F437877

General Info

Members Datasets Scaffolds Average Seq Length
412 266 403 133

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0580089|Ga0451576_0580089_383_859
Length 158
Sequence VLCNANRTAGLRHTAALAIFGTPAMQTKSVLTLSDVRAIAAAAEAEALAHQWAVTIAIVDDGGHLLWLQRLDGAAPVSAHIAPAKARTAALGRRESKVYEDVINQGRTSFLSAPTLEGMLEGGVPVLVDGQCVGAVGVSGVKSNEDAQIARAGIAALG

Samples

Sample ID Description Type Environment
1 2643221570 Acidovorax sp. Root568 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2643221652 Acidovorax sp. Root402 Isolate Unclassified
4 2643221660 Methylibium sp. Root1272 Isolate Unclassified
5 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
6 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
7 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
8 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
9 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
159 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
160 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
230 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
231 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
242 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
259 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 0.24
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.53
Nodule 0.49
Rhizoplane 1.7
Rhizosphere 70.39
Stem 0
Stem Tuber 0
Unclassified 11.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000460 3300002704 Bacteria 10309
2 JGI25156J39149_1000171 3300002705 Bacteria 47365
3 JGI25156J39149_1002671 3300002705 Bacteria 6251
4 JGI25162J39368_1002885 3300002737 Bacteria 5900
5 JGI25154J39366_1000113 3300002738 Bacteria 69635
6 JGI25154J39366_1000491 3300002738 Bacteria 20263
7 JGI25158J39367_1000849 3300002739 Bacteria 5843
8 JGI25157J39369_1001212 3300002741 Bacteria 10741
9 JGI25157J39369_1001744 3300002741 Bacteria 7172
10 JGI25159J45721_1002252 3300002987 Bacteria 7448
11 JGI25159J45721_1005127 3300002987 Bacteria 4159
12 JGI25161J50226_1001368 3300003374 Bacteria 7448
13 Ga0055532_1000017 3300003758 Bacteria 306880
14 Ga0055526_1000701 3300003771 Bacteria 25397
15 Ga0055526_1009920 3300003771 Bacteria 4509
16 Ga0055537_1000098 3300003773 Bacteria 65302
17 Ga0055537_1018367 3300003773 Bacteria 1119
18 Ga0055534_1000009 3300003784 Bacteria 210256
19 Ga0055528_1002883 3300003790 Bacteria 8946
20 Ga0055530_10004725 3300003791 Bacteria 6880
21 Ga0055543_1000937 3300004625 Bacteria 13476
22 Ga0055543_1005125 3300004625 Bacteria 3407
23 Ga0065165_1000039 3300005262 Bacteria 208372
24 Ga0065165_1001831 3300005262 Bacteria 20773
25 Ga0070676_10136994 3300005328 Bacteria 1554
26 Ga0070676_10160105 3300005328 Bacteria 1448
27 Ga0070670_100152803 3300005331 Bacteria 1998
28 Ga0070670_100277536 3300005331 Bacteria 1463
29 Ga0070670_100733322 3300005331 Bacteria 890
30 Ga0070677_10208655 3300005333 Bacteria 947
31 Ga0070666_10229331 3300005335 Bacteria 1311
32 Ga0070668_100949118 3300005347 Bacteria 771
33 Ga0070669_100540897 3300005353 Bacteria 970
34 Ga0070674_100350810 3300005356 Bacteria 1192
35 Ga0070673_100250059 3300005364 Bacteria 1545
36 Ga0070673_101920545 3300005364 Bacteria 561
37 Ga0070667_100007516 3300005367 Bacteria 9036
38 Ga0070667_100030357 3300005367 Bacteria 4508
39 Ga0070667_100882611 3300005367 Bacteria 832
40 Ga0070701_10676942 3300005438 Bacteria 691
41 Ga0070705_100142031 3300005440 Bacteria 1581
42 Ga0070700_100018643 3300005441 Bacteria 3993
43 Ga0070708_100224355 3300005445 Bacteria 1763
44 Ga0070663_100426406 3300005455 Bacteria 1089
45 Ga0070678_101308745 3300005456 Bacteria 674
46 Ga0068867_100000048 3300005459 Bacteria 73813
47 Ga0068867_100005348 3300005459 Bacteria 9072
48 Ga0070706_100002804 3300005467 Bacteria 17435
49 Ga0070698_100148021 3300005471 Bacteria 2297
50 Ga0070698_100760957 3300005471 Bacteria 912
51 Ga0070699_100521671 3300005518 Bacteria 1080
52 Ga0070679_101158062 3300005530 Bacteria 718
53 Ga0070672_100779508 3300005543 Bacteria 840
54 Ga0068855_101179306 3300005563 Bacteria 797
55 Ga0068857_100598428 3300005577 Bacteria 1042
56 Ga0068857_101174688 3300005577 Bacteria 743
57 Ga0068856_100183327 3300005614 Bacteria 2107
58 Ga0068852_100005208 3300005616 Bacteria 9273
59 Ga0068852_101254976 3300005616 Bacteria 762
60 Ga0068852_101563561 3300005616 Unclassified 682
61 Ga0068866_10126623 3300005718 Bacteria 1447
62 Ga0068861_100055957 3300005719 Bacteria 3009
63 Ga0068851_10109548 3300005834 Bacteria 1473
64 Ga0068860_100079293 3300005843 Bacteria 3122
65 Ga0068860_100932693 3300005843 Bacteria 885
66 Ga0068860_100969328 3300005843 Bacteria 868
67 Ga0068862_100201926 3300005844 Bacteria 1793
68 Ga0068862_100660690 3300005844 Bacteria 1009
69 Ga0075368_10100635 3300006042 Bacteria 1187
70 Ga0075363_100091635 3300006048 Bacteria 1673
71 Ga0075367_10042806 3300006178 Bacteria 2651
72 Ga0075366_10007387 3300006195 Bacteria 6067
73 Ga0075366_10045818 3300006195 Bacteria 2591
74 Ga0075366_10123934 3300006195 Bacteria 1558
75 Ga0075366_10365381 3300006195 Bacteria 886
76 Ga0075366_10424274 3300006195 Bacteria 819
77 Ga0075370_10230797 3300006353 Bacteria 1095
78 Ga0075430_100430633 3300006846 Bacteria 1089
79 Ga0075431_100129943 3300006847 Bacteria 2598
80 Ga0075431_100484303 3300006847 Bacteria 1229
81 Ga0075433_11668655 3300006852 Bacteria 549
82 Ga0075429_100073826 3300006880 Bacteria 2971
83 Ga0079104_1070073 3300006946 Bacteria 738
84 Ga0099826_10000001 3300006948 Bacteria 1155201
85 Ga0111539_11205987 3300009094 Bacteria 879
86 Ga0105245_10293476 3300009098 Bacteria 1593
87 Ga0114129_10158968 3300009147 Bacteria 3089
88 Ga0114129_11359937 3300009147 Bacteria 878
89 Ga0114129_11702568 3300009147 Bacteria 769
90 Ga0114129_11723220 3300009147 Bacteria 764
91 Ga0105243_10004483 3300009148 Bacteria 11036
92 Ga0105243_10495048 3300009148 Bacteria 1157
93 Ga0105238_10025602 3300009551 Bacteria 6015
94 Ga0105249_10149926 3300009553 Bacteria 2244
