F437894

General Info

Members Datasets Scaffolds Average Seq Length
412 233 824 171

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0248037|Ga0495645_0248037_617_1174
Length 185
Sequence VTSSNKSERGRLEITRAPLVGLYPGTFDPATLGHLDIIKRAVKLVDHLVIGVATNASKSPLFTLDERMEIMHHEAEKMAEGRATIEVLPVSEVLMVDFAKSIGATVVIRGLRAVSDFEYEFQMAAMNQRLNMEIETVVLMADPRMQAIASKLVKEIAILGGDVKPFTSPYVAERLSKRAKEQANR

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
223 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 0
Rhizoplane 0.73
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0248037 3300046543 Bacteria 1185
2 JGI25165J46597_1000013 3300003214 Bacteria 402100
3 JGI25153J46596_10003018 3300003215 Bacteria 9527
4 Ga0070658_10042656 3300005327 Bacteria 3664
5 Ga0070658_10051759 3300005327 Bacteria 3328
6 Ga0070658_10240932 3300005327 Bacteria 1533
7 Ga0070683_100113131 3300005329 Bacteria 2561
8 Ga0070690_100254800 3300005330 Bacteria 1243
9 Ga0070666_10125769 3300005335 Bacteria 1780
10 Ga0070666_10148892 3300005335 Bacteria 1633
11 Ga0070680_100723335 3300005336 Bacteria 857
12 Ga0070682_100768151 3300005337 Bacteria 780
13 Ga0068868_100020987 3300005338 Bacteria 4918
14 Ga0068868_101001213 3300005338 Bacteria 764
15 Ga0070660_100308699 3300005339 Bacteria 1298
16 Ga0070661_100003375 3300005344 Bacteria 11008
17 Ga0070661_100242047 3300005344 Bacteria 1390
18 Ga0070668_100226279 3300005347 Bacteria 1545
19 Ga0070675_100721391 3300005354 Bacteria 909
20 Ga0070671_100182508 3300005355 Bacteria 1777
21 Ga0070674_100196003 3300005356 Bacteria 1556
22 Ga0070674_100691522 3300005356 Bacteria 871
23 Ga0070659_100199772 3300005366 Bacteria 1645
24 Ga0070667_100030043 3300005367 Bacteria 4532
25 Ga0070667_101118043 3300005367 Bacteria 737
26 Ga0070667_101431068 3300005367 Bacteria 648
27 Ga0070714_100241269 3300005435 Bacteria 1668
28 Ga0070714_101350416 3300005435 Bacteria 696
29 Ga0070710_10636233 3300005437 Bacteria 746
30 Ga0070711_100132904 3300005439 Bacteria 1856
31 Ga0070681_10893696 3300005458 Bacteria 807
32 Ga0070681_11465611 3300005458 Bacteria 607
33 Ga0070679_100108925 3300005530 Bacteria 2756
34 Ga0070684_100025863 3300005535 Bacteria 4938
35 Ga0068853_100151736 3300005539 Bacteria 2086
36 Ga0068853_100194499 3300005539 Bacteria 1844
37 Ga0070665_100014524 3300005548 Bacteria 7900
38 Ga0070665_100180637 3300005548 Bacteria 2111
39 Ga0070665_100317342 3300005548 Bacteria 1562
40 Ga0070665_100745398 3300005548 Bacteria 992
41 Ga0068855_100062730 3300005563 Bacteria 4338
42 Ga0068855_100100880 3300005563 Bacteria 3323
43 Ga0068855_100308437 3300005563 Bacteria 1751
44 Ga0068857_100026423 3300005577 Bacteria 5117
45 Ga0068857_100324696 3300005577 Bacteria 1422
46 Ga0068856_100415548 3300005614 Bacteria 1365
47 Ga0068856_100785812 3300005614 Bacteria 972
48 Ga0068856_100879184 3300005614 Bacteria 915
49 Ga0068859_101283338 3300005617 Bacteria 807
50 Ga0068864_100097024 3300005618 Bacteria 2609
51 Ga0068864_102034940 3300005618 Bacteria 580
52 Ga0068861_100043871 3300005719 Bacteria 3360
53 Ga0068863_100037524 3300005841 Bacteria 4613
54 Ga0068858_100092535 3300005842 Bacteria 2815
55 Ga0068858_100126240 3300005842 Bacteria 2396
56 Ga0068860_100007909 3300005843 Bacteria 10615
57 Ga0068862_100052027 3300005844 Bacteria 3503
58 Ga0068862_101242549 3300005844 Bacteria 745
59 Ga0075365_10013719 3300006038 Bacteria 4859
60 Ga0075365_10075103 3300006038 Bacteria 2280
61 Ga0075368_10000440 3300006042 Bacteria 12241
62 Ga0075363_100000965 3300006048 Bacteria 10222
63 Ga0075364_10001672 3300006051 Bacteria 12176
64 Ga0070716_100840698 3300006173 Bacteria 714
65 Ga0075362_10000905 3300006177 Bacteria 8980
66 Ga0075367_10005181 3300006178 Bacteria 6443
67 Ga0075369_10003725 3300006186 Bacteria 5577
68 Ga0075366_10000526 3300006195 Bacteria 17747
69 Ga0097621_100000004 3300006237 Bacteria 144414
70 Ga0097621_100050804 3300006237 Bacteria 3373
