F437895

General Info

Members Datasets Scaffolds Average Seq Length
412 376 149 352

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0044136|Ga0495625_0044136_101_1252
Length 383
Sequence MTAPVSVHKATKTFGAFTALNDVSLDIKAGEFIVLLGPSGCGKTTLLSILGGFQSPTKGRVTIGGKDMTSVPPAKRPTTTMFQDYALFPHMKLRDNVGFGLRMRGMAKAERDDKALGFLDLIGVKGKAALDRASQLLELVRLSPDHGDRYPHELSGGQRQRVALARALAVDPDVLLLDEPLGALDLKLRRQMQDELKAIQKRVGTTFVHVTHDQEEAMAIADRIVVMNQGRIEDFGPPADIYMRPRSVFSAGFMGEVNFIPGTVKGADAGSALVETAVGSIALPIKSFTVSAPVAGQTITLCIRPEHFRRAGEAEGPVASLGEATVTGSAFFGTHYRCHLKPSAAPDLTVVAHMPQSAAVADGQIVPLAVNLADIVALPSGGN

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2512875024 Mesorhizobium loti R88b Isolate Nodule
12 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
13 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
16 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
17 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
18 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
19 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
20 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
21 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
22 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
23 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
24 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
25 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
26 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
27 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
28 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
29 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
30 2643221557 Ensifer sp. Root558 Isolate Unclassified
31 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
32 2643221599 Rhizobium sp. Root708 Isolate Unclassified
33 2643221607 Rhizobium sp. Root73 Isolate Unclassified
34 2643221610 Ensifer sp. Root74 Isolate Unclassified
35 2643221618 Ensifer sp. Root231 Isolate Unclassified
36 2643221626 Ensifer sp. Root31 Isolate Unclassified
37 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
38 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
39 2643221655 Ensifer sp. Root1252 Isolate Unclassified
40 2643221659 Ensifer sp. Root127 Isolate Unclassified
41 2643221668 Ensifer sp. Root423 Isolate Unclassified
42 2643221675 Ensifer sp. Root1298 Isolate Unclassified
43 2643221680 Ensifer sp. Root1312 Isolate Unclassified
44 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
45 2643221698 Ensifer sp. Root142 Isolate Unclassified
46 2643221712 Ensifer sp. Root258 Isolate Unclassified
47 2643221723 Ensifer sp. Root278 Isolate Unclassified
48 2643221726 Ensifer sp. Root954 Isolate Unclassified
49 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
50 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
51 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
52 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
53 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
54 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
55 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
56 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
57 2844163670 Ensifer sp. 1H6 Isolate Unclassified
58 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
59 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
60 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
61 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
62 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
63 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
64 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
65 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
66 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
67 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
68 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
69 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
70 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
71 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
72 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
73 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
74 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
75 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
76 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
77 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
78 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
79 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
80 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
81 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
82 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
83 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
84 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
85 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
86 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
87 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
88 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
89 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
90 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
91 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
92 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
93 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
94 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
95 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
96 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
97 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
98 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
99 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
100 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
101 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
102 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
103 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
104 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
105 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
