F437987

General Info

Members Datasets Scaffolds Average Seq Length
413 175 413 346

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100078732|Ga0070675_1000787323
Length 394
Sequence VRGLLEISNHPSDGNLFDLGNDVDGSERGERTISYGPSRTSERLATKGGHVTDIDRRTVLAGLASGLFFYGPRLEGRAQTSAARPHRIDVHHHFAPPAWVTAVRGRPLLQPANTTWTPEKSIDDMDRGGVALSLVSITNPGLWFGDAPMTRQLARACNEYGARLVHDHPTRFGVFAAMPLPDVDATLAEIAYAYDTLKVDGVGLFTSYGDKWLGHPSFRPVMEELNRRKAVVHVHPTAANCCRNLDYAPGVAPGSIEYGTDTTRAIMGVAFSGDAAKFPDVRFIWSHAGGSAPFLAARIEGASANAKDRLPNGFMAEIRKFYYDLAGASNRGAVASLLELVKSSQILFGTDFPPGGSATDYVKALSEMTLLNKNDLKAIDRDNAVRLIPRLAKT

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 2.42
Rhizosphere 96.85
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1009946 3300001977 Unclassified 1413
2 Ga0065712_10004096 3300005290 Bacteria 4357
3 Ga0065712_10071066 3300005290 Bacteria 5508
4 Ga0065712_10132014 3300005290 Unclassified 1533
5 Ga0065715_10015778 3300005293 Bacteria 3503
6 Ga0065715_10118072 3300005293 Unclassified 2328
7 Ga0065707_10000906 3300005295 Bacteria 35720
8 Ga0070676_10009638 3300005328 Bacteria 5221
9 Ga0070676_10055833 3300005328 Bacteria 2332
10 Ga0070690_100099025 3300005330 Unclassified 1930
11 Ga0070670_100044571 3300005331 Bacteria 3814
12 Ga0070677_10006598 3300005333 Bacteria 3856
13 Ga0070677_10021405 3300005333 Bacteria 2372
14 Ga0068869_100019838 3300005334 Bacteria 4602
15 Ga0070680_100225868 3300005336 Bacteria 1581
16 Ga0068868_100030094 3300005338 Bacteria 4162
17 Ga0068868_100294942 3300005338 Bacteria 1376
18 Ga0070689_100062842 3300005340 Bacteria 2890
19 Ga0070689_100107757 3300005340 Bacteria 2212
20 Ga0070661_100085115 3300005344 Bacteria 2336
21 Ga0070661_100112112 3300005344 Bacteria 2038
22 Ga0070668_100014867 3300005347 Bacteria 5818
23 Ga0070669_100002449 3300005353 Bacteria 13430
24 Ga0070669_100008836 3300005353 Bacteria 7190
25 Ga0070669_100018770 3300005353 Bacteria 4943
26 Ga0070669_100150882 3300005353 Bacteria 1799
27 Ga0070675_100036660 3300005354 Bacteria 3992
28 Ga0070675_100078732 3300005354 Bacteria 2745
29 Ga0070675_100085382 3300005354 Bacteria 2637
30 Ga0070675_100100998 3300005354 Bacteria 2430
31 Ga0070675_100124283 3300005354 Unclassified 2194
32 Ga0070675_100185525 3300005354 Unclassified 1800
33 Ga0070675_100203263 3300005354 Unclassified 1720
34 Ga0070671_100008541 3300005355 Bacteria 8210
35 Ga0070671_100009176 3300005355 Bacteria 7941
36 Ga0070671_100217727 3300005355 Bacteria 1620
37 Ga0070674_100007785 3300005356 Bacteria 6333
38 Ga0070674_100019093 3300005356 Bacteria 4349
39 Ga0070674_100099372 3300005356 Bacteria 2117
40 Ga0070673_100005652 3300005364 Bacteria 8032
41 Ga0070673_100016567 3300005364 Bacteria 5216
42 Ga0070673_100024138 3300005364 Bacteria 4453
43 Ga0070673_100040644 3300005364 Bacteria 3569
44 Ga0070673_100080600 3300005364 Bacteria 2638
45 Ga0070673_100136946 3300005364 Bacteria 2062
46 Ga0070688_100132115 3300005365 Unclassified 1686
47 Ga0070688_100135104 3300005365 Bacteria 1669
48 Ga0070659_100334383 3300005366 Unclassified 1268
49 Ga0070667_100001111 3300005367 Bacteria 24543
50 Ga0070667_100037373 3300005367 Bacteria 4070