71 Ga0097621_100054697 3300006237 Bacteria 3256
72 Ga0097621_100106936 3300006237 Bacteria 2360
73 Ga0097621_100768744 3300006237 Bacteria 891
74 Ga0075370_10009230 3300006353 Bacteria 5111
75 Ga0068871_100000028 3300006358 Bacteria 78414
76 Ga0068871_100039943 3300006358 Bacteria 3757
77 Ga0068871_100051672 3300006358 Bacteria 3328
78 Ga0068871_100058907 3300006358 Bacteria 3128
79 Ga0068871_100209463 3300006358 Bacteria 1686
80 Ga0068871_100994823 3300006358 Bacteria 781
81 Ga0068871_101381821 3300006358 Bacteria 663
82 Ga0068865_100004725 3300006881 Bacteria 8224
83 Ga0097620_101283560 3300006931 Bacteria 807
84 Ga0105240_10012030 3300009093 Bacteria 11996
85 Ga0105240_10688043 3300009093 Bacteria 1117
86 Ga0105240_11295699 3300009093 Bacteria 769
87 Ga0105240_11770644 3300009093 Bacteria 644
88 Ga0111539_10191349 3300009094 Bacteria 2387
89 Ga0105245_11176369 3300009098 Bacteria 814
90 Ga0105245_11202249 3300009098 Bacteria 806
91 Ga0105243_10561668 3300009148 Bacteria 1092
92 Ga0105241_10044486 3300009174 Bacteria 3365
93 Ga0105241_10130822 3300009174 Bacteria 2032
94 Ga0105241_10353971 3300009174 Bacteria 1276
95 Ga0105242_10010671 3300009176 Bacteria 7050
96 Ga0105242_10058055 3300009176 Bacteria 3171
97 Ga0105242_11052766 3300009176 Bacteria 825
98 Ga0105248_10024136 3300009177 Bacteria 6758
99 Ga0105248_10598479 3300009177 Bacteria 1244
100 Ga0105248_11347772 3300009177 Bacteria 807
101 Ga0105248_12244001 3300009177 Bacteria 621
102 Ga0105237_10068601 3300009545 Bacteria 3539
103 Ga0105237_10212456 3300009545 Bacteria 1934
104 Ga0105237_10533353 3300009545 Bacteria 1180
105 Ga0105237_11241600 3300009545 Bacteria 752
106 Ga0105238_10088964 3300009551 Bacteria 3075
107 Ga0105238_10247120 3300009551 Bacteria 1762
108 Ga0105238_10776911 3300009551 Bacteria 973
109 Ga0105238_10812232 3300009551 Bacteria 951
110 Ga0105238_11422515 3300009551 Bacteria 721
111 Ga0105249_10400158 3300009553 Bacteria 1403
112 Ga0099796_10018756 3300010159 Bacteria 2084
113 Ga0105239_10266624 3300010375 Bacteria 1925
114 Ga0105239_10503914 3300010375 Bacteria 1376
115 Ga0105239_11114824 3300010375 Bacteria 908
116 Ga0105239_11901294 3300010375 Bacteria 690
117 Ga0105239_12135166 3300010375 Bacteria 651
118 Ga0105246_10593327 3300011119 Bacteria 956
119 Ga0157373_10708270 3300013100 Bacteria 738
120 Ga0157371_10506743 3300013102 Bacteria 892
121 Ga0157369_10307772 3300013105 Bacteria 1648
122 Ga0157374_11105176 3300013296 Bacteria 813
123 Ga0157378_10009866 3300013297 Bacteria 8321
124 Ga0157378_10664226 3300013297 Bacteria 1059
125 Ga0157378_10696576 3300013297 Bacteria 1035
126 Ga0157378_11761577 3300013297 Bacteria 667
127 Ga0163162_10928447 3300013306 Bacteria 982
128 Ga0163162_10989454 3300013306 Bacteria 951
129 Ga0163162_11037858 3300013306 Bacteria 928
130 Ga0157372_10003598 3300013307 Bacteria 16678
131 Ga0157372_10032901 3300013307 Bacteria 5690
132 Ga0157372_10046890 3300013307 Bacteria 4799
133 Ga0157372_10132231 3300013307 Bacteria 2872
134 Ga0157372_10357509 3300013307 Bacteria 1702
135 Ga0157372_12330939 3300013307 Unclassified 615
136 Ga0157375_10038943 3300013308 Bacteria 4569
137 Ga0157375_11236401 3300013308 Bacteria 877
138 Ga0163163_10000111 3300014325 Bacteria 86620
139 Ga0163163_10198702 3300014325 Bacteria 2053
140 Ga0163163_10698658 3300014325 Bacteria 1078
141 Ga0163163_11711168 3300014325 Bacteria 689
142 Ga0157380_10347511 3300014326 Bacteria 1386
143 Ga0157379_10000904 3300014968 Bacteria 24009
144 Ga0157376_10025599 3300014969 Bacteria 4650
145 Ga0157376_10413328 3300014969 Bacteria 1307
146 Ga0157376_10420045 3300014969 Bacteria 1297
147 Ga0157376_10511709 3300014969 Bacteria 1182
148 Ga0157376_11257713 3300014969 Bacteria 769
149 Ga0163161_10184912 3300017792 Bacteria 1599
150 Ga0213874_10007393 3300021377 Bacteria 2635
151 Ga0213876_10000225 3300021384 Bacteria 56051