95 Ga0105249_11448904 3300009553 Bacteria 759
96 Ga0105239_10281595 3300010375 Bacteria 1872
97 Ga0157373_10026629 3300013100 Bacteria 4174
98 Ga0157378_10016318 3300013297 Bacteria 6505
99 Ga0163162_10020708 3300013306 Bacteria 6464
100 Ga0157375_10217256 3300013308 Bacteria 2070
101 Ga0157380_10092448 3300014326 Bacteria 2500
102 Ga0182008_10022755 3300014497 Bacteria 3208
103 Ga0157377_10000056 3300014745 Bacteria 87608
104 Ga0157379_10011722 3300014968 Bacteria 7655
105 Ga0157379_10062816 3300014968 Bacteria 3321
106 Ga0157379_12197999 3300014968 Bacteria 548
107 Ga0182006_1033321 3300015261 Bacteria 2066
108 Ga0182006_1036236 3300015261 Bacteria 1962
109 Ga0163161_10099573 3300017792 Bacteria 2162
110 Ga0213872_10000003 3300021361 Bacteria 366948
111 Ga0213872_10159319 3300021361 Bacteria 983
112 Ga0209435_100015 3300025206 Bacteria 321177
113 Ga0209435_100128 3300025206 Bacteria 26382
114 Ga0209436_100356 3300025208 Bacteria 20654
115 Ga0209147_100004 3300025229 Bacteria 1371850
116 Ga0209437_100329 3300025233 Bacteria 59120
117 Ga0209646_1000020 3300025246 Bacteria 462204
118 Ga0209646_1000040 3300025246 Bacteria 347867
119 Ga0209026_1000034 3300025250 Bacteria 306953
120 Ga0209026_1004287 3300025250 Bacteria 4305
121 Ga0209148_1026781 3300025254 Bacteria 892
122 Ga0209759_1000234 3300025256 Bacteria 83099
123 Ga0209759_1012474 3300025256 Bacteria 2352
124 Ga0209233_1036519 3300025261 Bacteria 1100
125 Ga0209565_1000015 3300025263 Bacteria 494091
126 Ga0209565_1009801 3300025263 Bacteria 2405
127 Ga0209565_1026885 3300025263 Bacteria 1150
128 Ga0209455_1003140 3300025272 Bacteria 6008
129 Ga0209673_1000017 3300025273 Bacteria 492994
130 Ga0209130_1000856 3300025284 Bacteria 25205
131 Ga0209130_1003063 3300025284 Bacteria 7509
132 Ga0209675_1000012 3300025291 Bacteria 494061
133 Ga0209675_1011321 3300025291 Bacteria 2966
134 Ga0209025_1001069 3300025294 Bacteria 39750
135 Ga0209564_1000016 3300025295 Bacteria 613131
136 Ga0209564_1000184 3300025295 Bacteria 149989
137 Ga0209050_1000159 3300025298 Bacteria 157244
138 Ga0209256_1000593 3300025299 Bacteria 50391
139 Ga0209256_1002373 3300025299 Bacteria 15531
140 Ga0207642_10106266 3300025899 Bacteria 1420
141 Ga0207647_10432489 3300025904 Bacteria 739
142 Ga0207645_10394305 3300025907 Bacteria 930
143 Ga0207662_10466496 3300025918 Bacteria 865
144 Ga0207681_10978967 3300025923 Bacteria 709
145 Ga0207694_10117402 3300025924 Bacteria 2121
146 Ga0207650_10169806 3300025925 Bacteria 1733
147 Ga0207644_10260017 3300025931 Bacteria 1388
148 Ga0207686_11171799 3300025934 Bacteria 628
149 Ga0207709_10002411 3300025935 Bacteria 11757
150 Ga0207709_11289130 3300025935 Bacteria 603
151 Ga0207669_10299889 3300025937 Bacteria 1221
152 Ga0207691_10140367 3300025940 Bacteria 2130
153 Ga0207667_10977044 3300025949 Bacteria 835
154 Ga0207651_10066438 3300025960 Bacteria 2534
155 Ga0207668_10311500 3300025972 Bacteria 1303
156 Ga0207658_10052082 3300025986 Bacteria 3020
157 Ga0207658_10113168 3300025986 Bacteria 2149
158 Ga0207658_10420006 3300025986 Bacteria 1179
159 Ga0207708_10130141 3300026075 Bacteria 1968
160 Ga0207648_10001142 3300026089 Bacteria 29820
161 Ga0207648_10040173 3300026089 Bacteria 4111
162 Ga0207674_10152729 3300026116 Bacteria 2266
163 Ga0207675_100053281 3300026118 Bacteria 3775
164 Ga0207683_10482934 3300026121 Bacteria 1143
165 Ga0207683_11218199 3300026121 Bacteria 698
166 Ga0207698_10062775 3300026142 Bacteria 2903
167 Ga0207698_11365204 3300026142 Bacteria 724
168 Ga0209983_1115683 3300027665 Unclassified 611
169 Ga0268265_11409811 3300028380 Bacteria 699
170 Ga0268264_10005958 3300028381 Bacteria 10316
171 Ga0268264_10773143 3300028381 Bacteria 958
172 Ga0307515_10009650 3300028794 Bacteria 18624
173 Ga0307515_10047918 3300028794 Bacteria 6477
174 Ga0307515_10063494 3300028794 Bacteria 5186
175 Ga0307512_10004318 3300030522 Bacteria 15676
176 Ga0307513_10007743 3300031456 Bacteria 13868
177 Ga0307513_10044451 3300031456 Bacteria 4866
178 Ga0307513_10065484 3300031456 Bacteria 3823
179 Ga0307513_10246198 3300031456 Bacteria 1588
180 Ga0307509_10121303 3300031507 Bacteria 2591
181 Ga0307509_10305270 3300031507 Bacteria 1337
182 Ga0307408_100000294 3300031548 Bacteria 48528
183 Ga0307408_100008913 3300031548 Bacteria 6629
184 Ga0307408_100070381 3300031548 Bacteria 2583
185 Ga0307408_100241638 3300031548 Bacteria 1484
186 Ga0307408_101744888 3300031548 Bacteria 594
187 Ga0307514_10096746 3300031649 Bacteria 2132
188 Ga0265314_10391918 3300031711 Bacteria 753
189 Ga0265342_10080492 3300031712 Bacteria 1882
190 Ga0307516_10011091 3300031730 Bacteria 9841
191 Ga0307516_10069359 3300031730 Bacteria 3391
192 Ga0307405_10300659 3300031731 Bacteria 1217
193 Ga0307413_10524134 3300031824 Bacteria 956
194 Ga0307518_10027859 3300031838 Bacteria 4075
195 Ga0307412_10219382 3300031911 Bacteria 1457
196 Ga0307412_10451321 3300031911 Bacteria 1059
197 Ga0307412_10947927 3300031911 Bacteria 757
198 Ga0307409_100096634 3300031995 Bacteria 2438
199 Ga0307416_101069582 3300032002 Bacteria 911
200 Ga0307507_10306300 3300033179 Bacteria 969
201 Ga0307510_10005180 3300033180 Bacteria 15492
202 Ga0307510_10046415 3300033180 Bacteria 4670
203 Ga0307510_10071904 3300033180 Bacteria 3440
204 Ga0373943_0582551 3300035170 Bacteria 658
205 Ga0373925_0028877 3300037068 Bacteria 4066
206 Ga0395900_0524070 3300037418 Bacteria 1132
207 Ga0395905_0002485 3300037471 Bacteria 20393
208 Ga0395905_1415858 3300037471 Bacteria 599
209 Ga0395901_0442005 3300038443 Bacteria 1331
210 Ga0395901_0792154 3300038443 Bacteria 937
211 Ga0436361_0003822 3300039447 Bacteria 65675
212 Ga0439465_0088784 3300041413 Bacteria 1055
213 Ga0451791_0553318 3300041451 Bacteria 1470
214 Ga0451795_0077431 3300041456 Bacteria 1127
215 Ga0451843_1527536 3300041509 Bacteria 579
216 Ga0439433_0117389 3300041999 Bacteria 669
217 Ga0439445_0038824 3300042004 Bacteria 1260
218 Ga0439449_0007042 3300042007 Bacteria 4283