51 Ga0070667_100356983 3300005367 Bacteria 1324
52 Ga0070709_10015553 3300005434 Bacteria 4332
53 Ga0070714_100065911 3300005435 Bacteria 3120
54 Ga0070701_10034663 3300005438 Bacteria 2530
55 Ga0070705_100035798 3300005440 Bacteria 2786
56 Ga0070700_100066597 3300005441 Bacteria 2286
57 Ga0070700_100141483 3300005441 Bacteria 1636
58 Ga0070700_100154339 3300005441 Bacteria 1573
59 Ga0070694_100035121 3300005444 Bacteria 3311
60 Ga0070694_100236237 3300005444 Unclassified 1377
61 Ga0070678_100003477 3300005456 Bacteria 8778
62 Ga0070678_100142491 3300005456 Bacteria 1920
63 Ga0070678_100221004 3300005456 Bacteria 1574
64 Ga0070662_100039022 3300005457 Bacteria 3376
65 Ga0068867_100014749 3300005459 Bacteria 5538
66 Ga0068867_100119373 3300005459 Bacteria 2036
67 Ga0070685_10118418 3300005466 Unclassified 1641
68 Ga0070707_100213637 3300005468 Bacteria 1880
69 Ga0070707_100370302 3300005468 Bacteria 1392
70 Ga0070698_100026431 3300005471 Bacteria 6042
71 Ga0070698_100107326 3300005471 Bacteria 2760
72 Ga0070697_100032903 3300005536 Bacteria 4174
73 Ga0070672_100029865 3300005543 Bacteria 4091
74 Ga0070672_100030940 3300005543 Bacteria 4026
75 Ga0070672_100060235 3300005543 Bacteria 2989
76 Ga0070672_100151961 3300005543 Bacteria 1916
77 Ga0070686_100095560 3300005544 Bacteria 1997
78 Ga0070686_100173536 3300005544 Bacteria 1527
79 Ga0070695_100207360 3300005545 Bacteria 1405
80 Ga0070696_100053259 3300005546 Bacteria 2816
81 Ga0070696_100155499 3300005546 Bacteria 1681
82 Ga0070665_100020412 3300005548 Bacteria 6655
83 Ga0070704_100250041 3300005549 Unclassified 1455
84 Ga0070704_100455891 3300005549 Unclassified 1102
85 Ga0070664_100005998 3300005564 Bacteria 9823
86 Ga0070664_100007088 3300005564 Bacteria 9044
87 Ga0068854_100004621 3300005578 Bacteria 8685
88 Ga0068854_100047278 3300005578 Bacteria 3066
89 Ga0068854_100323024 3300005578 Bacteria 1255
90 Ga0070702_100004659 3300005615 Bacteria 6288
91 Ga0070702_100065594 3300005615 Bacteria 2127
92 Ga0068859_100129935 3300005617 Bacteria 2590
93 Ga0068859_100134559 3300005617 Unclassified 2544
94 Ga0068859_100167113 3300005617 Bacteria 2280
95 Ga0068859_100270459 3300005617 Bacteria 1791
96 Ga0068859_100379048 3300005617 Bacteria 1510
97 Ga0068859_100598325 3300005617 Bacteria 1196
98 Ga0068866_10012151 3300005718 Bacteria 3748
99 Ga0068861_100007306 3300005719 Bacteria 7569
100 Ga0068861_100007846 3300005719 Bacteria 7341
101 Ga0068861_100018833 3300005719 Bacteria 4922
102 Ga0068861_100116748 3300005719 Bacteria 2146
103 Ga0068861_100150787 3300005719 Bacteria 1907
104 Ga0068870_10001125 3300005840 Bacteria 10667
105 Ga0068863_100012883 3300005841 Bacteria 8064
106 Ga0068863_100159183 3300005841 Bacteria 2163
107 Ga0068858_100005842 3300005842 Bacteria 12022
108 Ga0068858_100019331 3300005842 Bacteria 6370
109 Ga0068858_100030641 3300005842 Bacteria 4995
110 Ga0068858_100049880 3300005842 Bacteria 3875
111 Ga0068860_100013169 3300005843 Bacteria 8116
112 Ga0068860_100031965 3300005843 Bacteria 5060
113 Ga0068860_100065177 3300005843 Bacteria 3460
114 Ga0068860_100126485 3300005843 Bacteria 2450
115 Ga0068860_100191264 3300005843 Bacteria 1980