106 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
107 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
108 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
109 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
110 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
111 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
112 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
113 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
114 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
115 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
116 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
117 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
118 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
119 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
120 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
121 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
122 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
123 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
124 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
125 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
126 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
127 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
128 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
129 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
130 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
131 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
132 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
133 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
134 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
135 2909042592 Labrys sp. LIt4 Isolate Nodule
136 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
137 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
138 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
139 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
140 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
141 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
142 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
143 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
144 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
145 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
146 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
147 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
148 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
149 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
150 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
151 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
152 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
153 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
154 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
155 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
156 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
157 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
158 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
159 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
160 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
161 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
162 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
163 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
164 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
165 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
166 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
167 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
168 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
169 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
170 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
171 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
172 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
173 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
174 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
175 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
176 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
177 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
178 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
179 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
180 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
181 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
182 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
183 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
184 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
185 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
186 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
187 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
188 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
189 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
190 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
191 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
192 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
193 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
194 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
195 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
196 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
197 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
198 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
199 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
200 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
201 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
202 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
203 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
204 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
205 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
206 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
207 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
208 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
209 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
210 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
211 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
212 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
213 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
214 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
215 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
216 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
217 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
218 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
219 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
220 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
221 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
222 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
223 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
224 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
225 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
226 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
227 2996887358 Rhizobium sp. R711 Isolate Nodule
228 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
229 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
230 3004167301 Mesorhizobium loti 582 Isolate Unclassified
231 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
232 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
233 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
234 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
235 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
236 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
237 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
238 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
239 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
240 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
241 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
242 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
243 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
244 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
245 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
246 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
247 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
248 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
249 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
250 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
251 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
252 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
253 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
254 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
255 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
256 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
257 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
258 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
259 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
260 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
261 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
262 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
263 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
264 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
265 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
266 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
267 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
268 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
269 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
270 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
271 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
276 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
277 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
278 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
279 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
280 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
281 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
282 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
283 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
285 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
286 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
289 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
294 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
308 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
309 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
310 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
311 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
315 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
352 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
359 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
360 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
361 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
362 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
363 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
364 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
365 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
366 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
367 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
368 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
369 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
370 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
371 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
372 8005258706 Rhizobium sp. R693 Isolate Nodule
373 8005321885 Rhizobium sp. R72 Isolate Nodule
374 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
375 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
376 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.17
Metatranscriptomes 0
Isolates 63.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.92
Nodule 49.76
Rhizoplane 1.46
Rhizosphere 24.76
Stem 0
Stem Tuber 0