219 Ga0450888_008812 3300042126 Bacteria 1143
220 Ga0450898_022357 3300042134 Bacteria 1119
221 Ga0450906_023569 3300042145 Bacteria 1096
222 Ga0439446_0028707 3300042156 Bacteria 1603
223 Ga0439434_0020575 3300042435 Bacteria 1982
224 Ga0451577_0221191 3300042876 Bacteria 1711
225 Ga0466972_0000154 3300044658 Bacteria 55379
226 Ga0453683_0014003 3300044673 Bacteria 5218
227 Ga0466964_0478057 3300044706 Bacteria 665
228 Ga0453684_0234526 3300044712 Bacteria 2116
229 Ga0451576_0021797 3300045051 Bacteria 6955
230 Ga0451576_0230929 3300045051 Bacteria 1932
231 Ga0451576_0253694 3300045051 Bacteria 1838
232 Ga0451576_0580089 3300045051 Bacteria 1178
233 Ga0495592_0001081 3300046454 Bacteria 18882
234 Ga0495629_0520282 3300046459 Bacteria 801
235 Ga0495638_0020157 3300046460 Bacteria 4406
236 Ga0495638_0035461 3300046460 Bacteria 3180
237 Ga0495641_0184313 3300046461 Bacteria 935
238 Ga0495605_0001803 3300046474 Bacteria 13734
239 Ga0495605_0252462 3300046474 Bacteria 754
240 Ga0495584_0476333 3300046491 Bacteria 635
241 Ga0495585_0001355 3300046492 Bacteria 19398
242 Ga0495585_0025717 3300046492 Bacteria 3367
243 Ga0495585_0043427 3300046492 Bacteria 2514
244 Ga0495594_0008543 3300046499 Bacteria 5280
245 Ga0495594_0073042 3300046499 Bacteria 1908
246 Ga0495596_0006124 3300046500 Bacteria 5589
247 Ga0495607_0011511 3300046501 Bacteria 5886
248 Ga0495607_0055149 3300046501 Bacteria 2287
249 Ga0495607_0057189 3300046501 Bacteria 2236
250 Ga0495607_0097245 3300046501 Bacteria 1583
251 Ga0495583_0000235 3300046506 Bacteria 91939
252 Ga0495583_0000402 3300046506 Bacteria 65718
253 Ga0495583_0003535 3300046506 Bacteria 11809
254 Ga0495583_0055480 3300046506 Bacteria 1790
255 Ga0495583_0059945 3300046506 Bacteria 1703
256 Ga0495583_0087304 3300046506 Bacteria 1348
257 Ga0495606_0503234 3300046507 Bacteria 611
258 Ga0495610_0031809 3300046512 Bacteria 2749
259 Ga0495616_0004761 3300046513 Bacteria 8502
260 Ga0495616_0028955 3300046513 Bacteria 2928
261 Ga0495632_0031577 3300046519 Bacteria 2736
262 Ga0495632_0271925 3300046519 Bacteria 756
263 Ga0495632_0296325 3300046519 Bacteria 718
264 Ga0495643_0000922 3300046522 Bacteria 30713
265 Ga0495643_0035764 3300046522 Bacteria 2733
266 Ga0495643_0078801 3300046522 Bacteria 1719
267 Ga0495643_0106235 3300046522 Bacteria 1433
268 Ga0495644_0010960 3300046523 Bacteria 3494
269 Ga0495644_0011721 3300046523 Bacteria 3375
270 Ga0495648_0011178 3300046524 Bacteria 6780
271 Ga0495648_0034943 3300046524 Bacteria 3264
272 Ga0495648_0080786 3300046524 Bacteria 1851
273 Ga0495666_0110790 3300046526 Bacteria 1289
274 Ga0495642_0033969 3300046528 Bacteria 2052
275 Ga0495609_0002163 3300046538 Bacteria 12350
276 Ga0495609_0028723 3300046538 Bacteria 2537
277 Ga0495609_0117618 3300046538 Bacteria 1144
278 Ga0495622_0033655 3300046557 Bacteria 2392
279 Ga0495622_0375171 3300046557 Bacteria 614
280 Ga0495633_0371011 3300046558 Bacteria 648
281 Ga0495633_0409036 3300046558 Bacteria 613
282 Ga0495656_0025242 3300046615 Bacteria 2355
283 Ga0495656_0025802 3300046615 Bacteria 2333
284 Ga0495668_0004419 3300046616 Bacteria 9990
285 Ga0495668_0046583 3300046616 Bacteria 2408
286 Ga0495611_0009509 3300046648 Bacteria 4108
287 Ga0495611_0011245 3300046648 Bacteria 3794
288 Ga0495611_0054112 3300046648 Bacteria 1813
289 Ga0495625_0027536 3300046660 Bacteria 4277
290 Ga0495625_0057050 3300046660 Bacteria 2778
291 Ga0495625_0251668 3300046660 Bacteria 1146
292 Ga0495625_0482009 3300046660 Bacteria 761
293 Ga0495659_0004046 3300046664 Bacteria 4640
294 Ga0495659_0023754 3300046664 Bacteria 2085
295 Ga0495659_0353202 3300046664 Bacteria 628
296 Ga0495661_0068748 3300046665 Bacteria 2077
297 Ga0495661_0088571 3300046665 Bacteria 1766
298 Ga0495661_0234554 3300046665 Bacteria 944
299 Ga0495661_0275179 3300046665 Bacteria 850
300 Ga0495588_0028079 3300046674 Bacteria 2815
301 Ga0495646_0275481 3300046680 Bacteria 895
302 Ga0495669_0019562 3300046684 Bacteria 2923
303 Ga0495669_0033063 3300046684 Bacteria 2275
304 Ga0495670_0643212 3300046691 Bacteria 578
305 Ga0495671_0009254 3300046692 Bacteria 5506
306 Ga0495671_0079306 3300046692 Bacteria 1609
307 Ga0495671_0107111 3300046692 Bacteria 1365
308 Ga0495649_0035065 3300046694 Bacteria 2759
309 Ga0495649_0066945 3300046694 Bacteria 1927
310 Ga0495589_0311495 3300046794 Bacteria 728
311 Ga0495660_0001221 3300046810 Bacteria 17944
312 Ga0495660_0078661 3300046810 Bacteria 1733
313 Ga0495660_0146492 3300046810 Bacteria 1170
314 Ga0495636_0000873 3300047318 Bacteria 11144
315 Ga0495636_0049191 3300047318 Bacteria 1762
316 Ga0495636_0231527 3300047318 Bacteria 850
317 Ga0495672_0021391 3300047320 Bacteria 4220
318 Ga0495676_0812794 3300047321 Bacteria 601
319 Ga0495683_0003822 3300047323 Bacteria 8679
320 Ga0495687_000568 3300047443 Bacteria 43554
321 Ga0495687_266690 3300047443 Bacteria 502
322 Ga0495677_0005658 3300047445 Bacteria 4735
323 Ga0495677_0013686 3300047445 Bacteria 2952
324 Ga0495677_0019264 3300047445 Bacteria 2475
325 Ga0495679_030400 3300047446 Bacteria 1753
326 Ga0495685_000422 3300047447 Bacteria 13390
327 Ga0495685_064593 3300047447 Bacteria 1230
328 Ga0495685_207961 3300047447 Bacteria 626
329 Ga0495673_0042044 3300047469 Bacteria 2054
330 Ga0495681_0011152 3300047470 Bacteria 5379
331 Ga0495686_0002781 3300047472 Bacteria 15956
332 Ga0495686_0005058 3300047472 Bacteria 10572
333 Ga0495686_0212741 3300047472 Bacteria 1104
334 Ga0495686_0257080 3300047472 Bacteria 979
335 Ga0495626_0009700 3300048091 Bacteria 5190
336 Ga0495626_0264107 3300048091 Bacteria 687
337 Ga0496104_0176038 3300048907 Bacteria 2050
338 Ga0496105_0105541 3300048908 Bacteria 2326
339 Ga0496105_0550377 3300048908 Bacteria 901
340 Ga0496109_0344170 3300048912 Bacteria 1408
341 Ga0496110_0911631 3300048913 Bacteria 785
342 Ga0496116_0028074 3300048919 Bacteria 4084
343 Ga0496117_0146204 3300048920 Bacteria 1407
344 Ga0496121_0069439 3300048924 Bacteria 2843