116 Ga0068860_100257702 3300005843 Bacteria 1700
117 Ga0068862_100007993 3300005844 Bacteria 8751
118 Ga0068862_100170762 3300005844 Unclassified 1947
119 Ga0075432_10007994 3300006058 Unclassified 3608
120 Ga0097621_100008977 3300006237 Bacteria 7231
121 Ga0068871_100012290 3300006358 Bacteria 6307
122 Ga0068871_100114348 3300006358 Bacteria 2273
123 Ga0068871_100157293 3300006358 Unclassified 1942
124 Ga0075428_100000010 3300006844 Bacteria 213631
125 Ga0075428_100450406 3300006844 Bacteria 1379
126 Ga0075430_100003568 3300006846 Bacteria 13039
127 Ga0075431_100017648 3300006847 Bacteria 7256
128 Ga0075431_100088408 3300006847 Unclassified 3197
129 Ga0075431_100174753 3300006847 Unclassified 2206
130 Ga0075433_10002959 3300006852 Bacteria 13041
131 Ga0075433_10005616 3300006852 Bacteria 9859
132 Ga0075433_10015200 3300006852 Bacteria 6308
133 Ga0075434_100008263 3300006871 Bacteria 9667
134 Ga0075434_100010218 3300006871 Bacteria 8791
135 Ga0075434_100430180 3300006871 Unclassified 1341
136 Ga0075429_100018356 3300006880 Bacteria 6058
137 Ga0068865_100008969 3300006881 Bacteria 6189
138 Ga0068865_100041534 3300006881 Bacteria 3130
139 Ga0068865_100090078 3300006881 Bacteria 2223
140 Ga0068865_100203295 3300006881 Bacteria 1539
141 Ga0075436_100002423 3300006914 Bacteria 12858
142 Ga0097620_100129935 3300006931 Bacteria 2590
143 Ga0097620_100134557 3300006931 Unclassified 2544
144 Ga0097620_100167111 3300006931 Bacteria 2280
145 Ga0097620_100270467 3300006931 Bacteria 1791
146 Ga0097620_100379017 3300006931 Bacteria 1510
147 Ga0097620_100598242 3300006931 Bacteria 1196
148 Ga0075435_100000051 3300007076 Bacteria 59038
149 Ga0075435_100006302 3300007076 Bacteria 8379
150 Ga0075435_100093881 3300007076 Bacteria 2479
151 Ga0111539_10000001 3300009094 Bacteria 1035431
152 Ga0111539_10006826 3300009094 Bacteria 14678
153 Ga0111539_10006996 3300009094 Bacteria 14470
154 Ga0111539_10012720 3300009094 Bacteria 10540
155 Ga0111539_10026937 3300009094 Bacteria 7022
156 Ga0111539_10027956 3300009094 Bacteria 6887
157 Ga0111539_10077012 3300009094 Bacteria 3926
158 Ga0111539_10095444 3300009094 Bacteria 3493
159 Ga0111539_10239107 3300009094 Bacteria 2114
160 Ga0111539_10288142 3300009094 Viruses 1911
161 Ga0111539_10349292 3300009094 Unclassified 1721
162 Ga0105245_10325583 3300009098 Bacteria 1515
163 Ga0105245_10372787 3300009098 Bacteria 1419
164 Ga0105247_10142335 3300009101 Bacteria 1573
165 Ga0114129_10005134 3300009147 Bacteria 18429
166 Ga0114129_10012603 3300009147 Bacteria 12037
167 Ga0114129_10016056 3300009147 Bacteria 10651
168 Ga0114129_10016482 3300009147 Bacteria 10518
169 Ga0114129_10174916 3300009147 Bacteria 2924
170 Ga0105243_10010517 3300009148 Bacteria 7025
171 Ga0105241_10025773 3300009174 Bacteria 4371
172 Ga0105242_10012036 3300009176 Bacteria 6659
173 Ga0105242_10114026 3300009176 Bacteria 2309
174 Ga0105248_10011934 3300009177 Bacteria 9583
175 Ga0105248_10017857 3300009177 Bacteria 7829
176 Ga0105248_10070437 3300009177 Bacteria 3927
177 Ga0105248_10172122 3300009177 Bacteria 2441
178 Ga0105248_10238395 3300009177 Bacteria 2048