Unclassified 13.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10007527 3300002067 Bacteria 3549
2 JGI25159J45721_1000008 3300002987 Bacteria 172667
3 JGI25151J46595_10009682 3300003187 Bacteria 4542
4 JGI25160J50197_1000033 3300003354 Bacteria 172667
5 JGI25160J50197_1007041 3300003354 Bacteria 4452
6 JGI25161J50226_1001633 3300003374 Bacteria 6492
7 Ga0055542_1001014 3300003762 Bacteria 17858
8 Ga0055526_1003418 3300003771 Bacteria 10082
9 Ga0055528_1007704 3300003790 Bacteria 4721
10 Ga0055530_10016817 3300003791 Bacteria 2316
11 Ga0055540_1031310 3300003792 Bacteria 1223
12 Ga0055543_1000315 3300004625 Bacteria 33655
13 Ga0065165_1000513 3300005262 Bacteria 59506
14 Ga0070658_10371728 3300005327 Bacteria 1226
15 Ga0070671_100005901 3300005355 Bacteria 9757
16 Ga0070674_100107176 3300005356 Bacteria 2046
17 Ga0070696_100065065 3300005546 Bacteria 2556
18 Ga0070665_100135391 3300005548 Bacteria 2465
19 Ga0070665_100309973 3300005548 Bacteria 1582
20 Ga0068855_100163550 3300005563 Bacteria 2524
21 Ga0068861_100010923 3300005719 Bacteria 6309
22 Ga0068862_100005048 3300005844 Bacteria 11102
23 Ga0081538_10004673 3300005981 Bacteria 12552
24 Ga0075365_10046829 3300006038 Bacteria 2841
25 Ga0075363_100066041 3300006048 Bacteria 1957
26 Ga0075367_10000176 3300006178 Bacteria 20762
27 Ga0075369_10023640 3300006186 Bacteria 2542
28 Ga0075369_10036598 3300006186 Bacteria 2089
29 Ga0075370_10065087 3300006353 Bacteria 2079
30 Ga0075428_100092724 3300006844 Bacteria 3293
31 Ga0075431_100003607 3300006847 Bacteria 14997
32 Ga0068865_100194218 3300006881 Bacteria 1572
33 Ga0105251_10019483 3300009011 Bacteria 3582
34 Ga0114129_10009151 3300009147 Bacteria 14120
35 Ga0114129_10074760 3300009147 Bacteria 4719
36 Ga0114129_10113654 3300009147 Bacteria 3733
37 Ga0105249_10046550 3300009553 Bacteria 3947
38 Ga0105249_10058776 3300009553 Bacteria 3524
39 Ga0123342_1031055 3300009766 Bacteria 2621
40 Ga0105239_10161161 3300010375 Bacteria 2506
41 Ga0105239_10380718 3300010375 Bacteria 1595
42 Ga0171463_1007 3300013249 Bacteria 301198
43 Ga0157374_10206746 3300013296 Bacteria 1924
44 Ga0157380_10044137 3300014326 Bacteria 3492
45 Ga0182008_10065891 3300014497 Bacteria 1781
46 Ga0183363_1058 3300015690 Bacteria 33958
47 Ga0214542_1014241 3300021321 Bacteria 8998
48 Ga0214543_1001578 3300021327 Bacteria 44277
49 Ga0209436_100593 3300025208 Bacteria 15488
50 Ga0209148_1000038 3300025254 Bacteria 493744
51 Ga0209129_1002182 3300025258 Bacteria 9852
52 Ga0209233_1019491 3300025261 Bacteria 1802
53 Ga0209455_1000068 3300025272 Bacteria 310024
54 Ga0209673_1030146 3300025273 Bacteria 1713
55 Ga0209130_1000017 3300025284 Bacteria 388431
56 Ga0209130_1015332 3300025284 Bacteria 1892
57 Ga0209025_1000153 3300025294 Bacteria 170548
58 Ga0209025_1005936 3300025294 Bacteria 9733
59 Ga0209025_1035208 3300025294 Bacteria 2267
60 Ga0209564_1000372 3300025295 Bacteria 83053
61 Ga0209564_1004334 3300025295 Bacteria 8751
62 Ga0209564_1026031 3300025295 Bacteria 1946
63 Ga0209758_1009139 3300025297 Bacteria 6238
64 Ga0209758_1009967 3300025297 Bacteria 5780
65 Ga0209256_1000401 3300025299 Bacteria 68618
66 Ga0209256_1000735 3300025299 Bacteria 43205
67 Ga0207426_1000006 3300025302 Bacteria 1025969
68 Ga0207426_1001123 3300025302 Bacteria 24393
69 Ga0209051_1000901 3300025303 Bacteria 29651
70 Ga0209257_1018443 3300025304 Bacteria 2684
71 Ga0207647_10027361 3300025904 Bacteria 3717
72 Ga0207705_10214171 3300025909 Bacteria 1461
73 Ga0207681_10172932 3300025923 Bacteria 1639
74 Ga0207669_10134822 3300025937 Bacteria 1703
75 Ga0207704_10074782 3300025938 Bacteria 2163
76 Ga0207712_10188088 3300025961 Bacteria 1628
77 Ga0207668_10132687 3300025972 Bacteria 1904
78 Ga0207640_10059866 3300025981 Bacteria 2515
79 Ga0207675_100007617 3300026118 Bacteria 10228
80 Ga0268266_10397341 3300028379 Bacteria 1303
81 Ga0268265_10031474 3300028380 Bacteria 3831
82 Ga0307515_10000017 3300028794 Bacteria 550465
83 Ga0307515_10006276 3300028794 Bacteria 23849
84 Ga0307516_10170853 3300031730 Bacteria 1915
85 Ga0307406_10247305 3300031901 Bacteria 1341
86 Ga0307409_100381770 3300031995 Bacteria 1340
87 Ga0373927_0006313 3300035695 Bacteria 8079
88 Ga0395900_0007761 3300037418 Bacteria 11066
89 Ga0395900_0152546 3300037418 Bacteria 2360
90 Ga0395898_0275181 3300037466 Bacteria 1606
91 Ga0395905_0048626 3300037471 Bacteria 3974
92 Ga0395905_0098424 3300037471 Bacteria 2747
93 Ga0395905_0105877 3300037471 Bacteria 2641
94 Ga0395901_0023851 3300038443 Bacteria 6275
95 Ga0466960_0045781 3300044901 Bacteria 2091
96 Ga0495638_0001158 3300046460 Bacteria 25425
97 Ga0495585_0051683 3300046492 Bacteria 2277
98 Ga0495583_0000761 3300046506 Bacteria 40534
99 Ga0495656_0009519 3300046615 Bacteria 3496
100 Ga0495625_0044136 3300046660 Bacteria 3229
101 Ga0496104_0018030 3300048907 Bacteria 6436
102 Ga0496105_0001719 3300048908 Bacteria 15649
103 Ga0496106_0058027 3300048909 Bacteria 2929
104 Ga0496110_0020253 3300048913 Bacteria 5614
105 Ga0496119_0018114 3300048922 Bacteria 5259
106 Ga0496120_0004638 3300048923 Bacteria 11375
107 Ga0496120_0024173 3300048923 Bacteria 3792
108 Ga0496124_0115772 3300048927 Bacteria 2150
109 Ga0496126_0065604 3300048929 Bacteria 3248
110 Ga0501033_0022143 3300049570 Bacteria 4795
111 Ga0501036_0024138 3300049572 Bacteria 5125
112 Ga0501038_0106622 3300049574 Bacteria 2325
113 Ga0501039_0023317 3300049575 Bacteria 4751
114 Ga0501040_0021134 3300049576 Bacteria 4341
115 Ga0501041_0031444 3300049577 Bacteria 3207
116 Ga0501042_0033194 3300049578 Bacteria 3658
117 Ga0501042_0066123 3300049578 Bacteria 2584
118 Ga0501046_0010206 3300049580 Bacteria 8081
119 Ga0501046_0126569 3300049580 Bacteria 1940
120 Ga0501048_0001128 3300049582 Bacteria 20035
121 Ga0501048_0136867 3300049582 Bacteria 1731
122 Ga0501072_0018686 3300049588 Bacteria 5344
123 Ga0501072_0024602 3300049588 Bacteria 4686
124 Ga0501074_0209745 3300049590 Bacteria 1388
125 Ga0501074_0215647 3300049590 Bacteria 1367
