300032002	Ga0307416_100217347	Ga0307416_1002173471	263
175	3300032004	Ga0307414_10030404	Ga0307414_100304043	263
176	3300032004	Ga0307414_10206129	Ga0307414_102061292	263
177	3300032005	Ga0307411_10013052	Ga0307411_100130522	263
178	3300032005	Ga0307411_10081410	Ga0307411_100814102	263
179	3300032126	Ga0307415_100013525	Ga0307415_1000135252	263
180	3300032126	Ga0307415_100356469	Ga0307415_1003564692	263
181	3300032126	Ga0307415_100455249	Ga0307415_1004552491	263
182	3300037312	Ga0395899_0000365	Ga0395899_0000365_52760_53554	263
183	3300037312	Ga0395899_0002975	Ga0395899_0002975_10765_11559	263
184	3300037312	Ga0395899_0027991	Ga0395899_0027991_1260_2099	263
185	3300037418	Ga0395900_0000093	Ga0395900_0000093_1118_1912	263
186	3300037418	Ga0395900_0003959	Ga0395900_0003959_3690_4484	263
187	3300037418	Ga0395900_0084067	Ga0395900_0084067_791_1585	263
188	3300037466	Ga0395898_0000053	Ga0395898_0000053_1118_1912	263
189	3300037466	Ga0395898_0001859	Ga0395898_0001859_24117_24911	263
190	3300037466	Ga0395898_0113696	Ga0395898_0113696_1714_2553	263
191	3300037471	Ga0395905_0000031	Ga0395905_0000031_284846_285640	263
192	3300037471	Ga0395905_0036724	Ga0395905_0036724_1877_2671	263
193	3300037471	Ga0395905_0041683	Ga0395905_0041683_1811_2605	263
194	3300037471	Ga0395905_0050489	Ga0395905_0050489_2416_3210	263
195	3300038443	Ga0395901_0005161	Ga0395901_0005161_12224_13018	263
196	3300038443	Ga0395901_0005379	Ga0395901_0005379_11039_11833	263
197	3300038443	Ga0395901_0448482	Ga0395901_0448482_441_1235	263
198	3300044719	Ga0466971_0054556	Ga0466971_0054556_133_927	263
199	3300044842	Ga0466957_0011733	Ga0466957_0011733_1802_2596	263
200	3300044842	Ga0466957_0143142	Ga0466957_0143142_484_1275	263
201	3300045836	Ga0466958_0038496	Ga0466958_0038496_688_1482	263
202	3300045836	Ga0466958_0151380	Ga0466958_0151380_196_990	263
203	3300045976	Ga0466967_0007633	Ga0466967_0007633_4082_4876	263
204	3300045976	Ga0466967_0272814	Ga0466967_0272814_246_1040	263
205	3300045976	Ga0466967_0330043	Ga0466967_0330043_260_1054	263
206	3300048912	Ga0496109_0339386	Ga0496109_0339386_502_1296	263
207	3300048915	Ga0496112_0040663	Ga0496112_0040663_742_1536	263
208	3300048915	Ga0496112_0343009	Ga0496112_0343009_244_1038	263
209	3300061719	Ga0466962_0036699	Ga0466962_0036699_539_1333	263
210	3300061719	Ga0466962_0079820	Ga0466962_0079820_675_1469	263
211	3300001978	JGI24747J21853_1001180	JGI24747J21853_10011802	264
212	3300001990	JGI24737J22298_10038300	JGI24737J22298_100383001	264
213	3300001991	JGI24743J22301_10025569	JGI24743J22301_100255692	264
214	3300002073	JGI24745J21846_1006716	JGI24745J21846_10067161	264
215	3300002077	JGI24744J21845_10002622	JGI24744J21845_100026224	264
216	3300003316	rootH1_10124416	rootH1_101244162	264
217	3300005327	Ga0070658_10104150	Ga0070658_101041503	264
218	3300005327	Ga0070658_10535080	Ga0070658_105350801	264
219	3300005328	Ga0070676_10171969	Ga0070676_101719692	264
220	3300005328	Ga0070676_10207817	Ga0070676_102078172	264
221	3300005330	Ga0070690_100001926	Ga0070690_1000019266	264
222	3300005330	Ga0070690_100060321	Ga0070690_1000603211	264
223	3300005331	Ga0070670_100004030	Ga0070670_1000040306	264
224	3300005331	Ga0070670_100575826	Ga0070670_1005758262	264