179 Ga0105248_10301701 3300009177 Unclassified 1804
180 Ga0105238_10014276 3300009551 Bacteria 8028
181 Ga0105249_10310314 3300009553 Bacteria 1585
182 Ga0163162_10006792 3300013306 Bacteria 11100
183 Ga0163162_10117792 3300013306 Unclassified 2758
184 Ga0157375_10008338 3300013308 Bacteria 9077
185 Ga0157375_10106938 3300013308 Unclassified 2890
186 Ga0163163_10001162 3300014325 Bacteria 22395
187 Ga0163163_10469814 3300014325 Bacteria 1318
188 Ga0157380_10001150 3300014326 Bacteria 17085
189 Ga0157380_10003729 3300014326 Bacteria 10482
190 Ga0157380_10007303 3300014326 Bacteria 7843
191 Ga0157380_10066115 3300014326 Bacteria 2907
192 Ga0157380_10259106 3300014326 Bacteria 1579
193 Ga0157380_10262959 3300014326 Bacteria 1568
194 Ga0157377_10001921 3300014745 Bacteria 9096
195 Ga0157377_10008368 3300014745 Bacteria 5043
196 Ga0157377_10164271 3300014745 Bacteria 1383
197 Ga0157379_10036316 3300014968 Unclassified 4394
198 Ga0157379_10090672 3300014968 Bacteria 2742
199 Ga0157376_10129299 3300014969 Bacteria 2251
200 Ga0163161_10158810 3300017792 Bacteria 1723
201 Ga0213876_10023736 3300021384 Bacteria 3237
202 Ga0207697_10003717 3300025315 Bacteria 7468
203 Ga0207682_10000612 3300025893 Bacteria 16611
204 Ga0207682_10006704 3300025893 Unclassified 4624
205 Ga0207682_10036023 3300025893 Bacteria 2001
206 Ga0207688_10000544 3300025901 Bacteria 18348
207 Ga0207688_10052691 3300025901 Unclassified 2281
208 Ga0207680_10008873 3300025903 Bacteria 4957
209 Ga0207680_10181632 3300025903 Unclassified 1423
210 Ga0207699_10020965 3300025906 Bacteria 3513
211 Ga0207645_10005333 3300025907 Bacteria 9346
212 Ga0207645_10040845 3300025907 Bacteria 2971
213 Ga0207645_10049298 3300025907 Bacteria 2689
214 Ga0207645_10189893 3300025907 Unclassified 1350
215 Ga0207643_10000450 3300025908 Bacteria 26721
216 Ga0207643_10028246 3300025908 Bacteria 3114
217 Ga0207643_10033392 3300025908 Bacteria 2879
218 Ga0207662_10045298 3300025918 Bacteria 2600
219 Ga0207662_10095445 3300025918 Unclassified 1835
220 Ga0207649_10097462 3300025920 Bacteria 1939
221 Ga0207646_10286236 3300025922 Bacteria 1489
222 Ga0207681_10011515 3300025923 Bacteria 5433
223 Ga0207681_10016018 3300025923 Bacteria 4682
224 Ga0207681_10028379 3300025923 Bacteria 3624
225 Ga0207681_10037875 3300025923 Bacteria 3191
226 Ga0207681_10057016 3300025923 Bacteria 2667
227 Ga0207650_10032990 3300025925 Bacteria 3748
228 Ga0207650_10105635 3300025925 Unclassified 2174
229 Ga0207650_10173483 3300025925 Unclassified 1715
230 Ga0207659_10010250 3300025926 Bacteria 5881
231 Ga0207659_10020797 3300025926 Bacteria 4344
232 Ga0207659_10033958 3300025926 Bacteria 3515
233 Ga0207659_10092574 3300025926 Unclassified 2260
234 Ga0207659_10093558 3300025926 Bacteria 2250
235 Ga0207659_10121146 3300025926 Unclassified 2005
236 Ga0207659_10143166 3300025926 Unclassified 1858
237 Ga0207700_10076889 3300025928 Bacteria 2592
238 Ga0207664_10114445 3300025929 Bacteria 2248
239 Ga0207644_10037948 3300025931 Bacteria 3391
240 Ga0207644_10039956 3300025931 Bacteria 3313
241 Ga0207706_10008269 3300025933 Bacteria 9601
242 Ga0207706_10092922 3300025933 Bacteria 2653