126 Ga0501075_0011756 3300049591 Bacteria 6206
127 Ga0501075_0016289 3300049591 Bacteria 5352
128 Ga0501076_0004082 3300049592 Bacteria 10328
129 Ga0501076_0024135 3300049592 Bacteria 4696
130 Ga0501077_0005362 3300049593 Bacteria 7800
131 Ga0501079_0021667 3300049741 Bacteria 4917
132 Ga0501079_0084565 3300049741 Bacteria 2454
133 Ga0501080_0173121 3300049742 Bacteria 1990
134 Ga0501081_0010403 3300049743 Bacteria 6068
135 Ga0501081_0117674 3300049743 Bacteria 1890
136 Ga0501045_0023430 3300049824 Bacteria 4425
137 nmdc:mga03n38_106827_c1 3300050490 Bacteria 1358
138 nmdc:mga05p37_106805_c1 3300050507 Bacteria 3444
139 nmdc:mga05p37_137050_c1 3300050507 Bacteria 3000
140 nmdc:mga06r32_139869_c1 3300050510 Bacteria 2396
141 nmdc:mga06r32_5778_c1 3300050510 Bacteria 11148
142 Ga0500644_0003129 3300053088 Bacteria 4097
143 Ga0500555_001616 3300053103 Bacteria 6804
144 Ga0500559_0011007 3300053136 Bacteria 3872
145 Ga0500622_0000906 3300053156 Bacteria 25193
146 Ga0501084_0056307 3300054114 Bacteria 3290
147 Ga0501082_0011876 3300060353 Bacteria 7485
148 Ga0530510_0002797 3300061734 Bacteria 11993
149 Ga0530510_0068351 3300061734 Bacteria 2577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0136867 Ga0501048_0136867_132_986 283
2 3300049591 Ga0501075_0016289 Ga0501075_0016289_122_976 283
3 iso_pu_bacteria 2869234852 2869239949 287
4 iso_pu_bacteria 2874109183 2874111206 287
5 iso_pu_bacteria 2878730984 2878737007 287
6 iso_pu_bacteria 8004300914 8004304444 303
7 iso_pu_bacteria 3004195979 3004196548 316
8 iso_pu_bacteria 2937980651 2937981563 319
9 3300025923 Ga0207681_10172932 Ga0207681_101729322 331
10 iso_pu_bacteria 2885312484 2885317493 331
11 3300031995 Ga0307409_100381770 Ga0307409_1003817702 339
12 iso_pu_bacteria 2529292951 2530646733 339
13 3300049572 Ga0501036_0024138 Ga0501036_0024138_3164_4195 340
14 3300049574 Ga0501038_0106622 Ga0501038_0106622_780_1811 340
15 3300049575 Ga0501039_0023317 Ga0501039_0023317_2694_3725 340
16 3300049578 Ga0501042_0033194 Ga0501042_0033194_2339_3370 340
17 3300049580 Ga0501046_0126569 Ga0501046_0126569_586_1617 340
18 3300049582 Ga0501048_0001128 Ga0501048_0001128_16010_17041 340
19 3300049588 Ga0501072_0024602 Ga0501072_0024602_661_1692 340
20 3300049590 Ga0501074_0215647 Ga0501074_0215647_149_1180 340
21 3300049591 Ga0501075_0011756 Ga0501075_0011756_3022_4053 340
22 3300049592 Ga0501076_0024135 Ga0501076_0024135_540_1571 340
23 3300049741 Ga0501079_0021667 Ga0501079_0021667_1497_2528 340
24 3300049742 Ga0501080_0173121 Ga0501080_0173121_197_1228 340
25 3300049743 Ga0501081_0117674 Ga0501081_0117674_731_1762 340
26 3300054114 Ga0501084_0056307 Ga0501084_0056307_2023_3054 340
27 3300060353 Ga0501082_0011876 Ga0501082_0011876_4039_5070 340
28 3300061734 Ga0530510_0068351 Ga0530510_0068351_1256_2287 340
29 3300005356 Ga0070674_100107176 Ga0070674_1001071762 342
30 3300005546 Ga0070696_100065065 Ga0070696_1000650651 342
31 3300005719 Ga0068861_100010923 Ga0068861_1000109234 342
32 3300005844 Ga0068862_100005048 Ga0068862_10000504812 342
33 3300005981 Ga0081538_10004673 Ga0081538_100046735 342
34 3300006844 Ga0075428_100092724 Ga0075428_1000927242 342
35 3300006881 Ga0068865_100194218 Ga0068865_1001942181 342
36 3300009147 Ga0114129_10074760 Ga0114129_100747606 342
37 3300009147 Ga0114129_10113654 Ga0114129_101136542 342
38 3300009553 Ga0105249_10046550 Ga0105249_100465504 342
39 3300014326 Ga0157380_10044137 Ga0157380_100441374 342
40 3300025937 Ga0207669_10134822 Ga0207669_101348221 342
41 3300025938 Ga0207704_10074782 Ga0207704_100747822 342
42 3300025961 Ga0207712_10188088 Ga0207712_101880883 342
43 3300026118 Ga0207675_100007617 Ga0207675_1000076174 342
44 3300028380 Ga0268265_10031474 Ga0268265_100314743 342
45 3300050507 nmdc:mga05p37_106805_c1 nmdc:mga05p37_106805_c1_112_1140 342
46 3300050507 nmdc:mga05p37_137050_c1 nmdc:mga05p37_137050_c1_364_1392 342
47 3300050510 nmdc:mga06r32_139869_c1 nmdc:mga06r32_139869_c1_649_1677 342
48 iso_pu_bacteria 2582581866 2585397505 342
49 iso_pu_bacteria 2989349275 2989352314 345
50 iso_pu_bacteria 2869169390 2869169638 346
51 iso_pu_bacteria 2909042592 2909044316 346
52 iso_pu_bacteria 2979710463 2979711357 346
53 iso_pu_bacteria 2775507049 2776911285 347
54 iso_pu_bacteria 2989771324 2989775219 347
55 iso_pu_bacteria 2922158528 2922163243 348
56 iso_pu_bacteria 2996341866 2996348156 348
57 iso_pu_bacteria 3003930520 3003935288 348
58 iso_pu_bacteria 8005246636 8005248126 348
59 iso_pu_bacteria 8054558443 8054560903 348
60 iso_pu_bacteria 2508501122 2509107977 349
61 iso_pu_bacteria 2509276019 2509376847 349
62 iso_pu_bacteria 2509276021 2509389730 349
63 iso_pu_bacteria 2510917028 2511186681 349
64 iso_pu_bacteria 2512875024 2512958245 349
65 iso_pu_bacteria 2513237088 2513594980 349
66 iso_pu_bacteria 2513237138 2513867149 349
67 iso_pu_bacteria 2513237164 2514032622 349
68 iso_pu_bacteria 2558860100 2558865796 349
69 iso_pu_bacteria 2582581294 2585201018 349
70 iso_pu_bacteria 2582581299 2585230361 349
71 iso_pu_bacteria 2582581306 2585265876 349
72 iso_pu_bacteria 2582581865 2585390066 349
73 iso_pu_bacteria 2582581866 2585393459 349
74 iso_pu_bacteria 2582581867 2585402677 349
75 iso_pu_bacteria 2585427590 2585820410 349
76 iso_pu_bacteria 2599185352 2600196905 349
77 iso_pu_bacteria 2643221557 2643804467 349
78 iso_pu_bacteria 2643221599 2644004116 349
79 iso_pu_bacteria 2643221607 2644052134 349
80 iso_pu_bacteria 2643221610 2644065238 349
81 iso_pu_bacteria 2643221618 2644105530 349
82 iso_pu_bacteria 2643221626 2644146533 349
83 iso_pu_bacteria 2643221636 2644204928 349
84 iso_pu_bacteria 2643221655 2644308281 349
85 iso_pu_bacteria 2643221659 2644334108 349
86 iso_pu_bacteria 2643221668 2644377647 349
87 iso_pu_bacteria 2643221675 2644418156 349
88 iso_pu_bacteria 2643221680 2644451412 349
89 iso_pu_bacteria 2643221686 2644484877 349
90 iso_pu_bacteria 2643221698 2644541702 349