152 Ga0213876_10001860 3300021384 Bacteria 12707
153 Ga0209233_1000013 3300025261 Bacteria 1013785
154 Ga0209233_1000964 3300025261 Bacteria 12429
155 Ga0209758_1000036 3300025297 Bacteria 441671
156 Ga0209758_1035611 3300025297 Bacteria 1959
157 Ga0207682_10281163 3300025893 Bacteria 778
158 Ga0207642_10129097 3300025899 Bacteria 1316
159 Ga0207680_10186325 3300025903 Bacteria 1406
160 Ga0207705_10028609 3300025909 Bacteria 3973
161 Ga0207705_10132281 3300025909 Bacteria 1857
162 Ga0207654_10002467 3300025911 Bacteria 9403
163 Ga0207707_11006322 3300025912 Bacteria 684
164 Ga0207695_10052612 3300025913 Bacteria 4264
165 Ga0207695_10053055 3300025913 Bacteria 4243
166 Ga0207695_10164623 3300025913 Bacteria 2147
167 Ga0207695_10282504 3300025913 Bacteria 1553
168 Ga0207671_10058895 3300025914 Bacteria 2848
169 Ga0207671_10363350 3300025914 Bacteria 1149
170 Ga0207657_10045311 3300025919 Bacteria 3861
171 Ga0207657_10110733 3300025919 Bacteria 2268
172 Ga0207649_10000073 3300025920 Bacteria 86636
173 Ga0207652_10104136 3300025921 Bacteria 2510
174 Ga0207652_10249463 3300025921 Bacteria 1601
175 Ga0207694_10149311 3300025924 Bacteria 1882
176 Ga0207694_10568488 3300025924 Bacteria 952
177 Ga0207694_10652967 3300025924 Bacteria 886
178 Ga0207694_10873713 3300025924 Bacteria 760
179 Ga0207650_10929218 3300025925 Bacteria 739
180 Ga0207659_10532636 3300025926 Bacteria 997
181 Ga0207687_10417885 3300025927 Bacteria 1106
182 Ga0207664_10204331 3300025929 Bacteria 1707
183 Ga0207664_10739535 3300025929 Bacteria 885
184 Ga0207644_10396162 3300025931 Bacteria 1128
185 Ga0207690_10076015 3300025932 Bacteria 2331
186 Ga0207706_10974168 3300025933 Bacteria 714
187 Ga0207686_10014940 3300025934 Bacteria 4333
188 Ga0207686_10015854 3300025934 Bacteria 4223
189 Ga0207686_10413273 3300025934 Bacteria 1030
190 Ga0207709_11190700 3300025935 Bacteria 628
191 Ga0207669_10294117 3300025937 Bacteria 1231
192 Ga0207704_10072895 3300025938 Bacteria 2185
193 Ga0207704_10139205 3300025938 Bacteria 1695
194 Ga0207691_10241027 3300025940 Bacteria 1563
195 Ga0207711_10046724 3300025941 Bacteria 3699
196 Ga0207711_10721432 3300025941 Bacteria 930
197 Ga0207689_10233103 3300025942 Bacteria 1521
198 Ga0207661_10443714 3300025944 Bacteria 1181
199 Ga0207679_10133854 3300025945 Bacteria 1993
200 Ga0207667_10138834 3300025949 Bacteria 2502
201 Ga0207667_10148405 3300025949 Bacteria 2414
202 Ga0207667_10370059 3300025949 Bacteria 1460
203 Ga0207651_10526933 3300025960 Bacteria 1025
204 Ga0207712_10816830 3300025961 Bacteria 820
205 Ga0207668_10102022 3300025972 Bacteria 2134
206 Ga0207668_11107731 3300025972 Bacteria 710
207 Ga0207658_10450449 3300025986 Bacteria 1139
208 Ga0207677_10394635 3300026023 Bacteria 1172
209 Ga0207703_10012145 3300026035 Bacteria 6712
210 Ga0207703_10188910 3300026035 Bacteria 1823
211 Ga0207639_10039705 3300026041 Bacteria 3508
212 Ga0207639_10456432 3300026041 Bacteria 1161
213 Ga0207639_10546747 3300026041 Bacteria 1063
214 Ga0207678_10248217 3300026067 Bacteria 1524
215 Ga0207702_10445162 3300026078 Bacteria 1256
216 Ga0207702_10770394 3300026078 Bacteria 950
217 Ga0207702_10809718 3300026078 Bacteria 926
218 Ga0207641_10010540 3300026088 Bacteria 7585
219 Ga0207641_11840447 3300026088 Bacteria 607
220 Ga0207676_10053359 3300026095 Bacteria 3164
221 Ga0207676_11145877 3300026095 Bacteria 770
222 Ga0207674_10040418 3300026116 Bacteria 4831
223 Ga0207674_10211073 3300026116 Bacteria 1890
224 Ga0207674_10276056 3300026116 Bacteria 1628
225 Ga0207683_10047741 3300026121 Bacteria 3749
226 Ga0209813_10000625 3300027866 Bacteria 8213
227 Ga0268266_10108213 3300028379 Bacteria 2459
228 Ga0268266_10156276 3300028379 Bacteria 2060
229 Ga0268265_10305547 3300028380 Bacteria 1434
230 Ga0268265_10335381 3300028380 Bacteria 1375
231 Ga0268265_10688174 3300028380 Bacteria 987
232 Ga0268264_10153274 3300028381 Bacteria 2068