345 Ga0496121_0247019 3300048924 Bacteria 1240
346 Ga0496122_0000743 3300048925 Bacteria 63607
347 Ga0496123_0000582 3300048926 Bacteria 62256
348 Ga0496123_0334455 3300048926 Bacteria 710
349 Ga0496124_0193265 3300048927 Bacteria 1555
350 Ga0496125_0002847 3300048928 Bacteria 21779
351 Ga0496125_0025990 3300048928 Bacteria 5348
352 Ga0495678_004834 3300049459 Bacteria 7648
353 Ga0495678_156059 3300049459 Bacteria 733
354 Ga0495682_0000813 3300049460 Bacteria 19684
355 Ga0495682_0004113 3300049460 Bacteria 6314
356 Ga0501325_015415 3300049541 Bacteria 754
357 Ga0501033_0281711 3300049570 Bacteria 1173
358 Ga0501036_0464919 3300049572 Bacteria 1053
359 Ga0501037_0378888 3300049573 Bacteria 973
360 Ga0501039_0276690 3300049575 Bacteria 1320
361 Ga0501040_0792106 3300049576 Unclassified 686
362 Ga0501046_0204065 3300049580 Bacteria 1470
363 Ga0501073_0729044 3300049589 Unclassified 684
364 Ga0501076_1298331 3300049592 Unclassified 598
365 Ga0501077_0038873 3300049593 Bacteria 3030
366 Ga0501077_0716320 3300049593 Bacteria 643
367 Ga0501230_152695 3300049667 Bacteria 525
368 Ga0501236_110625 3300049670 Bacteria 549
369 Ga0501079_0222043 3300049741 Bacteria 1476
370 Ga0501080_0427726 3300049742 Bacteria 1189
371 Ga0501081_0029953 3300049743 Bacteria 3680
372 Ga0501081_1230097 3300049743 Unclassified 567
373 Ga0501266_001619 3300049763 Bacteria 2869
374 Ga0501045_0030588 3300049824 Bacteria 3898
375 nmdc:mga0k408_11995_c1 3300050493 Bacteria 4729
376 nmdc:mga0k408_191211_c1 3300050493 Bacteria 1221
377 nmdc:mga0k408_418719_c1 3300050493 Bacteria 797
378 nmdc:mga06z11_447065_c1 3300050494 Bacteria 781
379 nmdc:mga04h51_30130_c1 3300050495 Bacteria 1705
380 nmdc:mga07m45_237773_c1 3300050496 Bacteria 1060
381 nmdc:mga07m45_326056_c1 3300050496 Bacteria 893
382 nmdc:mga05p37_1167790_c1 3300050507 Bacteria 799
383 nmdc:mga05p37_1237951_c1 3300050507 Bacteria 767
384 nmdc:mga05p37_1317288_c1 3300050507 Unclassified 735
385 nmdc:mga05p37_409448_c1 3300050507 Bacteria 1581
386 nmdc:mga09592_28016_c1 3300050508 Bacteria 4677
387 nmdc:mga06r32_532347_c1 3300050510 Bacteria 1150
388 nmdc:mga06r32_982329_c1 3300050510 Unclassified 798
389 nmdc:mga08y16_935280_c1 3300050511 Bacteria 851
390 nmdc:mga0a205_286095_c2 3300050515 Bacteria 508
391 Ga0500651_0280319 3300053093 Bacteria 961
392 Ga0500593_000933 3300053117 Bacteria 10808
393 Ga0500594_0013317 3300053118 Bacteria 1953
394 Ga0500559_0000059 3300053136 Bacteria 87846
395 Ga0500559_0153031 3300053136 Bacteria 1083
396 Ga0500568_0159557 3300053139 Bacteria 832
397 Ga0500622_0001424 3300053156 Bacteria 19240
398 Ga0500636_0334605 3300053177 Bacteria 730
399 Ga0500645_066187 3300053730 Bacteria 1040
400 Ga0500587_005069 3300053739 Bacteria 1786
401 Ga0500587_005415 3300053739 Bacteria 1716
402 Ga0530510_0015262 3300061734 Bacteria 5425
403 Ga0530510_0080474 3300061734 Bacteria 2371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027665 Ga0209983_1115683 Ga0209983_11156832 111
2 3300009147 Ga0114129_11359937 Ga0114129_113599372 119
3 3300050507 nmdc:mga05p37_409448_c1 nmdc:mga05p37_409448_c1_833_1192 119
4 3300050508 nmdc:mga09592_28016_c1 nmdc:mga09592_28016_c1_1470_1829 119
5 3300050510 nmdc:mga06r32_532347_c1 nmdc:mga06r32_532347_c1_85_444 119
6 3300050515 nmdc:mga0a205_286095_c2 nmdc:mga0a205_286095_c2_82_441 119
7 iso_pu_bacteria 2856287931 2856292665 119
8 3300005328 Ga0070676_10136994 Ga0070676_101369942 123
9 3300005333 Ga0070677_10208655 Ga0070677_102086551 123
10 3300005347 Ga0070668_100949118 Ga0070668_1009491181 123
11 3300005353 Ga0070669_100540897 Ga0070669_1005408971 123
12 3300005367 Ga0070667_100030357 Ga0070667_1000303574 123
13 3300005438 Ga0070701_10676942 Ga0070701_106769421 123
14 3300005441 Ga0070700_100018643 Ga0070700_1000186432 123
15 3300005455 Ga0070663_100426406 Ga0070663_1004264061 123
16 3300005456 Ga0070678_101308745 Ga0070678_1013087451 123
17 3300005459 Ga0068867_100005348 Ga0068867_1000053485 123
18 3300005543 Ga0070672_100779508 Ga0070672_1007795081 123
19 3300005616 Ga0068852_101254976 Ga0068852_1012549761 123
20 3300005718 Ga0068866_10126623 Ga0068866_101266232 123
21 3300005719 Ga0068861_100055957 Ga0068861_1000559572 123
22 3300005843 Ga0068860_100079293 Ga0068860_1000792933 123
23 3300005844 Ga0068862_100201926 Ga0068862_1002019262 123
24 3300009148 Ga0105243_10495048 Ga0105243_104950482 123
25 3300009553 Ga0105249_10149926 Ga0105249_101499262 123
26 3300013297 Ga0157378_10016318 Ga0157378_100163182 123
27 3300013306 Ga0163162_10020708 Ga0163162_100207083 123
28 3300014968 Ga0157379_10062816 Ga0157379_100628163 123
29 3300017792 Ga0163161_10099573 Ga0163161_100995732 125
30 3300025899 Ga0207642_10106266 Ga0207642_101062662 125
31 3300025907 Ga0207645_10394305 Ga0207645_103943051 125
32 3300025918 Ga0207662_10466496 Ga0207662_104664961 125
33 3300025923 Ga0207681_10978967 Ga0207681_109789671 125
34 3300025934 Ga0207686_11171799 Ga0207686_111717991 125
35 3300025935 Ga0207709_11289130 Ga0207709_112891301 125
36 3300025940 Ga0207691_10140367 Ga0207691_101403673 125
37 3300025986 Ga0207658_10052082 Ga0207658_100520821 125
38 3300026075 Ga0207708_10130141 Ga0207708_101301412 125
39 3300026089 Ga0207648_10040173 Ga0207648_100401733 125
40 3300026118 Ga0207675_100053281 Ga0207675_1000532813 125
41 3300026121 Ga0207683_11218199 Ga0207683_112181992 125
42 3300026142 Ga0207698_11365204 Ga0207698_113652041 125
43 3300028381 Ga0268264_10005958 Ga0268264_100059584 125
44 3300006195 Ga0075366_10365381 Ga0075366_103653812 126
45 3300006946 Ga0079104_1070073 Ga0079104_10700732 126
46 3300025294 Ga0209025_1001069 Ga0209025_100106914 127
47 3300050493 nmdc:mga0k408_191211_c1 nmdc:mga0k408_191211_c1_110_523 127
48 3300031711 Ga0265314_10391918 Ga0265314_103919182 130
49 3300031712 Ga0265342_10080492 Ga0265342_100804921 130
50 3300048907 Ga0496104_0176038 Ga0496104_0176038_1301_1705 130
51 3300048908 Ga0496105_0105541 Ga0496105_0105541_436_828 130