91 iso_pu_bacteria 2643221712 2644615563 349
92 iso_pu_bacteria 2643221723 2644672696 349
93 iso_pu_bacteria 2643221726 2644691608 349
94 iso_pu_bacteria 2844163670 2844166445 349
95 iso_pu_bacteria 2850079185 2850081851 349
96 iso_pu_bacteria 2920822456 2920825705 349
97 iso_pu_bacteria 2923556063 2923560083 349
98 iso_pu_bacteria 2941499720 2941504525 349
99 iso_pu_bacteria 2996887358 2996888541 349
100 iso_pu_bacteria 3005452660 3005457163 349
101 iso_pu_bacteria 8005258706 8005264518 349
102 iso_pu_bacteria 8005321885 8005323068 349
103 iso_pu_bacteria 8054002106 8054007437 349
104 3300006186 Ga0075369_10023640 Ga0075369_100236402 350
105 iso_pu_bacteria 2503198000 2503202713 350
106 iso_pu_bacteria 2508501127 2509144099 350
107 iso_pu_bacteria 2509276018 2509371278 350
108 iso_pu_bacteria 2509276022 2509397214 350
109 iso_pu_bacteria 2510065059 2510313945 350
110 iso_pu_bacteria 2512875016 2512930508 350
111 iso_pu_bacteria 2513237090 2513612177 350
112 iso_pu_bacteria 2513237305 2514417769 350
113 iso_pu_bacteria 2588253730 2588516141 350
114 iso_pu_bacteria 2597489875 2597814675 350
115 iso_pu_bacteria 2599185301 2599937622 350
116 iso_pu_bacteria 2643221595 2643989467 350
117 iso_pu_bacteria 2643221627 2644153954 350
118 iso_pu_bacteria 2687453392 2688598924 350
119 iso_pu_bacteria 2721755686 2723576012 350
120 iso_pu_bacteria 2756170246 2756677445 350
121 iso_pu_bacteria 2791355123 2792751754 350
122 iso_pu_bacteria 2841734538 2841740511 350
123 iso_pu_bacteria 2844002411 2844006851 350
124 iso_pu_bacteria 2844009547 2844014272 350
125 iso_pu_bacteria 2847670302 2847670949 350
126 iso_pu_bacteria 2847686936 2847687117 350
127 iso_pu_bacteria 2856314179 2856316421 350
128 iso_pu_bacteria 2856320880 2856324983 350
129 iso_pu_bacteria 2856328259 2856330682 350
130 iso_pu_bacteria 2856334872 2856334905 350
131 iso_pu_bacteria 2856342000 2856348299 350
132 iso_pu_bacteria 2856364286 2856367167 350
133 iso_pu_bacteria 2857349434 2857355537 350
134 iso_pu_bacteria 2857367948 2857371687 350
135 iso_pu_bacteria 2869162929 2869166398 350
136 iso_pu_bacteria 2869242130 2869242319 350
137 iso_pu_bacteria 2869249662 2869256287 350
138 iso_pu_bacteria 2869271264 2869271323 350
139 iso_pu_bacteria 2869278585 2869280963 350
140 iso_pu_bacteria 2869285874 2869287504 350
141 iso_pu_bacteria 2871429161 2871431031 350
142 iso_pu_bacteria 2871444079 2871444391 350
143 iso_pu_bacteria 2871451962 2871455831 350
144 iso_pu_bacteria 2871466892 2871472496 350
145 iso_pu_bacteria 2871474448 2871481045 350
146 iso_pu_bacteria 2871481445 2871484829 350
147 iso_pu_bacteria 2871488783 2871495302 350
148 iso_pu_bacteria 2871495908 2871500407 350
149 iso_pu_bacteria 2874102143 2874107119 350
150 iso_pu_bacteria 2874123672 2874127999 350
151 iso_pu_bacteria 2874131515 2874134665 350
152 iso_pu_bacteria 2874139085 2874141371 350
153 iso_pu_bacteria 2874146452 2874150200 350
154 iso_pu_bacteria 2874155637 2874157270 350
155 iso_pu_bacteria 2874168670 2874173138 350
156 iso_pu_bacteria 2876363079 2876368147 350
157 iso_pu_bacteria 2876399893 2876405764 350
158 iso_pu_bacteria 2876406927 2876411212 350
159 iso_pu_bacteria 2876413966 2876415653 350
160 iso_pu_bacteria 2876420981 2876424178 350
161 iso_pu_bacteria 2878035449 2878041730 350
162 iso_pu_bacteria 2878738818 2878743097 350
163 iso_pu_bacteria 2878745973 2878747652 350
164 iso_pu_bacteria 2878753008 2878758031 350
165 iso_pu_bacteria 2878760144 2878764496 350
166 iso_pu_bacteria 2878767105 2878771597 350
167 iso_pu_bacteria 2878774303 2878780574 350
168 iso_pu_bacteria 2878781027 2878785963 350
169 iso_pu_bacteria 2878788777 2878793605 350
170 iso_pu_bacteria 2881147464 2881152498 350
171 iso_pu_bacteria 2881161766 2881161842 350
172 iso_pu_bacteria 2881861095 2881866229 350
173 iso_pu_bacteria 2882632389 2882633013 350
174 iso_pu_bacteria 2882912400 2882914799 350
175 iso_pu_bacteria 2885305155 2885310729 350
176 iso_pu_bacteria 2885318864 2885325646 350
177 iso_pu_bacteria 2885334103 2885340715 350
178 iso_pu_bacteria 2888337043 2888340749 350
179 iso_pu_bacteria 2888343758 2888347979 350
180 iso_pu_bacteria 2888350351 2888356942 350
181 iso_pu_bacteria 2889010040 2889011984 350
182 iso_pu_bacteria 2889016732 2889023079 350
183 iso_pu_bacteria 2903448605 2903452166 350
184 iso_pu_bacteria 2903492973 2903501585 350
185 iso_pu_bacteria 2903492973 2903502069 350
186 iso_pu_bacteria 2903521522 2903527143 350
187 iso_pu_bacteria 2903528002 2903533370 350
188 iso_pu_bacteria 2903540706 2903545220 350
189 iso_pu_bacteria 2906308376 2906310044 350
190 iso_pu_bacteria 2906321335 2906322917 350
191 iso_pu_bacteria 2906328253 2906332869 350
192 iso_pu_bacteria 2906363423 2906366675 350
193 iso_pu_bacteria 2906393657 2906401054 350
194 iso_pu_bacteria 2906401398 2906406432 350
195 iso_pu_bacteria 2906408224 2906411722 350
196 iso_pu_bacteria 2906414383 2906416558 350
197 iso_pu_bacteria 2922158528 2922160054 350
198 iso_pu_bacteria 2922172374 2922177204 350
199 iso_pu_bacteria 2924710171 2924714102 350
200 iso_pu_bacteria 2924733363 2924739225 350
201 iso_pu_bacteria 2924741084 2924745848 350
202 iso_pu_bacteria 2924754689 2924758799 350
203 iso_pu_bacteria 2924776078 2924780896 350
204 iso_pu_bacteria 2924784321 2924784744 350
205 iso_pu_bacteria 2937813078 2937813343 350
206 iso_pu_bacteria 2937836603 2937839936 350
207 iso_pu_bacteria 2937848649 2937852889 350
208 iso_pu_bacteria 2937861824 2937865795 350
209 iso_pu_bacteria 2937868953 2937876018 350
210 iso_pu_bacteria 2937877337 2937879473 350
211 iso_pu_bacteria 2937972304 2937974886 350
212 iso_pu_bacteria 2937994558 2937999068 350
213 iso_pu_bacteria 2938014810 2938019592 350
214 iso_pu_bacteria 2958034702 2958036926 350
215 iso_pu_bacteria 2958041894 2958050548 350
216 iso_pu_bacteria 2958071322 2958074385 350
217 iso_pu_bacteria 2958084443 2958086648 350
218 iso_pu_bacteria 2958092219 2958097599 350
219 iso_pu_bacteria 2958100919 2958106047 350