233 Ga0265318_10043625 3300028577 Bacteria 1699
234 Ga0265338_10043723 3300028800 Bacteria 4149
235 Ga0265338_10095701 3300028800 Bacteria 2438
236 Ga0265330_10032648 3300031235 Bacteria 2332
237 Ga0265332_10025264 3300031238 Bacteria 2610
238 Ga0265332_10108831 3300031238 Bacteria 1168
239 Ga0265332_10141750 3300031238 Bacteria 1007
240 Ga0265328_10097955 3300031239 Bacteria 1085
241 Ga0265325_10004925 3300031241 Bacteria 8327
242 Ga0265325_10015770 3300031241 Bacteria 4240
243 Ga0265329_10023000 3300031242 Bacteria 2080
244 Ga0265340_10000021 3300031247 Bacteria 87640
245 Ga0265340_10003362 3300031247 Bacteria 9050
246 Ga0265340_10068658 3300031247 Bacteria 1683
247 Ga0265339_10009825 3300031249 Bacteria 5977
248 Ga0265339_10055770 3300031249 Bacteria 2142
249 Ga0265339_10089270 3300031249 Bacteria 1618
250 Ga0265339_10162401 3300031249 Bacteria 1123
251 Ga0265331_10000006 3300031250 Bacteria 418907
252 Ga0265331_10000823 3300031250 Bacteria 25431
253 Ga0265331_10189889 3300031250 Bacteria 927
254 Ga0265327_10000074 3300031251 Bacteria 214435
255 Ga0265327_10031062 3300031251 Bacteria 3008
256 Ga0265316_10002070 3300031344 Bacteria 21121
257 Ga0265316_10049639 3300031344 Bacteria 3304
258 Ga0265316_10050999 3300031344 Bacteria 3252
259 Ga0265316_10308281 3300031344 Bacteria 1152
260 Ga0265316_10380236 3300031344 Bacteria 1019
261 Ga0265313_10008006 3300031595 Bacteria 7093
262 Ga0265313_10063720 3300031595 Bacteria 1717
263 Ga0265313_10118864 3300031595 Bacteria 1154
264 Ga0265314_10000370 3300031711 Bacteria 61431
265 Ga0265314_10065200 3300031711 Bacteria 2461
266 Ga0265314_10076858 3300031711 Bacteria 2216
267 Ga0265314_10205980 3300031711 Bacteria 1159
268 Ga0265314_10209975 3300031711 Bacteria 1144
269 Ga0265342_10052161 3300031712 Bacteria 2438
270 Ga0265342_10228314 3300031712 Bacteria 1001
271 Ga0265342_10293623 3300031712 Bacteria 858
272 Ga0307516_10075012 3300031730 Bacteria 3237
273 Ga0307516_10086492 3300031730 Bacteria 2971
274 Ga0307507_10035940 3300033179 Bacteria 5076
275 Ga0373943_0014593 3300035170 Bacteria 3560
276 Ga0373946_0139774 3300035171 Bacteria 1121
277 Ga0373935_0009238 3300035692 Bacteria 5901
278 Ga0373947_0009411 3300035725 Bacteria 5613
279 Ga0373925_0002583 3300037068 Bacteria 14402
280 Ga0373925_0200239 3300037068 Bacteria 1588
281 Ga0395900_0820690 3300037418 Bacteria 857
282 Ga0395898_0178819 3300037466 Bacteria 2027
283 Ga0395901_1304928 3300038443 Bacteria 687
284 Ga0436365_0014930 3300039437 Bacteria 48249
285 Ga0436365_0992819 3300039437 Bacteria 772
286 Ga0436365_1698101 3300039437 Bacteria 2635
287 Ga0436365_1793593 3300039437 Bacteria 726
288 Ga0436361_1129526 3300039447 Bacteria 1029
289 Ga0436363_0026865 3300039450 Bacteria 582
290 Ga0436363_1287658 3300039450 Bacteria 1996
291 Ga0436362_1114918 3300039453 Bacteria 811
292 Ga0451793_0905697 3300041452 Bacteria 969
293 Ga0451802_2127313 3300041460 Bacteria 985
294 Ga0466967_0623967 3300045976 Bacteria 1065
295 Ga0495617_133260 3300046452 Bacteria 796
296 Ga0495592_0188789 3300046454 Bacteria 1398
297 Ga0495650_0055472 3300046471 Bacteria 1612
298 Ga0495580_0003681 3300046472 Bacteria 13002
299 Ga0495639_0194789 3300046475 Bacteria 990
300 Ga0495585_0155984 3300046492 Bacteria 1188
301 Ga0495618_0784459 3300046514 Bacteria 556
302 Ga0495648_0295686 3300046524 Bacteria 761
303 Ga0495665_0153390 3300046531 Bacteria 1202
304 Ga0495609_0007772 3300046538 Bacteria 5314
305 Ga0495621_0013772 3300046539 Bacteria 2547
306 Ga0495622_0011212 3300046557 Bacteria 4138
307 Ga0495656_0066625 3300046615 Bacteria 1587
308 Ga0495657_0143026 3300046675 Bacteria 1490
309 Ga0495658_0006807 3300046683 Bacteria 5627
310 Ga0495658_0130522 3300046683 Bacteria 1529
311 Ga0495649_0042200 3300046694 Bacteria 2493
312 Ga0495589_0132521 3300046794 Bacteria 1196
313 Ga0495600_0242670 3300046809 Bacteria 1148