225	3300005334	Ga0068869_100087118	Ga0068869_1000871184	264
226	3300005335	Ga0070666_10040106	Ga0070666_100401063	264
227	3300005335	Ga0070666_10092191	Ga0070666_100921911	264
228	3300005338	Ga0068868_100002343	Ga0068868_10000234318	264
229	3300005338	Ga0068868_100044527	Ga0068868_1000445274	264
230	3300005338	Ga0068868_100048979	Ga0068868_1000489794	264
231	3300005339	Ga0070660_100411870	Ga0070660_1004118702	264
232	3300005340	Ga0070689_100315643	Ga0070689_1003156432	264
233	3300005347	Ga0070668_100014711	Ga0070668_1000147115	264
234	3300005354	Ga0070675_100107085	Ga0070675_1001070851	264
235	3300005354	Ga0070675_100162556	Ga0070675_1001625562	264
236	3300005354	Ga0070675_100327380	Ga0070675_1003273802	264
237	3300005355	Ga0070671_100002744	Ga0070671_1000027448	264
238	3300005355	Ga0070671_100002863	Ga0070671_10000286317	264
239	3300005355	Ga0070671_100086487	Ga0070671_1000864872	264
240	3300005355	Ga0070671_100106361	Ga0070671_1001063613	264
241	3300005355	Ga0070671_100124225	Ga0070671_1001242251	264
242	3300005356	Ga0070674_100023094	Ga0070674_1000230944	264
243	3300005356	Ga0070674_100033005	Ga0070674_1000330052	264
244	3300005364	Ga0070673_100003651	Ga0070673_1000036515	264
245	3300005364	Ga0070673_100010276	Ga0070673_1000102761	264
246	3300005364	Ga0070673_100019876	Ga0070673_1000198762	264
247	3300005364	Ga0070673_100562956	Ga0070673_1005629561	264
248	3300005366	Ga0070659_100001753	Ga0070659_1000017531	264
249	3300005366	Ga0070659_100207125	Ga0070659_1002071252	264
250	3300005366	Ga0070659_100285937	Ga0070659_1002859372	264
251	3300005367	Ga0070667_100002750	Ga0070667_10000275011	264
252	3300005367	Ga0070667_100309768	Ga0070667_1003097681	264
253	3300005436	Ga0070713_100013582	Ga0070713_1000135825	264
254	3300005455	Ga0070663_100124022	Ga0070663_1001240224	264
255	3300005455	Ga0070663_100401525	Ga0070663_1004015252	264
256	3300005456	Ga0070678_100014954	Ga0070678_1000149546	264
257	3300005456	Ga0070678_100019307	Ga0070678_1000193071	264
258	3300005456	Ga0070678_100151636	Ga0070678_1001516362	264
259	3300005457	Ga0070662_100046983	Ga0070662_1000469832	264
260	3300005458	Ga0070681_10201978	Ga0070681_102019782	264
261	3300005459	Ga0068867_100003061	Ga0068867_1000030614	264
262	3300005459	Ga0068867_100009786	Ga0068867_1000097864	264
263	3300005539	Ga0068853_100219605	Ga0068853_1002196052	264
264	3300005543	Ga0070672_100016832	Ga0070672_1000168325	264
265	3300005543	Ga0070672_100046292	Ga0070672_1000462922	264
266	3300005543	Ga0070672_100324285	Ga0070672_1003242852	264
267	3300005543	Ga0070672_100696340	Ga0070672_1006963401	264
268	3300005544	Ga0070686_100001629	Ga0070686_1000016296	264
269	3300005544	Ga0070686_100120476	Ga0070686_1001204762	264
270	3300005547	Ga0070693_100086749	Ga0070693_1000867492	264
271	3300005563	Ga0068855_100133080	Ga0068855_1001330803	264
272	3300005564	Ga0070664_100150498	Ga0070664_1001504981	264
273	3300005578	Ga0068854_100158378	Ga0068854_1001583781	264
274	3300005614	Ga0068856_100033822	Ga0068856_1000338225	264
275	3300005616	Ga0068852_100173967	Ga0068852_1001739672	264
276	3300005617	Ga0068859_100028314	Ga0068859_1000283146	264
277	3300005718	Ga0068866_10010865	Ga0068866_100108653	264
278	3300005718	Ga0068866_10033220	Ga0068866_100332204	264