220 iso_pu_bacteria 2958115193 2958122446 350
221 iso_pu_bacteria 2958122699 2958123414 350
222 iso_pu_bacteria 2958130278 2958131907 350
223 iso_pu_bacteria 2958137437 2958139264 350
224 iso_pu_bacteria 2958144490 2958149633 350
225 iso_pu_bacteria 2958165035 2958169542 350
226 iso_pu_bacteria 2958179912 2958181710 350
227 iso_pu_bacteria 2961077736 2961079553 350
228 iso_pu_bacteria 2961163497 2961168002 350
229 iso_pu_bacteria 2961170736 2961174605 350
230 iso_pu_bacteria 2961183825 2961186440 350
231 iso_pu_bacteria 2963644680 2963648720 350
232 iso_pu_bacteria 2965018300 2965022821 350
233 iso_pu_bacteria 2965025482 2965028119 350
234 iso_pu_bacteria 2965040258 2965044365 350
235 iso_pu_bacteria 2965047637 2965051636 350
236 iso_pu_bacteria 2965062239 2965066698 350
237 iso_pu_bacteria 2965102966 2965103260 350
238 iso_pu_bacteria 2965119406 2965126776 350
239 iso_pu_bacteria 2967996073 2968000596 350
240 iso_pu_bacteria 2968003550 2968010031 350
241 iso_pu_bacteria 2968016561 2968020247 350
242 iso_pu_bacteria 2968083720 2968083946 350
243 iso_pu_bacteria 2968091066 2968092554 350
244 iso_pu_bacteria 2968097103 2968101677 350
245 iso_pu_bacteria 2968128360 2968128715 350
246 iso_pu_bacteria 2968171901 2968176402 350
247 iso_pu_bacteria 2970469710 2970473569 350
248 iso_pu_bacteria 2970489779 2970490966 350
249 iso_pu_bacteria 2970503327 2970507191 350
250 iso_pu_bacteria 2970510686 2970515000 350
251 iso_pu_bacteria 2970524798 2970531870 350
252 iso_pu_bacteria 2970540015 2970541791 350
253 iso_pu_bacteria 2970547951 2970552908 350
254 iso_pu_bacteria 2970554993 2970559341 350
255 iso_pu_bacteria 2970593180 2970595567 350
256 iso_pu_bacteria 2970627176 2970633906 350
257 iso_pu_bacteria 2977821940 2977828895 350
258 iso_pu_bacteria 2977828996 2977833425 350
259 iso_pu_bacteria 2977843712 2977845343 350
260 iso_pu_bacteria 2977851361 2977851471 350
261 iso_pu_bacteria 2977858184 2977863704 350
262 iso_pu_bacteria 2977864932 2977866651 350
263 iso_pu_bacteria 2977872689 2977876429 350
264 iso_pu_bacteria 2977898635 2977906614 350
265 iso_pu_bacteria 2977907340 2977910129 350
266 iso_pu_bacteria 2977922695 2977924795 350
267 iso_pu_bacteria 2977942078 2977949040 350
268 iso_pu_bacteria 2977950692 2977956748 350
269 iso_pu_bacteria 2977957713 2977964444 350
270 iso_pu_bacteria 2977986579 2977990581 350
271 iso_pu_bacteria 2979779861 2979782219 350
272 iso_pu_bacteria 2979808191 2979812387 350
273 iso_pu_bacteria 2987636660 2987640670 350
274 iso_pu_bacteria 2987645492 2987646402 350
275 iso_pu_bacteria 2987652177 2987652378 350
276 iso_pu_bacteria 2987659509 2987664016 350
277 iso_pu_bacteria 2987673487 2987674054 350
278 iso_pu_bacteria 2996341866 2996348692 350
279 iso_pu_bacteria 2996348954 2996351293 350
280 iso_pu_bacteria 2996386984 2996390759 350
281 iso_pu_bacteria 3000135777 3000136117 350
282 iso_pu_bacteria 3004167301 3004170251 350
283 iso_pu_bacteria 3004188549 3004193071 350
284 iso_pu_bacteria 3004203850 3004208867 350
285 iso_pu_bacteria 3004211236 3004213045 350
286 iso_pu_bacteria 3004218560 3004222192 350
287 iso_pu_bacteria 3004268573 3004273779 350
288 iso_pu_bacteria 3004275668 3004277991 350
289 iso_pu_bacteria 3004289098 3004296845 350
290 iso_pu_bacteria 3004334049 3004340121 350
291 iso_pu_bacteria 637000159 637073505 350
292 iso_pu_bacteria 649633066 649873440 350
293 iso_pu_bacteria 8004312739 8004317714 350
294 iso_pu_bacteria 8004361976 8004367439 350
295 iso_pu_bacteria 8004374579 8004379543 350
296 iso_pu_bacteria 8004387939 8004390243 350
297 iso_pu_bacteria 8004445564 8004451762 350
298 iso_pu_bacteria 8004633249 8004635515 350
299 iso_pu_bacteria 8004640170 8004643054 350
300 iso_pu_bacteria 8004695233 8004699934 350
301 iso_pu_bacteria 8004703790 8004714406 350
302 iso_pu_bacteria 8004714634 8004716306 350
303 iso_pu_bacteria 8055617313 8055622084 350
304 3300005548 Ga0070665_100309973 Ga0070665_1003099732 351
305 3300031901 Ga0307406_10247305 Ga0307406_102473052 351
306 3300002987 JGI25159J45721_1000008 JGI25159J45721_100000829 353
307 3300003187 JGI25151J46595_10009682 JGI25151J46595_100096824 353
308 3300003354 JGI25160J50197_1000033 JGI25160J50197_1000033146 353
309 3300003354 JGI25160J50197_1007041 JGI25160J50197_10070413 353
310 3300003374 JGI25161J50226_1001633 JGI25161J50226_10016333 353
311 3300003771 Ga0055526_1003418 Ga0055526_100341810 353
312 3300003790 Ga0055528_1007704 Ga0055528_10077044 353
313 3300003791 Ga0055530_10016817 Ga0055530_100168172 353
314 3300003792 Ga0055540_1031310 Ga0055540_10313101 353
315 3300004625 Ga0055543_1000315 Ga0055543_10003155 353
316 3300005262 Ga0065165_1000513 Ga0065165_100051330 353
317 3300005355 Ga0070671_100005901 Ga0070671_1000059018 353
318 3300006178 Ga0075367_10000176 Ga0075367_100001769 353
319 3300006186 Ga0075369_10036598 Ga0075369_100365982 353
320 3300006847 Ga0075431_100003607 Ga0075431_1000036077 353
321 3300009011 Ga0105251_10019483 Ga0105251_100194833 353
322 3300009147 Ga0114129_10009151 Ga0114129_1000915113 353
323 3300009553 Ga0105249_10058776 Ga0105249_100587763 353
324 3300009766 Ga0123342_1031055 Ga0123342_10310552 353
325 3300013249 Ga0171463_1007 Ga0171463_1007268 353
326 3300015690 Ga0183363_1058 Ga0183363_105829 353
327 3300021321 Ga0214542_1014241 Ga0214542_10142413 353
328 3300021327 Ga0214543_1001578 Ga0214543_100157826 353
329 3300025208 Ga0209436_100593 Ga0209436_10059312 353
330 3300025258 Ga0209129_1002182 Ga0209129_10021827 353
331 3300025273 Ga0209673_1030146 Ga0209673_10301462 353
332 3300025284 Ga0209130_1000017 Ga0209130_100001731 353
333 3300025284 Ga0209130_1015332 Ga0209130_10153322 353
334 3300025294 Ga0209025_1000153 Ga0209025_1000153146 353
335 3300025294 Ga0209025_1005936 Ga0209025_10059369 353
336 3300025294 Ga0209025_1035208 Ga0209025_10352082 353
337 3300025295 Ga0209564_1000372 Ga0209564_100037236 353
338 3300025295 Ga0209564_1004334 Ga0209564_10043344 353