314 Ga0495636_0018305 3300047318 Bacteria 2810
315 Ga0495674_0557773 3300047319 Bacteria 911
316 Ga0495683_0168356 3300047323 Bacteria 1009
317 Ga0495602_0275398 3300048088 Bacteria 1242
318 Ga0496100_0570477 3300048903 Bacteria 877
319 Ga0496121_0002103 3300048924 Bacteria 31338
320 Ga0501031_0020259 3300049568 Bacteria 4336
321 Ga0501031_0790913 3300049568 Bacteria 608
322 Ga0501032_0010031 3300049569 Bacteria 6838
323 Ga0501032_0114470 3300049569 Bacteria 1784
324 Ga0501033_0005872 3300049570 Bacteria 9648
325 Ga0501033_0025987 3300049570 Bacteria 4406
326 Ga0501033_0086134 3300049570 Bacteria 2300
327 Ga0501033_0359283 3300049570 Bacteria 1019
328 Ga0501034_0091345 3300049571 Bacteria 3042
329 Ga0501034_0856060 3300049571 Bacteria 799
330 Ga0501034_1212180 3300049571 Bacteria 633
331 Ga0501036_0019828 3300049572 Bacteria 5646
332 Ga0501036_0193741 3300049572 Bacteria 1710
333 Ga0501036_0661431 3300049572 Bacteria 864
334 Ga0501037_0019421 3300049573 Bacteria 5012
335 Ga0501037_0027488 3300049573 Bacteria 4203
336 Ga0501037_0420433 3300049573 Bacteria 915
337 Ga0501037_0562427 3300049573 Bacteria 769
338 Ga0501038_0018768 3300049574 Bacteria 6243
339 Ga0501038_0037225 3300049574 Bacteria 4267
340 Ga0501038_0226698 3300049574 Bacteria 1489
341 Ga0501038_0348650 3300049574 Bacteria 1153
342 Ga0501038_0862456 3300049574 Bacteria 670
343 Ga0501039_0034845 3300049575 Bacteria 3884
344 Ga0501043_0005813 3300049579 Bacteria 9923
345 Ga0501043_0027261 3300049579 Bacteria 4486
346 Ga0501043_0151476 3300049579 Bacteria 1815
347 Ga0501046_0002196 3300049580 Bacteria 18436
348 Ga0501046_0066667 3300049580 Bacteria 2805
349 Ga0501046_0068504 3300049580 Bacteria 2762
350 Ga0501046_0272575 3300049580 Bacteria 1241
351 Ga0501046_0372038 3300049580 Bacteria 1035
352 Ga0501047_0054734 3300049581 Bacteria 3859
353 Ga0501047_0135343 3300049581 Bacteria 2344
354 Ga0501047_0180256 3300049581 Bacteria 1979
355 Ga0501048_0001595 3300049582 Bacteria 17213
356 Ga0501067_0002120 3300049583 Bacteria 10922
357 Ga0501068_0033835 3300049584 Bacteria 3046
358 Ga0501069_0005271 3300049585 Bacteria 6717
359 Ga0501070_0007693 3300049586 Bacteria 9139
360 Ga0501072_0023730 3300049588 Bacteria 4765
361 Ga0501073_0041007 3300049589 Bacteria 3272
362 Ga0501073_0185959 3300049589 Bacteria 1438
363 Ga0501073_0486902 3300049589 Bacteria 853
364 Ga0501074_0006923 3300049590 Bacteria 8185
365 Ga0501076_0140467 3300049592 Bacteria 1962
366 Ga0501079_0017694 3300049741 Bacteria 5444
367 Ga0501080_0063730 3300049742 Bacteria 3429
368 Ga0501080_0220922 3300049742 Bacteria 1734
369 Ga0501080_0289771 3300049742 Bacteria 1486
370 Ga0501080_0638584 3300049742 Bacteria 943
371 Ga0501083_0012369 3300049744 Bacteria 5972
372 Ga0501083_0037466 3300049744 Bacteria 3303
373 Ga0501035_0102792 3300049822 Bacteria 2507
374 Ga0501035_0164015 3300049822 Bacteria 1922
375 Ga0501035_0204603 3300049822 Bacteria 1691
376 Ga0501035_0433783 3300049822 Bacteria 1089
377 Ga0501044_0047692 3300049823 Bacteria 4430
378 Ga0501044_0058863 3300049823 Bacteria 3938
379 Ga0501044_0078571 3300049823 Bacteria 3343
380 Ga0501044_0406472 3300049823 Bacteria 1273
381 nmdc:mga03683_1393_c1 3300050489 Bacteria 7192
382 nmdc:mga03n38_1069_c1 3300050490 Bacteria 7557
383 nmdc:mga00v17_67378_c1 3300050491 Bacteria 2212
384 nmdc:mga0yw44_8703_c1 3300050492 Bacteria 5076
385 nmdc:mga0k408_18844_c1 3300050493 Bacteria 3853
386 nmdc:mga06z11_1924_c1 3300050494 Bacteria 7832
387 nmdc:mga06z11_392765_c1 3300050494 Bacteria 834
388 nmdc:mga04h51_383_c1 3300050495 Bacteria 10752
389 nmdc:mga07m45_426681_c1 3300050496 Bacteria 769
390 Ga0500643_000014 3300053087 Bacteria 318249
391 Ga0500644_0304027 3300053088 Bacteria 683
392 Ga0500566_0372756 3300053094 Bacteria 647
393 Ga0500641_0209479 3300053096 Bacteria 830
394 Ga0500650_0395297 3300053098 Bacteria 599
395 Ga0500555_036129 3300053103 Bacteria 1386