279	3300005718	Ga0068866_10036053	Ga0068866_100360534	264
280	3300005719	Ga0068861_100230916	Ga0068861_1002309162	264
281	3300005834	Ga0068851_10058502	Ga0068851_100585024	264
282	3300005841	Ga0068863_100007458	Ga0068863_1000074585	264
283	3300005841	Ga0068863_100012971	Ga0068863_1000129712	264
284	3300005842	Ga0068858_100019228	Ga0068858_1000192286	264
285	3300005842	Ga0068858_100038694	Ga0068858_1000386945	264
286	3300005842	Ga0068858_100275886	Ga0068858_1002758862	264
287	3300005843	Ga0068860_100081369	Ga0068860_1000813693	264
288	3300006028	Ga0070717_10204982	Ga0070717_102049822	264
289	3300006173	Ga0070716_100134398	Ga0070716_1001343982	264
290	3300006237	Ga0097621_100324452	Ga0097621_1003244521	264
291	3300006358	Ga0068871_100042864	Ga0068871_1000428643	264
292	3300006871	Ga0075434_100017710	Ga0075434_1000177103	264
293	3300006881	Ga0068865_100001641	Ga0068865_1000016419	264
294	3300006931	Ga0097620_100028315	Ga0097620_1000283152	264
295	3300009098	Ga0105245_10272375	Ga0105245_102723753	264
296	3300009098	Ga0105245_10492127	Ga0105245_104921271	264
297	3300009148	Ga0105243_10139388	Ga0105243_101393882	264
298	3300009174	Ga0105241_10454881	Ga0105241_104548812	264
299	3300009177	Ga0105248_10002097	Ga0105248_1000209722	264
300	3300009177	Ga0105248_10180218	Ga0105248_101802182	264
301	3300009551	Ga0105238_10202893	Ga0105238_102028932	264
302	3300010375	Ga0105239_10836702	Ga0105239_108367022	264
303	3300011119	Ga0105246_10420746	Ga0105246_104207462	264
304	3300013100	Ga0157373_10075106	Ga0157373_100751062	264
305	3300013100	Ga0157373_10122605	Ga0157373_101226051	264
306	3300013102	Ga0157371_10091138	Ga0157371_100911381	264
307	3300013296	Ga0157374_10004363	Ga0157374_100043637	264
308	3300013296	Ga0157374_10326809	Ga0157374_103268092	264
309	3300013296	Ga0157374_10605356	Ga0157374_106053561	264
310	3300013297	Ga0157378_10041421	Ga0157378_100414213	264
311	3300013297	Ga0157378_10177673	Ga0157378_101776732	264
312	3300013297	Ga0157378_10203313	Ga0157378_102033133	264
313	3300013306	Ga0163162_10275056	Ga0163162_102750562	264
314	3300013306	Ga0163162_10413911	Ga0163162_104139111	264
315	3300014325	Ga0163163_10069868	Ga0163163_100698681	264
316	3300014745	Ga0157377_10194393	Ga0157377_101943931	264
317	3300014968	Ga0157379_10048726	Ga0157379_100487263	264
318	3300014969	Ga0157376_10032581	Ga0157376_100325811	264
319	3300020082	Ga0206353_11297066	Ga0206353_112970662	264
320	3300021384	Ga0213876_10017463	Ga0213876_100174632	264
321	3300025893	Ga0207682_10019312	Ga0207682_100193122	264
322	3300025899	Ga0207642_10008084	Ga0207642_100080843	264
323	3300025901	Ga0207688_10005782	Ga0207688_100057827	264
324	3300025903	Ga0207680_10003501	Ga0207680_100035014	264
325	3300025903	Ga0207680_10081644	Ga0207680_100816442	264
326	3300025904	Ga0207647_10002329	Ga0207647_100023298	264
327	3300025906	Ga0207699_10030056	Ga0207699_100300561	264
328	3300025907	Ga0207645_10012759	Ga0207645_100127594	264
329	3300025907	Ga0207645_10194097	Ga0207645_101940972	264
330	3300025909	Ga0207705_10014786	Ga0207705_100147866	264
331	3300025909	Ga0207705_10073102	Ga0207705_100731022	264
332	3300025912	Ga0207707_10200113	Ga0207707_102001132	264
333	3300025913	Ga0207695_10284321	Ga0207695_102843212	264