52 iso_pu_bacteria 2643221638 2644211835 130
53 iso_pu_bacteria 2643221660 2644340295 130
54 iso_pu_bacteria 2857357740 2857360867 130
55 iso_pu_bacteria 2643221570 2643866885 131
56 iso_pu_bacteria 2643221652 2644294719 131
57 iso_pu_bacteria 2818991445 2819591978 131
58 iso_pu_bacteria 2887375801 2887377913 131
59 iso_pu_bacteria 2990710928 2990712817 131
60 3300049570 Ga0501033_0281711 Ga0501033_0281711_371_769 132
61 3300049572 Ga0501036_0464919 Ga0501036_0464919_383_781 132
62 3300049573 Ga0501037_0378888 Ga0501037_0378888_390_788 132
63 3300049575 Ga0501039_0276690 Ga0501039_0276690_516_914 132
64 3300049576 Ga0501040_0792106 Ga0501040_0792106_10_408 132
65 3300049580 Ga0501046_0204065 Ga0501046_0204065_477_875 132
66 3300049589 Ga0501073_0729044 Ga0501073_0729044_68_466 132
67 3300049592 Ga0501076_1298331 Ga0501076_1298331_133_531 132
68 3300049593 Ga0501077_0038873 Ga0501077_0038873_204_602 132
69 3300049593 Ga0501077_0716320 Ga0501077_0716320_34_432 132
70 3300049741 Ga0501079_0222043 Ga0501079_0222043_1000_1398 132
71 3300049742 Ga0501080_0427726 Ga0501080_0427726_772_1170 132
72 3300049743 Ga0501081_0029953 Ga0501081_0029953_275_673 132
73 3300049743 Ga0501081_1230097 Ga0501081_1230097_104_502 132
74 3300049824 Ga0501045_0030588 Ga0501045_0030588_2032_2430 132
75 3300061734 Ga0530510_0015262 Ga0530510_0015262_2066_2464 132
76 3300061734 Ga0530510_0080474 Ga0530510_0080474_173_571 132
77 3300005440 Ga0070705_100142031 Ga0070705_1001420311 133
78 3300005471 Ga0070698_100760957 Ga0070698_1007609572 133
79 3300005577 Ga0068857_100598428 Ga0068857_1005984282 133
80 3300006846 Ga0075430_100430633 Ga0075430_1004306331 133
81 3300006847 Ga0075431_100129943 Ga0075431_1001299433 133
82 3300006847 Ga0075431_100484303 Ga0075431_1004843032 133
83 3300006852 Ga0075433_11668655 Ga0075433_116686551 133
84 3300006880 Ga0075429_100073826 Ga0075429_1000738263 133
85 3300009094 Ga0111539_11205987 Ga0111539_112059871 133
86 3300009147 Ga0114129_10158968 Ga0114129_101589682 133
87 3300009147 Ga0114129_11723220 Ga0114129_117232202 133
88 3300025904 Ga0207647_10432489 Ga0207647_104324892 133
89 3300026116 Ga0207674_10152729 Ga0207674_101527293 133
90 3300046459 Ga0495629_0520282 Ga0495629_0520282_37_444 133
91 3300046499 Ga0495594_0073042 Ga0495594_0073042_970_1377 133
92 3300046526 Ga0495666_0110790 Ga0495666_0110790_776_1183 133
93 3300046557 Ga0495622_0375171 Ga0495622_0375171_107_514 133
94 3300046558 Ga0495633_0371011 Ga0495633_0371011_50_457 133
95 3300046674 Ga0495588_0028079 Ga0495588_0028079_569_976 133
96 3300047321 Ga0495676_0812794 Ga0495676_0812794_145_552 133
97 3300050507 nmdc:mga05p37_1167790_c1 nmdc:mga05p37_1167790_c1_297_698 133
98 3300050507 nmdc:mga05p37_1317288_c1 nmdc:mga05p37_1317288_c1_239_640 133
99 3300050510 nmdc:mga06r32_982329_c1 nmdc:mga06r32_982329_c1_188_589 133
100 3300050511 nmdc:mga08y16_935280_c1 nmdc:mga08y16_935280_c1_330_731 133
101 3300002739 JGI25158J39367_1000849 JGI25158J39367_10008494 134
102 3300002987 JGI25159J45721_1002252 JGI25159J45721_10022524 134
103 3300002987 JGI25159J45721_1005127 JGI25159J45721_10051273 134
104 3300003374 JGI25161J50226_1001368 JGI25161J50226_10013684 134
105 3300003771 Ga0055526_1000701 Ga0055526_10007015 134
106 3300003771 Ga0055526_1009920 Ga0055526_10099204 134
107 3300003773 Ga0055537_1000098 Ga0055537_10000985 134
108 3300003773 Ga0055537_1018367 Ga0055537_10183672 134
109 3300003784 Ga0055534_1000009 Ga0055534_1000009201 134
110 3300003790 Ga0055528_1002883 Ga0055528_10028835 134
111 3300003791 Ga0055530_10004725 Ga0055530_100047256 134
112 3300004625 Ga0055543_1000937 Ga0055543_10009374 134
113 3300004625 Ga0055543_1005125 Ga0055543_10051253 134
114 3300005262 Ga0065165_1000039 Ga0065165_10000395 134
115 3300005262 Ga0065165_1001831 Ga0065165_10018314 134
116 3300005331 Ga0070670_100152803 Ga0070670_1001528032 134
117 3300005335 Ga0070666_10229331 Ga0070666_102293311 134
118 3300005356 Ga0070674_100350810 Ga0070674_1003508101 134
119 3300005364 Ga0070673_100250059 Ga0070673_1002500592 134
120 3300005364 Ga0070673_101920545 Ga0070673_1019205451 134
121 3300005367 Ga0070667_100882611 Ga0070667_1008826112 134
122 3300005445 Ga0070708_100224355 Ga0070708_1002243552 134
123 3300005467 Ga0070706_100002804 Ga0070706_1000028042 134
124 3300005471 Ga0070698_100148021 Ga0070698_1001480214 134
125 3300005518 Ga0070699_100521671 Ga0070699_1005216712 134
126 3300005843 Ga0068860_100932693 Ga0068860_1009326932 134
127 3300005844 Ga0068862_100660690 Ga0068862_1006606902 134
128 3300006042 Ga0075368_10100635 Ga0075368_101006351 134
129 3300006048 Ga0075363_100091635 Ga0075363_1000916352 134
130 3300006178 Ga0075367_10042806 Ga0075367_100428062 134
131 3300006195 Ga0075366_10045818 Ga0075366_100458182 134
132 3300006195 Ga0075366_10424274 Ga0075366_104242742 134
133 3300006948 Ga0099826_10000001 Ga0099826_10000001645 134
134 3300009098 Ga0105245_10293476 Ga0105245_102934761 134
135 3300009553 Ga0105249_11448904 Ga0105249_114489041 134
136 3300014326 Ga0157380_10092448 Ga0157380_100924482 134
137 3300021361 Ga0213872_10159319 Ga0213872_101593191 134
138 3300025208 Ga0209436_100356 Ga0209436_1003564 134
139 3300025263 Ga0209565_1000015 Ga0209565_1000015477 134
140 3300025263 Ga0209565_1009801 Ga0209565_10098014 134
141 3300025263 Ga0209565_1026885 Ga0209565_10268851 134
142 3300025273 Ga0209673_1000017 Ga0209673_1000017368 134
143 3300025284 Ga0209130_1000856 Ga0209130_10008564 134
144 3300025284 Ga0209130_1003063 Ga0209130_10030636 134
145 3300025291 Ga0209675_1000012 Ga0209675_10000125 134
146 3300025291 Ga0209675_1011321 Ga0209675_10113212 134
147 3300025295 Ga0209564_1000016 Ga0209564_1000016118 134
148 3300025295 Ga0209564_1000184 Ga0209564_1000184138 134
149 3300025298 Ga0209050_1000159 Ga0209050_10001594 134
150 3300025299 Ga0209256_1000593 Ga0209256_100059345 134
151 3300025299 Ga0209256_1002373 Ga0209256_100237310 134