396 Ga0500593_205750 3300053117 Bacteria 706
397 Ga0500594_0021048 3300053118 Bacteria 1632
398 Ga0500594_0056065 3300053118 Bacteria 1123
399 Ga0500595_000390 3300053119 Bacteria 28255
400 Ga0500595_021288 3300053119 Bacteria 2317
401 Ga0500595_054709 3300053119 Bacteria 1224
402 Ga0500595_087748 3300053119 Bacteria 904
403 Ga0500597_062620 3300053120 Bacteria 1600
404 Ga0500642_0077175 3300053130 Bacteria 1525
405 Ga0500568_0137526 3300053139 Bacteria 906
406 Ga0500616_0114683 3300053153 Bacteria 1296
407 Ga0500639_146681 3300053163 Bacteria 1094
408 Ga0500636_0318539 3300053177 Bacteria 757
409 Ga0500596_023331 3300053735 Bacteria 938
410 Ga0501084_0021827 3300054114 Bacteria 5340
411 Ga0501082_0007310 3300060353 Bacteria 9530
412 Ga0501082_0039274 3300060353 Bacteria 4083
413 Ga0495645_0248037
414 JGI25165J46597_1000013
415 JGI25153J46596_10003018
416 Ga0070658_10042656
417 Ga0070658_10051759
418 Ga0070658_10240932
419 Ga0070683_100113131
420 Ga0070690_100254800
421 Ga0070666_10125769
422 Ga0070666_10148892
423 Ga0070680_100723335
424 Ga0070682_100768151
425 Ga0068868_100020987
426 Ga0068868_101001213
427 Ga0070660_100308699
428 Ga0070661_100003375
429 Ga0070661_100242047
430 Ga0070668_100226279
431 Ga0070675_100721391
432 Ga0070671_100182508
433 Ga0070674_100196003
434 Ga0070674_100691522
435 Ga0070659_100199772
436 Ga0070667_100030043
437 Ga0070667_101118043
438 Ga0070667_101431068
439 Ga0070714_100241269
440 Ga0070714_101350416
441 Ga0070710_10636233
442 Ga0070711_100132904
443 Ga0070681_10893696
444 Ga0070681_11465611
445 Ga0070679_100108925
446 Ga0070684_100025863
447 Ga0068853_100151736
448 Ga0068853_100194499
449 Ga0070665_100014524
450 Ga0070665_100180637
451 Ga0070665_100317342
452 Ga0070665_100745398
453 Ga0068855_100062730
454 Ga0068855_100100880
455 Ga0068855_100308437
456 Ga0068857_100026423
457 Ga0068857_100324696
458 Ga0068856_100415548
459 Ga0068856_100785812
460 Ga0068856_100879184
461 Ga0068859_101283338
462 Ga0068864_100097024
463 Ga0068864_102034940
464 Ga0068861_100043871
465 Ga0068863_100037524
466 Ga0068858_100092535
467 Ga0068858_100126240
468 Ga0068860_100007909
469 Ga0068862_100052027
470 Ga0068862_101242549
471 Ga0075365_10013719
472 Ga0075365_10075103
473 Ga0075368_10000440
474 Ga0075363_100000965
475 Ga0075364_10001672
476 Ga0070716_100840698
477 Ga0075362_10000905
478 Ga0075367_10005181
479 Ga0075369_10003725
480 Ga0075366_10000526
481 Ga0097621_100000004
482 Ga0097621_100050804
483 Ga0097621_100054697
484 Ga0097621_100106936
485 Ga0097621_100768744
486 Ga0075370_10009230
487 Ga0068871_100000028
488 Ga0068871_100039943
489 Ga0068871_100051672
490 Ga0068871_100058907
491 Ga0068871_100209463
492 Ga0068871_100994823
493 Ga0068871_101381821
494 Ga0068865_100004725
495 Ga0097620_101283560
496 Ga0105240_10012030
497 Ga0105240_10688043
498 Ga0105240_11295699
499 Ga0105240_11770644
500 Ga0111539_10191349
501 Ga0105245_11176369
502 Ga0105245_11202249
503 Ga0105243_10561668
504 Ga0105241_10044486
505 Ga0105241_10130822
506 Ga0105241_10353971
507 Ga0105242_10010671
508 Ga0105242_10058055
509 Ga0105242_11052766
510 Ga0105248_10024136
511 Ga0105248_10598479
512 Ga0105248_11347772
513 Ga0105248_12244001
514 Ga0105237_10068601
515 Ga0105237_10212456
516 Ga0105237_10533353
517 Ga0105237_11241600
518 Ga0105238_10088964
519 Ga0105238_10247120
520 Ga0105238_10776911
521 Ga0105238_10812232
522 Ga0105238_11422515
523 Ga0105249_10400158
524 Ga0099796_10018756
525 Ga0105239_10266624
526 Ga0105239_10503914
527 Ga0105239_11114824
528 Ga0105239_11901294
529 Ga0105239_12135166
530 Ga0105246_10593327
531 Ga0157373_10708270
532 Ga0157371_10506743
533 Ga0157369_10307772
534 Ga0157374_11105176
535 Ga0157378_10009866
536 Ga0157378_10664226
537 Ga0157378_10696576
538 Ga0157378_11761577
539 Ga0163162_10928447
540 Ga0163162_10989454
541 Ga0163162_11037858
542 Ga0157372_10003598
543 Ga0157372_10032901