334	3300025919	Ga0207657_10437398	Ga0207657_104373981	264
335	3300025923	Ga0207681_10350889	Ga0207681_103508891	264
336	3300025924	Ga0207694_10293870	Ga0207694_102938702	264
337	3300025925	Ga0207650_10010159	Ga0207650_100101598	264
338	3300025925	Ga0207650_10254873	Ga0207650_102548732	264
339	3300025926	Ga0207659_10287322	Ga0207659_102873222	264
340	3300025927	Ga0207687_10079831	Ga0207687_100798311	264
341	3300025929	Ga0207664_10046513	Ga0207664_100465133	264
342	3300025931	Ga0207644_10001058	Ga0207644_1000105820	264
343	3300025931	Ga0207644_10005246	Ga0207644_100052466	264
344	3300025931	Ga0207644_10005523	Ga0207644_100055234	264
345	3300025932	Ga0207690_10283759	Ga0207690_102837592	264
346	3300025932	Ga0207690_10375297	Ga0207690_103752972	264
347	3300025933	Ga0207706_10028855	Ga0207706_100288552	264
348	3300025933	Ga0207706_10082458	Ga0207706_100824582	264
349	3300025933	Ga0207706_10289100	Ga0207706_102891001	264
350	3300025936	Ga0207670_10213025	Ga0207670_102130252	264
351	3300025937	Ga0207669_10017150	Ga0207669_100171504	264
352	3300025938	Ga0207704_10108308	Ga0207704_101083082	264
353	3300025938	Ga0207704_10216973	Ga0207704_102169731	264
354	3300025940	Ga0207691_10000954	Ga0207691_1000095416	264
355	3300025940	Ga0207691_10042803	Ga0207691_100428035	264
356	3300025941	Ga0207711_10002646	Ga0207711_1000264610	264
357	3300025941	Ga0207711_10003374	Ga0207711_100033749	264
358	3300025941	Ga0207711_10300016	Ga0207711_103000162	264
359	3300025942	Ga0207689_10034458	Ga0207689_100344582	264
360	3300025949	Ga0207667_10570194	Ga0207667_105701941	264
361	3300025960	Ga0207651_10000289	Ga0207651_1000028920	264
362	3300025960	Ga0207651_10011519	Ga0207651_100115192	264
363	3300025960	Ga0207651_10021611	Ga0207651_100216112	264
364	3300025960	Ga0207651_10054187	Ga0207651_100541872	264
365	3300025972	Ga0207668_10537599	Ga0207668_105375991	264
366	3300025981	Ga0207640_10211727	Ga0207640_102117272	264
367	3300025981	Ga0207640_10347504	Ga0207640_103475042	264
368	3300025986	Ga0207658_10004081	Ga0207658_100040817	264
369	3300025986	Ga0207658_10005082	Ga0207658_100050822	264
370	3300026023	Ga0207677_10013871	Ga0207677_100138715	264
371	3300026023	Ga0207677_10483640	Ga0207677_104836401	264
372	3300026035	Ga0207703_10002884	Ga0207703_100028849	264
373	3300026035	Ga0207703_10005616	Ga0207703_100056167	264
374	3300026041	Ga0207639_10200929	Ga0207639_102009292	264
375	3300026067	Ga0207678_10018673	Ga0207678_100186734	264
376	3300026078	Ga0207702_10041944	Ga0207702_100419442	264
377	3300026088	Ga0207641_10005418	Ga0207641_100054188	264
378	3300026088	Ga0207641_10176376	Ga0207641_101763762	264
379	3300026089	Ga0207648_10005820	Ga0207648_1000582015	264
380	3300026089	Ga0207648_10010845	Ga0207648_100108454	264
381	3300026095	Ga0207676_10009780	Ga0207676_100097809	264
382	3300026121	Ga0207683_10001453	Ga0207683_1000145311	264
383	3300026121	Ga0207683_10017922	Ga0207683_100179224	264
384	3300026121	Ga0207683_10188625	Ga0207683_101886252	264
385	3300026142	Ga0207698_10570614	Ga0207698_105706141	264
386	3300028381	Ga0268264_10227764	Ga0268264_102277643	264
387	3300037312	Ga0395899_0027690	Ga0395899_0027690_385_1179	264
388	3300037418	Ga0395900_0017884	Ga0395900_0017884_4388_5182	264
389	3300037418	Ga0395900_0097702	Ga0395900_0097702_588_1382	264