339 3300025295 Ga0209564_1026031 Ga0209564_10260312 353
340 3300025297 Ga0209758_1009139 Ga0209758_10091397 353
341 3300025299 Ga0209256_1000401 Ga0209256_100040141 353
342 3300025299 Ga0209256_1000735 Ga0209256_100073523 353
343 3300025302 Ga0207426_1000006 Ga0207426_100000630 353
344 3300025302 Ga0207426_1001123 Ga0207426_10011234 353
345 3300025303 Ga0209051_1000901 Ga0209051_100090125 353
346 3300025304 Ga0209257_1018443 Ga0209257_10184433 353
347 3300028794 Ga0307515_10000017 Ga0307515_10000017302 353
348 3300028794 Ga0307515_10006276 Ga0307515_1000627615 353
349 3300035695 Ga0373927_0006313 Ga0373927_0006313_6196_7278 353
350 3300037471 Ga0395905_0048626 Ga0395905_0048626_1002_2084 353
351 3300046492 Ga0495585_0051683 Ga0495585_0051683_288_1388 353
352 3300046506 Ga0495583_0000761 Ga0495583_0000761_14157_15257 353
353 3300046615 Ga0495656_0009519 Ga0495656_0009519_1971_3071 353
354 3300046660 Ga0495625_0044136 Ga0495625_0044136_101_1252 353
355 3300048907 Ga0496104_0018030 Ga0496104_0018030_2973_4067 353
356 3300048908 Ga0496105_0001719 Ga0496105_0001719_2994_4088 353
357 3300048909 Ga0496106_0058027 Ga0496106_0058027_1727_2821 353
358 3300048913 Ga0496110_0020253 Ga0496110_0020253_3538_4632 353
359 3300048922 Ga0496119_0018114 Ga0496119_0018114_2318_3412 353
360 3300048927 Ga0496124_0115772 Ga0496124_0115772_663_1763 353
361 3300048929 Ga0496126_0065604 Ga0496126_0065604_385_1479 353
362 3300050510 nmdc:mga06r32_5778_c1 nmdc:mga06r32_5778_c1_5790_6854 353
363 3300053088 Ga0500644_0003129 Ga0500644_0003129_385_1467 353
364 3300053136 Ga0500559_0011007 Ga0500559_0011007_1613_2698 353
365 3300053156 Ga0500622_0000906 Ga0500622_0000906_7730_8812 353
366 3300002067 JGI24735J21928_10007527 JGI24735J21928_100075273 354
367 3300003762 Ga0055542_1001014 Ga0055542_100101414 354
368 3300005327 Ga0070658_10371728 Ga0070658_103717281 354
369 3300005548 Ga0070665_100135391 Ga0070665_1001353912 354
370 3300005563 Ga0068855_100163550 Ga0068855_1001635502 354
371 3300006038 Ga0075365_10046829 Ga0075365_100468293 354
372 3300006048 Ga0075363_100066041 Ga0075363_1000660412 354
373 3300006353 Ga0075370_10065087 Ga0075370_100650873 354
374 3300010375 Ga0105239_10161161 Ga0105239_101611612 354
375 3300010375 Ga0105239_10380718 Ga0105239_103807182 354
376 3300013296 Ga0157374_10206746 Ga0157374_102067462 354
377 3300014497 Ga0182008_10065891 Ga0182008_100658912 354
378 3300025254 Ga0209148_1000038 Ga0209148_1000038143 354
379 3300025261 Ga0209233_1019491 Ga0209233_10194912 354
380 3300025272 Ga0209455_1000068 Ga0209455_1000068283 354
381 3300025297 Ga0209758_1009967 Ga0209758_10099673 354
382 3300025904 Ga0207647_10027361 Ga0207647_100273613 354
383 3300025909 Ga0207705_10214171 Ga0207705_102141712 354
384 3300025972 Ga0207668_10132687 Ga0207668_101326872 354
385 3300025981 Ga0207640_10059866 Ga0207640_100598662 354
386 3300028379 Ga0268266_10397341 Ga0268266_103973411 354
387 3300031730 Ga0307516_10170853 Ga0307516_101708532 354
388 3300037418 Ga0395900_0007761 Ga0395900_0007761_8232_9296 354
389 3300037418 Ga0395900_0152546 Ga0395900_0152546_355_1419 354
390 3300037466 Ga0395898_0275181 Ga0395898_0275181_481_1545 354
391 3300037471 Ga0395905_0098424 Ga0395905_0098424_1648_2712 354
392 3300037471 Ga0395905_0105877 Ga0395905_0105877_894_1958 354
393 3300038443 Ga0395901_0023851 Ga0395901_0023851_3143_4207 354
394 3300044901 Ga0466960_0045781 Ga0466960_0045781_157_1221 354
395 3300046460 Ga0495638_0001158 Ga0495638_0001158_24283_25365 354
396 3300048923 Ga0496120_0004638 Ga0496120_0004638_9203_10267 354
397 3300048923 Ga0496120_0024173 Ga0496120_0024173_2584_3648 354
398 3300049570 Ga0501033_0022143 Ga0501033_0022143_1910_2977 354
399 3300049576 Ga0501040_0021134 Ga0501040_0021134_2969_4036 354
400 3300049577 Ga0501041_0031444 Ga0501041_0031444_202_1269 354
401 3300049578 Ga0501042_0066123 Ga0501042_0066123_1448_2515 354
402 3300049580 Ga0501046_0010206 Ga0501046_0010206_3895_4962 354
403 3300049588 Ga0501072_0018686 Ga0501072_0018686_1151_2218 354
404 3300049590 Ga0501074_0209745 Ga0501074_0209745_44_1111 354
405 3300049592 Ga0501076_0004082 Ga0501076_0004082_9226_10293 354
406 3300049593 Ga0501077_0005362 Ga0501077_0005362_310_1377 354
407 3300049741 Ga0501079_0084565 Ga0501079_0084565_1169_2236 354
408 3300049743 Ga0501081_0010403 Ga0501081_0010403_3434_4501 354
409 3300049824 Ga0501045_0023430 Ga0501045_0023430_1810_2877 354
410 3300050490 nmdc:mga03n38_106827_c1 nmdc:mga03n38_106827_c1_233_1297 354
411 3300053103 Ga0500555_001616 Ga0500555_001616_5272_6336 354
412 3300061734 Ga0530510_0002797 Ga0530510_0002797_9369_10436 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

182

0.9

PF08402

TOBE_2

TOBE domain

301

378

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9415 4 216
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9402 5 235
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9374 3 219
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9349 6 218
4wbs-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia phymatum 0.9307 6 222
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.979 4 216 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9713 6 217 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9544 6 236 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9525 4 216 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 6 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9759 5 187 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A534HSD0-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9732 2 220 GO:0005524
GO:0016887
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9654 6 222 GO:0005524
GO:0016887
GO:0055052
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9611 6 153 GO:0005524
GO:0016887
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9606 6 222 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.72 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map