544 Ga0157372_10046890
545 Ga0157372_10132231
546 Ga0157372_10357509
547 Ga0157372_12330939
548 Ga0157375_10038943
549 Ga0157375_11236401
550 Ga0163163_10000111
551 Ga0163163_10198702
552 Ga0163163_10698658
553 Ga0163163_11711168
554 Ga0157380_10347511
555 Ga0157379_10000904
556 Ga0157376_10025599
557 Ga0157376_10413328
558 Ga0157376_10420045
559 Ga0157376_10511709
560 Ga0157376_11257713
561 Ga0163161_10184912
562 Ga0213874_10007393
563 Ga0213876_10000225
564 Ga0213876_10001860
565 Ga0209233_1000013
566 Ga0209233_1000964
567 Ga0209758_1000036
568 Ga0209758_1035611
569 Ga0207682_10281163
570 Ga0207642_10129097
571 Ga0207680_10186325
572 Ga0207705_10028609
573 Ga0207705_10132281
574 Ga0207654_10002467
575 Ga0207707_11006322
576 Ga0207695_10052612
577 Ga0207695_10053055
578 Ga0207695_10164623
579 Ga0207695_10282504
580 Ga0207671_10058895
581 Ga0207671_10363350
582 Ga0207657_10045311
583 Ga0207657_10110733
584 Ga0207649_10000073
585 Ga0207652_10104136
586 Ga0207652_10249463
587 Ga0207694_10149311
588 Ga0207694_10568488
589 Ga0207694_10652967
590 Ga0207694_10873713
591 Ga0207650_10929218
592 Ga0207659_10532636
593 Ga0207687_10417885
594 Ga0207664_10204331
595 Ga0207664_10739535
596 Ga0207644_10396162
597 Ga0207690_10076015
598 Ga0207706_10974168
599 Ga0207686_10014940
600 Ga0207686_10015854
601 Ga0207686_10413273
602 Ga0207709_11190700
603 Ga0207669_10294117
604 Ga0207704_10072895
605 Ga0207704_10139205
606 Ga0207691_10241027
607 Ga0207711_10046724
608 Ga0207711_10721432
609 Ga0207689_10233103
610 Ga0207661_10443714
611 Ga0207679_10133854
612 Ga0207667_10138834
613 Ga0207667_10148405
614 Ga0207667_10370059
615 Ga0207651_10526933
616 Ga0207712_10816830
617 Ga0207668_10102022
618 Ga0207668_11107731
619 Ga0207658_10450449
620 Ga0207677_10394635
621 Ga0207703_10012145
622 Ga0207703_10188910
623 Ga0207639_10039705
624 Ga0207639_10456432
625 Ga0207639_10546747
626 Ga0207678_10248217
627 Ga0207702_10445162
628 Ga0207702_10770394
629 Ga0207702_10809718
630 Ga0207641_10010540
631 Ga0207641_11840447
632 Ga0207676_10053359
633 Ga0207676_11145877
634 Ga0207674_10040418
635 Ga0207674_10211073
636 Ga0207674_10276056
637 Ga0207683_10047741
638 Ga0209813_10000625
639 Ga0268266_10108213
640 Ga0268266_10156276
641 Ga0268265_10305547
642 Ga0268265_10335381
643 Ga0268265_10688174
644 Ga0268264_10153274
645 Ga0265318_10043625
646 Ga0265338_10043723
647 Ga0265338_10095701
648 Ga0265330_10032648
649 Ga0265332_10025264
650 Ga0265332_10108831
651 Ga0265332_10141750
652 Ga0265328_10097955
653 Ga0265325_10004925
654 Ga0265325_10015770
655 Ga0265329_10023000
656 Ga0265340_10000021
657 Ga0265340_10003362
658 Ga0265340_10068658
659 Ga0265339_10009825
660 Ga0265339_10055770
661 Ga0265339_10089270
662 Ga0265339_10162401
663 Ga0265331_10000006
664 Ga0265331_10000823
665 Ga0265331_10189889
666 Ga0265327_10000074
667 Ga0265327_10031062
668 Ga0265316_10002070
669 Ga0265316_10049639
670 Ga0265316_10050999
671 Ga0265316_10308281
672 Ga0265316_10380236
673 Ga0265313_10008006
674 Ga0265313_10063720
675 Ga0265313_10118864
676 Ga0265314_10000370
677 Ga0265314_10065200
678 Ga0265314_10076858
679 Ga0265314_10205980
680 Ga0265314_10209975
681 Ga0265342_10052161
682 Ga0265342_10228314
683 Ga0265342_10293623
684 Ga0307516_10075012
685 Ga0307516_10086492
686 Ga0307507_10035940
687 Ga0373943_0014593
688 Ga0373946_0139774
689 Ga0373935_0009238
690 Ga0373947_0009411
691 Ga0373925_0002583
692 Ga0373925_0200239
693 Ga0395900_0820690
694 Ga0395898_0178819
695 Ga0395901_1304928
696 Ga0436365_0014930
697 Ga0436365_0992819
698 Ga0436365_1698101
699 Ga0436365_1793593
700 Ga0436361_1129526
701 Ga0436363_0026865
702 Ga0436363_1287658
703 Ga0436362_1114918
704 Ga0451793_0905697
705 Ga0451802_2127313
706 Ga0466967_0623967
707 Ga0495617_133260
708 Ga0495592_0188789
709 Ga0495650_0055472
710 Ga0495580_0003681
711 Ga0495639_0194789
712 Ga0495585_0155984
713 Ga0495618_0784459