152 3300025931 Ga0207644_10260017 Ga0207644_102600173 134
153 3300025937 Ga0207669_10299889 Ga0207669_102998892 134
154 3300025960 Ga0207651_10066438 Ga0207651_100664383 134
155 3300025986 Ga0207658_10420006 Ga0207658_104200062 134
156 3300026121 Ga0207683_10482934 Ga0207683_104829342 134
157 3300028380 Ga0268265_11409811 Ga0268265_114098111 134
158 3300028794 Ga0307515_10009650 Ga0307515_1000965018 134
159 3300028794 Ga0307515_10047918 Ga0307515_100479182 134
160 3300031548 Ga0307408_100008913 Ga0307408_1000089134 134
161 3300031548 Ga0307408_100241638 Ga0307408_1002416382 134
162 3300031731 Ga0307405_10300659 Ga0307405_103006592 134
163 3300031838 Ga0307518_10027859 Ga0307518_100278593 134
164 3300031911 Ga0307412_10219382 Ga0307412_102193822 134
165 3300031911 Ga0307412_10947927 Ga0307412_109479273 134
166 3300031995 Ga0307409_100096634 Ga0307409_1000966341 134
167 3300032002 Ga0307416_101069582 Ga0307416_1010695821 134
168 3300037471 Ga0395905_1415858 Ga0395905_1415858_14_418 134
169 3300041451 Ga0451791_0553318 Ga0451791_0553318_461_865 134
170 3300041456 Ga0451795_0077431 Ga0451795_0077431_169_573 134
171 3300041509 Ga0451843_1527536 Ga0451843_1527536_146_550 134
172 3300045051 Ga0451576_0580089 Ga0451576_0580089_383_859 134
173 3300046460 Ga0495638_0020157 Ga0495638_0020157_1602_2006 134
174 3300046460 Ga0495638_0035461 Ga0495638_0035461_1952_2356 134
175 3300046474 Ga0495605_0001803 Ga0495605_0001803_2616_3020 134
176 3300046491 Ga0495584_0476333 Ga0495584_0476333_214_618 134
177 3300046492 Ga0495585_0025717 Ga0495585_0025717_1657_2061 134
178 3300046492 Ga0495585_0043427 Ga0495585_0043427_1932_2336 134
179 3300046501 Ga0495607_0011511 Ga0495607_0011511_3759_4163 134
180 3300046501 Ga0495607_0055149 Ga0495607_0055149_694_1098 134
181 3300046501 Ga0495607_0057189 Ga0495607_0057189_125_529 134
182 3300046501 Ga0495607_0097245 Ga0495607_0097245_1073_1477 134
183 3300046506 Ga0495583_0000402 Ga0495583_0000402_53664_54068 134
184 3300046506 Ga0495583_0055480 Ga0495583_0055480_929_1333 134
185 3300046512 Ga0495610_0031809 Ga0495610_0031809_212_616 134
186 3300046513 Ga0495616_0028955 Ga0495616_0028955_418_822 134
187 3300046519 Ga0495632_0031577 Ga0495632_0031577_1271_1675 134
188 3300046519 Ga0495632_0296325 Ga0495632_0296325_108_512 134
189 3300046522 Ga0495643_0035764 Ga0495643_0035764_159_563 134
190 3300046522 Ga0495643_0078801 Ga0495643_0078801_484_888 134
191 3300046522 Ga0495643_0106235 Ga0495643_0106235_235_639 134
192 3300046523 Ga0495644_0010960 Ga0495644_0010960_1727_2131 134
193 3300046523 Ga0495644_0011721 Ga0495644_0011721_1607_2011 134
194 3300046524 Ga0495648_0011178 Ga0495648_0011178_2068_2472 134
195 3300046528 Ga0495642_0033969 Ga0495642_0033969_1156_1560 134
196 3300046538 Ga0495609_0002163 Ga0495609_0002163_2596_3000 134
197 3300046538 Ga0495609_0117618 Ga0495609_0117618_285_689 134
198 3300046557 Ga0495622_0033655 Ga0495622_0033655_1941_2345 134
199 3300046615 Ga0495656_0025802 Ga0495656_0025802_1513_1917 134
200 3300046616 Ga0495668_0004419 Ga0495668_0004419_5939_6343 134
201 3300046616 Ga0495668_0046583 Ga0495668_0046583_458_862 134
202 3300046648 Ga0495611_0009509 Ga0495611_0009509_1607_2011 134
203 3300046648 Ga0495611_0011245 Ga0495611_0011245_2087_2491 134
204 3300046660 Ga0495625_0027536 Ga0495625_0027536_1365_1769 134
205 3300046660 Ga0495625_0251668 Ga0495625_0251668_452_856 134
206 3300046660 Ga0495625_0482009 Ga0495625_0482009_107_511 134
207 3300046664 Ga0495659_0004046 Ga0495659_0004046_3464_3868 134
208 3300046664 Ga0495659_0023754 Ga0495659_0023754_522_926 134
209 3300046664 Ga0495659_0353202 Ga0495659_0353202_23_427 134
210 3300046665 Ga0495661_0068748 Ga0495661_0068748_438_842 134
211 3300046665 Ga0495661_0275179 Ga0495661_0275179_23_427 134
212 3300046684 Ga0495669_0033063 Ga0495669_0033063_857_1261 134
213 3300046691 Ga0495670_0643212 Ga0495670_0643212_105_509 134
214 3300046692 Ga0495671_0009254 Ga0495671_0009254_2850_3254 134
215 3300046692 Ga0495671_0079306 Ga0495671_0079306_28_432 134
216 3300046692 Ga0495671_0107111 Ga0495671_0107111_743_1147 134
217 3300046694 Ga0495649_0035065 Ga0495649_0035065_2107_2511 134
218 3300046694 Ga0495649_0066945 Ga0495649_0066945_1319_1723 134
219 3300046794 Ga0495589_0311495 Ga0495589_0311495_45_449 134
220 3300046810 Ga0495660_0001221 Ga0495660_0001221_3261_3665 134
221 3300046810 Ga0495660_0078661 Ga0495660_0078661_338_742 134
222 3300047318 Ga0495636_0000873 Ga0495636_0000873_2099_2503 134
223 3300047318 Ga0495636_0049191 Ga0495636_0049191_1104_1508 134
224 3300047320 Ga0495672_0021391 Ga0495672_0021391_116_520 134
225 3300047323 Ga0495683_0003822 Ga0495683_0003822_1785_2189 134
226 3300047443 Ga0495687_000568 Ga0495687_000568_22262_22666 134
227 3300047443 Ga0495687_266690 Ga0495687_266690_75_479 134
228 3300047445 Ga0495677_0005658 Ga0495677_0005658_846_1250 134
229 3300047445 Ga0495677_0013686 Ga0495677_0013686_1897_2301 134
230 3300047445 Ga0495677_0019264 Ga0495677_0019264_240_644 134
231 3300047446 Ga0495679_030400 Ga0495679_030400_942_1346 134
232 3300047447 Ga0495685_000422 Ga0495685_000422_847_1251 134
233 3300047447 Ga0495685_064593 Ga0495685_064593_330_734 134
234 3300047469 Ga0495673_0042044 Ga0495673_0042044_470_874 134
235 3300047470 Ga0495681_0011152 Ga0495681_0011152_3759_4163 134
236 3300047472 Ga0495686_0002781 Ga0495686_0002781_12928_13332 134
237 3300047472 Ga0495686_0005058 Ga0495686_0005058_4146_4550 134
238 3300047472 Ga0495686_0257080 Ga0495686_0257080_289_693 134
239 3300048927 Ga0496124_0193265 Ga0496124_0193265_600_1004 134
240 3300049459 Ga0495678_004834 Ga0495678_004834_1232_1636 134
241 3300049459 Ga0495678_156059 Ga0495678_156059_303_707 134
242 3300049460 Ga0495682_0000813 Ga0495682_0000813_17916_18320 134
243 3300049460 Ga0495682_0004113 Ga0495682_0004113_4546_4950 134
244 3300049667 Ga0501230_152695 Ga0501230_152695_25_429 134
245 3300050493 nmdc:mga0k408_418719_c1 nmdc:mga0k408_418719_c1_43_447 134