390	3300037466	Ga0395898_0327756	Ga0395898_0327756_282_1076	264
391	3300037471	Ga0395905_0012904	Ga0395905_0012904_1579_2373	264
392	3300037471	Ga0395905_0064255	Ga0395905_0064255_1042_1836	264
393	3300037471	Ga0395905_0074543	Ga0395905_0074543_1734_2528	264
394	3300038443	Ga0395901_0394554	Ga0395901_0394554_144_938	264
395	3300039437	Ga0436365_1506208	Ga0436365_1506208_854_1657	264
396	3300046537	Ga0495598_0003795	Ga0495598_0003795_480_1274	264
397	3300046539	Ga0495621_0000574	Ga0495621_0000574_353_1147	264
398	3300046664	Ga0495659_0101539	Ga0495659_0101539_221_1015	264
399	3300046691	Ga0495670_0000783	Ga0495670_0000783_10800_11594	264
400	3300047320	Ga0495672_0050753	Ga0495672_0050753_422_1225	264
401	3300047472	Ga0495686_0003429	Ga0495686_0003429_5161_5967	264
402	3300048903	Ga0496100_0007338	Ga0496100_0007338_503_1300	264
403	3300048904	Ga0496101_0001522	Ga0496101_0001522_11375_12172	264
404	3300048905	Ga0496102_0587822	Ga0496102_0587822_97_891	264
405	3300048910	Ga0496107_0003637	Ga0496107_0003637_5942_6739	264
406	3300048911	Ga0496108_0001452	Ga0496108_0001452_14000_14797	264
407	3300048912	Ga0496109_0008419	Ga0496109_0008419_1966_2763	264
408	3300048913	Ga0496110_0456386	Ga0496110_0456386_223_1020	264
409	3300048915	Ga0496112_0155958	Ga0496112_0155958_191_985	264
410	3300048915	Ga0496112_0320045	Ga0496112_0320045_504_1301	264
411	3300048917	Ga0496114_0000006	Ga0496114_0000006_278890_279684	264
412	3300050512	nmdc:mga0n895_153659_c1	nmdc:mga0n895_153659_c1_518_1324	264

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3kav-assembly1.cif.gz_A	crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198	0.4401	118	222
3kav-assembly1.cif.gz_A	crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198	0.4258	118	222
3kaw-assembly1.cif.gz_A	crystal structure of pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198	0.4113	146	221
2c63-assembly2.cif.gz_D	14-3-3 protein eta (human) complexed to peptide	0.3645	50	223
6q6b-assembly1.cif.gz_A	structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents	0.3637	88	222

ID	Description	Score	Start	End	Superfamily
af_Q6YZ04_1_129_1.20.140.40	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein	0.6021	13	97	1.20.140.40
af_B6U3T4_15_155_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.57	18	100	1.20.1250.20
af_I1MHL2_72_227_1.20.140.40	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein	0.4963	7	98	1.20.140.40
af_Q8MZ67_1_133_1.20.140.150	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;	0.4655	118	236	1.20.140.150
af_C0HEA1_38_187_1.20.140.40	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein	0.4473	93	221	1.20.140.40

ID	Description	Score	Start	End	GO Terms
AF-A0A7Y4YWN1-F1-model_v4	DUF2306 domain-containing protein	0.9856	27	258	GO:0016020
AF-A0A6N0X514-F1-model_v4	DUF2306 domain-containing protein	0.9853	27	255	GO:0016020
AF-A0A2S8B4K7-F1-model_v4	Uncharacterized protein	0.9839	27	255	GO:0016020
AF-A0A7U1E9B7-F1-model_v4	deleted	0.9816	27	169
AF-A0A0Q4KJR6-F1-model_v4	Uncharacterized protein	0.9812	12	257	GO:0016020

Feature Viewer

pLDDT	pTM	Quality
88.77	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F437875

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map