714 Ga0495648_0295686
715 Ga0495665_0153390
716 Ga0495609_0007772
717 Ga0495621_0013772
718 Ga0495622_0011212
719 Ga0495656_0066625
720 Ga0495657_0143026
721 Ga0495658_0006807
722 Ga0495658_0130522
723 Ga0495649_0042200
724 Ga0495589_0132521
725 Ga0495600_0242670
726 Ga0495636_0018305
727 Ga0495674_0557773
728 Ga0495683_0168356
729 Ga0495602_0275398
730 Ga0496100_0570477
731 Ga0496121_0002103
732 Ga0501031_0020259
733 Ga0501031_0790913
734 Ga0501032_0010031
735 Ga0501032_0114470
736 Ga0501033_0005872
737 Ga0501033_0025987
738 Ga0501033_0086134
739 Ga0501033_0359283
740 Ga0501034_0091345
741 Ga0501034_0856060
742 Ga0501034_1212180
743 Ga0501036_0019828
744 Ga0501036_0193741
745 Ga0501036_0661431
746 Ga0501037_0019421
747 Ga0501037_0027488
748 Ga0501037_0420433
749 Ga0501037_0562427
750 Ga0501038_0018768
751 Ga0501038_0037225
752 Ga0501038_0226698
753 Ga0501038_0348650
754 Ga0501038_0862456
755 Ga0501039_0034845
756 Ga0501043_0005813
757 Ga0501043_0027261
758 Ga0501043_0151476
759 Ga0501046_0002196
760 Ga0501046_0066667
761 Ga0501046_0068504
762 Ga0501046_0272575
763 Ga0501046_0372038
764 Ga0501047_0054734
765 Ga0501047_0135343
766 Ga0501047_0180256
767 Ga0501048_0001595
768 Ga0501067_0002120
769 Ga0501068_0033835
770 Ga0501069_0005271
771 Ga0501070_0007693
772 Ga0501072_0023730
773 Ga0501073_0041007
774 Ga0501073_0185959
775 Ga0501073_0486902
776 Ga0501074_0006923
777 Ga0501076_0140467
778 Ga0501079_0017694
779 Ga0501080_0063730
780 Ga0501080_0220922
781 Ga0501080_0289771
782 Ga0501080_0638584
783 Ga0501083_0012369
784 Ga0501083_0037466
785 Ga0501035_0102792
786 Ga0501035_0164015
787 Ga0501035_0204603
788 Ga0501035_0433783
789 Ga0501044_0047692
790 Ga0501044_0058863
791 Ga0501044_0078571
792 Ga0501044_0406472
793 nmdc:mga03683_1393_c1
794 nmdc:mga03n38_1069_c1
795 nmdc:mga00v17_67378_c1
796 nmdc:mga0yw44_8703_c1
797 nmdc:mga0k408_18844_c1
798 nmdc:mga06z11_1924_c1
799 nmdc:mga06z11_392765_c1
800 nmdc:mga04h51_383_c1
801 nmdc:mga07m45_426681_c1
802 Ga0500643_000014
803 Ga0500644_0304027
804 Ga0500566_0372756
805 Ga0500641_0209479
806 Ga0500650_0395297
807 Ga0500555_036129
808 Ga0500593_205750
809 Ga0500594_0021048
810 Ga0500594_0056065
811 Ga0500595_000390
812 Ga0500595_021288
813 Ga0500595_054709
814 Ga0500595_087748
815 Ga0500597_062620
816 Ga0500642_0077175
817 Ga0500568_0137526
818 Ga0500616_0114683
819 Ga0500639_146681
820 Ga0500636_0318539
821 Ga0500596_023331
822 Ga0501084_0021827
823 Ga0501082_0007310
824 Ga0501082_0039274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

22

156

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9696 10 171
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9676 10 171
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.9664 11 169
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9662 11 170
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.964 11 169
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.956 11 170 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9495 11 169 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9491 11 170 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9446 8 170 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9377 10 168 3.40.50.620
ID Description Score Start End GO Terms
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9842 11 174 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A5FXQ8-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9803 10 171 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A7G9SKH7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9795 11 171 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3A0EP61-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9794 9 173 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-B8GVE7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.979 11 172 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map