246 3300050494 nmdc:mga06z11_447065_c1 nmdc:mga06z11_447065_c1_124_528 134
247 3300050495 nmdc:mga04h51_30130_c1 nmdc:mga04h51_30130_c1_84_488 134
248 3300050496 nmdc:mga07m45_326056_c1 nmdc:mga07m45_326056_c1_156_560 134
249 3300053739 Ga0500587_005069 Ga0500587_005069_210_614 134
250 3300002704 JGI25155J39150_1000460 JGI25155J39150_10004602 135
251 3300002705 JGI25156J39149_1000171 JGI25156J39149_10001712 135
252 3300002705 JGI25156J39149_1002671 JGI25156J39149_10026717 135
253 3300002737 JGI25162J39368_1002885 JGI25162J39368_10028855 135
254 3300002738 JGI25154J39366_1000113 JGI25154J39366_10001132 135
255 3300002738 JGI25154J39366_1000491 JGI25154J39366_10004913 135
256 3300002741 JGI25157J39369_1001212 JGI25157J39369_100121210 135
257 3300002741 JGI25157J39369_1001744 JGI25157J39369_10017445 135
258 3300003758 Ga0055532_1000017 Ga0055532_100001773 135
259 3300005328 Ga0070676_10160105 Ga0070676_101601052 135
260 3300005331 Ga0070670_100277536 Ga0070670_1002775363 135
261 3300005331 Ga0070670_100733322 Ga0070670_1007333222 135
262 3300005367 Ga0070667_100007516 Ga0070667_1000075164 135
263 3300005459 Ga0068867_100000048 Ga0068867_10000004868 135
264 3300005530 Ga0070679_101158062 Ga0070679_1011580621 135
265 3300005563 Ga0068855_101179306 Ga0068855_1011793062 135
266 3300005577 Ga0068857_101174688 Ga0068857_1011746881 135
267 3300005614 Ga0068856_100183327 Ga0068856_1001833272 135
268 3300005616 Ga0068852_100005208 Ga0068852_1000052085 135
269 3300005616 Ga0068852_101563561 Ga0068852_1015635611 135
270 3300005834 Ga0068851_10109548 Ga0068851_101095483 135
271 3300005843 Ga0068860_100969328 Ga0068860_1009693282 135
272 3300006195 Ga0075366_10007387 Ga0075366_100073873 135
273 3300006195 Ga0075366_10123934 Ga0075366_101239341 135
274 3300006353 Ga0075370_10230797 Ga0075370_102307972 135
275 3300009147 Ga0114129_11702568 Ga0114129_117025681 135
276 3300009148 Ga0105243_10004483 Ga0105243_1000448312 135
277 3300009551 Ga0105238_10025602 Ga0105238_100256022 135
278 3300010375 Ga0105239_10281595 Ga0105239_102815952 135
279 3300013100 Ga0157373_10026629 Ga0157373_100266292 135
280 3300013308 Ga0157375_10217256 Ga0157375_102172562 135
281 3300014497 Ga0182008_10022755 Ga0182008_100227551 135
282 3300014745 Ga0157377_10000056 Ga0157377_1000005614 135
283 3300014968 Ga0157379_10011722 Ga0157379_100117222 135
284 3300014968 Ga0157379_12197999 Ga0157379_121979991 135
285 3300015261 Ga0182006_1033321 Ga0182006_10333213 135
286 3300015261 Ga0182006_1036236 Ga0182006_10362362 135
287 3300021361 Ga0213872_10000003 Ga0213872_10000003328 135
288 3300025206 Ga0209435_100015 Ga0209435_10001586 135
289 3300025206 Ga0209435_100128 Ga0209435_10012829 135
290 3300025229 Ga0209147_100004 Ga0209147_1000041140 135
291 3300025233 Ga0209437_100329 Ga0209437_10032919 135
292 3300025246 Ga0209646_1000020 Ga0209646_100002068 135
293 3300025246 Ga0209646_1000040 Ga0209646_1000040116 135
294 3300025250 Ga0209026_1000034 Ga0209026_1000034203 135
295 3300025250 Ga0209026_1004287 Ga0209026_10042874 135
296 3300025254 Ga0209148_1026781 Ga0209148_10267811 135
297 3300025256 Ga0209759_1000234 Ga0209759_100023474 135
298 3300025256 Ga0209759_1012474 Ga0209759_10124742 135
299 3300025261 Ga0209233_1036519 Ga0209233_10365192 135
300 3300025272 Ga0209455_1003140 Ga0209455_10031403 135
301 3300025924 Ga0207694_10117402 Ga0207694_101174022 135
302 3300025925 Ga0207650_10169806 Ga0207650_101698063 135
303 3300025935 Ga0207709_10002411 Ga0207709_100024113 135
304 3300025949 Ga0207667_10977044 Ga0207667_109770441 135
305 3300025972 Ga0207668_10311500 Ga0207668_103115002 135
306 3300025986 Ga0207658_10113168 Ga0207658_101131682 135
307 3300026089 Ga0207648_10001142 Ga0207648_100011422 135
308 3300026142 Ga0207698_10062775 Ga0207698_100627753 135
309 3300028381 Ga0268264_10773143 Ga0268264_107731431 135
310 3300028794 Ga0307515_10063494 Ga0307515_100634943 135
311 3300030522 Ga0307512_10004318 Ga0307512_1000431811 135
312 3300031456 Ga0307513_10007743 Ga0307513_1000774311 135
313 3300031456 Ga0307513_10044451 Ga0307513_100444512 135
314 3300031456 Ga0307513_10065484 Ga0307513_100654843 135
315 3300031456 Ga0307513_10246198 Ga0307513_102461982 135
316 3300031507 Ga0307509_10121303 Ga0307509_101213032 135
317 3300031507 Ga0307509_10305270 Ga0307509_103052702 135
318 3300031548 Ga0307408_100000294 Ga0307408_10000029410 135
319 3300031548 Ga0307408_100070381 Ga0307408_1000703813 135
320 3300031548 Ga0307408_101744888 Ga0307408_1017448881 135
321 3300031649 Ga0307514_10096746 Ga0307514_100967462 135
322 3300031730 Ga0307516_10011091 Ga0307516_100110917 135
323 3300031730 Ga0307516_10069359 Ga0307516_100693592 135
324 3300031824 Ga0307413_10524134 Ga0307413_105241342 135
325 3300031911 Ga0307412_10451321 Ga0307412_104513212 135
326 3300033179 Ga0307507_10306300 Ga0307507_103063002 135
327 3300033180 Ga0307510_10005180 Ga0307510_100051804 135
328 3300033180 Ga0307510_10046415 Ga0307510_100464153 135
329 3300033180 Ga0307510_10071904 Ga0307510_100719042 135
330 3300035170 Ga0373943_0582551 Ga0373943_0582551_239_646 135
331 3300037068 Ga0373925_0028877 Ga0373925_0028877_2010_2417 135
332 3300037418 Ga0395900_0524070 Ga0395900_0524070_347_754 135
333 3300037471 Ga0395905_0002485 Ga0395905_0002485_5361_5768 135
334 3300038443 Ga0395901_0442005 Ga0395901_0442005_275_682 135
335 3300038443 Ga0395901_0792154 Ga0395901_0792154_463_870 135
336 3300039447 Ga0436361_0003822 Ga0436361_0003822_26773_27180 135
337 3300041413 Ga0439465_0088784 Ga0439465_0088784_591_998 135
338 3300041999 Ga0439433_0117389 Ga0439433_0117389_205_612 135
339 3300042004 Ga0439445_0038824 Ga0439445_0038824_35_442 135
340 3300042007 Ga0439449_0007042 Ga0439449_0007042_2700_3107 135
341 3300042126 Ga0450888_008812 Ga0450888_008812_631_1038 135
342 3300042134 Ga0450898_022357 Ga0450898_022357_139_546 135
343 3300042145 Ga0450906_023569 Ga0450906_023569_579_986 135
344 3300042156 Ga0439446_0028707 Ga0439446_0028707_56_463 135
345 3300042435 Ga0439434_0020575 Ga0439434_0020575_173_580 135
346 3300042876 Ga0451577_0221191 Ga0451577_0221191_887_1294 135
347 3300044658 Ga0466972_0000154 Ga0466972_0000154_54459_54866 135
348 3300044673 Ga0453683_0014003 Ga0453683_0014003_2963_3370 135
349 3300044706 Ga0466964_0478057 Ga0466964_0478057_93_500 135
350 3300044712 Ga0453684_0234526 Ga0453684_0234526_270_677 135
351 3300045051 Ga0451576_0021797 Ga0451576_0021797_4781_5188 135
352 3300045051 Ga0451576_0230929 Ga0451576_0230929_357_764 135
353 3300045051 Ga0451576_0253694 Ga0451576_0253694_888_1295 135
354 3300046454 Ga0495592_0001081 Ga0495592_0001081_2329_2736 135
355 3300046461 Ga0495641_0184313 Ga0495641_0184313_106_513 135
356 3300046474 Ga0495605_0252462 Ga0495605_0252462_306_713 135
357 3300046492 Ga0495585_0001355 Ga0495585_0001355_18323_18733 135
358 3300046499 Ga0495594_0008543 Ga0495594_0008543_3057_3467 135
359 3300046500 Ga0495596_0006124 Ga0495596_0006124_1513_1923 135
360 3300046506 Ga0495583_0000235 Ga0495583_0000235_74532_74939 135
361 3300046506 Ga0495583_0003535 Ga0495583_0003535_1747_2154 135
362 3300046506 Ga0495583_0059945 Ga0495583_0059945_167_574 135
363 3300046506 Ga0495583_0087304 Ga0495583_0087304_322_729 135
364 3300046507 Ga0495606_0503234 Ga0495606_0503234_178_585 135
365 3300046513 Ga0495616_0004761 Ga0495616_0004761_5882_6295 135
366 3300046519 Ga0495632_0271925 Ga0495632_0271925_93_500 135
367 3300046522 Ga0495643_0000922 Ga0495643_0000922_3943_4350 135
368 3300046524 Ga0495648_0034943 Ga0495648_0034943_1367_1774 135
369 3300046524 Ga0495648_0080786 Ga0495648_0080786_949_1356 135
370 3300046538 Ga0495609_0028723 Ga0495609_0028723_1833_2240 135
371 3300046558 Ga0495633_0409036 Ga0495633_0409036_141_551 135
372 3300046615 Ga0495656_0025242 Ga0495656_0025242_509_916 135
373 3300046648 Ga0495611_0054112 Ga0495611_0054112_1250_1660 135
374 3300046660 Ga0495625_0057050 Ga0495625_0057050_2155_2562 135
375 3300046665 Ga0495661_0088571 Ga0495661_0088571_895_1302 135
376 3300046665 Ga0495661_0234554 Ga0495661_0234554_452_862 135
377 3300046680 Ga0495646_0275481 Ga0495646_0275481_416_823 135
378 3300046684 Ga0495669_0019562 Ga0495669_0019562_432_842 135
379 3300046810 Ga0495660_0146492 Ga0495660_0146492_239_646 135
380 3300047318 Ga0495636_0231527 Ga0495636_0231527_255_662 135
381 3300047447 Ga0495685_207961 Ga0495685_207961_104_514 135
382 3300047472 Ga0495686_0212741 Ga0495686_0212741_451_858 135
383 3300048091 Ga0495626_0009700 Ga0495626_0009700_3038_3448 135
384 3300048091 Ga0495626_0264107 Ga0495626_0264107_18_425 135
385 3300048908 Ga0496105_0550377 Ga0496105_0550377_327_734 135
386 3300048912 Ga0496109_0344170 Ga0496109_0344170_720_1127 135
387 3300048913 Ga0496110_0911631 Ga0496110_0911631_309_716 135
388 3300048919 Ga0496116_0028074 Ga0496116_0028074_836_1243 135
389 3300048920 Ga0496117_0146204 Ga0496117_0146204_790_1197 135
390 3300048924 Ga0496121_0069439 Ga0496121_0069439_1889_2296 135
391 3300048924 Ga0496121_0247019 Ga0496121_0247019_761_1168 135
392 3300048925 Ga0496122_0000743 Ga0496122_0000743_59421_59828 135
393 3300048926 Ga0496123_0000582 Ga0496123_0000582_59520_59927 135
394 3300048926 Ga0496123_0334455 Ga0496123_0334455_287_694 135
395 3300048928 Ga0496125_0002847 Ga0496125_0002847_20518_20925 135
396 3300048928 Ga0496125_0025990 Ga0496125_0025990_171_578 135
397 3300049541 Ga0501325_015415 Ga0501325_015415_146_553 135
398 3300049670 Ga0501236_110625 Ga0501236_110625_11_418 135
399 3300049763 Ga0501266_001619 Ga0501266_001619_1556_1963 135
400 3300050493 nmdc:mga0k408_11995_c1 nmdc:mga0k408_11995_c1_3118_3525 135
401 3300050496 nmdc:mga07m45_237773_c1 nmdc:mga07m45_237773_c1_303_710 135
402 3300050507 nmdc:mga05p37_1237951_c1 nmdc:mga05p37_1237951_c1_290_697 135
403 3300053093 Ga0500651_0280319 Ga0500651_0280319_180_587 135
404 3300053117 Ga0500593_000933 Ga0500593_000933_8611_9018 135
405 3300053118 Ga0500594_0013317 Ga0500594_0013317_797_1204 135
406 3300053136 Ga0500559_0000059 Ga0500559_0000059_59950_60357 135
407 3300053136 Ga0500559_0153031 Ga0500559_0153031_297_704 135
408 3300053139 Ga0500568_0159557 Ga0500568_0159557_149_556 135
409 3300053156 Ga0500622_0001424 Ga0500622_0001424_4080_4487 135
410 3300053177 Ga0500636_0334605 Ga0500636_0334605_261_668 135
411 3300053730 Ga0500645_066187 Ga0500645_066187_130_537 135
412 3300053739 Ga0500587_005415 Ga0500587_005415_310_717 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

31

155

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bws-assembly1.cif.gz_B-2 crystal structure of efga from methylobacterium extorquens 0.9088 5 132
3fpv-assembly1.cif.gz_C crystal structure of hbps 0.8895 1 135
5cx7-assembly1.cif.gz_B crystal structure of pduoc:heme complex 0.8889 5 132
4bmw-assembly1.cif.gz_A crystal structure of the streptomyces reticuli hbps e78d, e81d double mutant 0.8883 1 135
2a2l-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae protein orfy, pfam duf336 0.8879 1 134
ID Description Score Start End Superfamily
af_P0AEQ1_1_133_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9213 1 133 3.30.450.150
af_P0AEQ1_1_133_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9081 1 133 3.30.450.150
6c0zB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9048 5 132 3.30.450.150
3fpvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9016 8 135 3.30.450.150
3fpvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.8949 8 135 3.30.450.150
ID Description Score Start End GO Terms
AF-I4N9W2-F1-model_v4 GlcG protein 0.936 2 134
AF-A0A7X0PKV8-F1-model_v4 Uncharacterized protein GlcG (DUF336 family) 0.9353 1 133
AF-A0A496WZ94-F1-model_v4 Heme-binding protein 0.934 1 135
AF-A0A6G6Y1Y7-F1-model_v4 Heme-binding protein 0.934 1 132
AF-A0A2C9D460-F1-model_v4 GlcG protein 0.9317 1 135

Feature Viewer

pLDDT pTM Quality
85.06 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map