243 Ga0207706_10162294 3300025933 Bacteria 1964
244 Ga0207706_10233376 3300025933 Unclassified 1609
245 Ga0207686_10030317 3300025934 Bacteria 3200
246 Ga0207686_10083195 3300025934 Bacteria 2094
247 Ga0207709_10007799 3300025935 Bacteria 5935
248 Ga0207670_10043037 3300025936 Bacteria 2980
249 Ga0207670_10080936 3300025936 Bacteria 2272
250 Ga0207670_10161192 3300025936 Bacteria 1674
251 Ga0207670_10261357 3300025936 Bacteria 1342
252 Ga0207670_10322962 3300025936 Unclassified 1215
253 Ga0207669_10010986 3300025937 Bacteria 4385
254 Ga0207704_10031348 3300025938 Bacteria 2993
255 Ga0207704_10170243 3300025938 Bacteria 1561
256 Ga0207691_10007325 3300025940 Bacteria 10643
257 Ga0207691_10019192 3300025940 Bacteria 6473
258 Ga0207691_10037038 3300025940 Bacteria 4518
259 Ga0207691_10055728 3300025940 Bacteria 3602
260 Ga0207691_10077975 3300025940 Bacteria 2983
261 Ga0207691_10152231 3300025940 Bacteria 2033
262 Ga0207711_10009194 3300025941 Bacteria 8255
263 Ga0207711_10009762 3300025941 Bacteria 7985
264 Ga0207711_10124127 3300025941 Bacteria 2308
265 Ga0207711_10152007 3300025941 Unclassified 2089
266 Ga0207711_10188107 3300025941 Unclassified 1881
267 Ga0207689_10001850 3300025942 Bacteria 20023
268 Ga0207689_10004538 3300025942 Bacteria 12567
269 Ga0207689_10076286 3300025942 Unclassified 2756
270 Ga0207689_10086039 3300025942 Unclassified 2583
271 Ga0207679_10014671 3300025945 Bacteria 5158
272 Ga0207679_10099080 3300025945 Bacteria 2275
273 Ga0207651_10043947 3300025960 Unclassified 2986
274 Ga0207651_10050737 3300025960 Bacteria 2819
275 Ga0207651_10099691 3300025960 Bacteria 2152
276 Ga0207651_10175572 3300025960 Bacteria 1694
277 Ga0207712_10004928 3300025961 Bacteria 8438
278 Ga0207712_10294914 3300025961 Unclassified 1329
279 Ga0207668_10057831 3300025972 Bacteria 2707
280 Ga0207640_10004709 3300025981 Bacteria 7409
281 Ga0207640_10039065 3300025981 Bacteria 3001
282 Ga0207640_10140601 3300025981 Bacteria 1759
283 Ga0207658_10003584 3300025986 Bacteria 10965
284 Ga0207658_10251368 3300025986 Bacteria 1502
285 Ga0207703_10111368 3300026035 Bacteria 2336
286 Ga0207703_10259334 3300026035 Bacteria 1571
287 Ga0207678_10055307 3300026067 Bacteria 3419
288 Ga0207678_10124741 3300026067 Unclassified 2197
289 Ga0207708_10016789 3300026075 Bacteria 5510
290 Ga0207708_10054299 3300026075 Unclassified 3054
291 Ga0207708_10063732 3300026075 Unclassified 2816
292 Ga0207708_10086865 3300026075 Bacteria 2407
293 Ga0207641_10005952 3300026088 Bacteria 10336
294 Ga0207641_10263331 3300026088 Bacteria 1615
295 Ga0207648_10000587 3300026089 Bacteria 40789
296 Ga0207648_10011991 3300026089 Bacteria 8135
297 Ga0207648_10074851 3300026089 Bacteria 2952
298 Ga0207648_10083494 3300026089 Unclassified 2786
299 Ga0207648_10088971 3300026089 Bacteria 2696
300 Ga0207676_10027281 3300026095 Bacteria 4253
301 Ga0207674_10152920 3300026116 Unclassified 2264
302 Ga0207675_100005152 3300026118 Bacteria 12589
303 Ga0207675_100007972 3300026118 Bacteria 9987
304 Ga0207675_100018088 3300026118 Bacteria 6571
305 Ga0207675_100044003 3300026118 Bacteria 4170
306 Ga0207675_100101807 3300026118 Unclassified 2706
307 Ga0207683_10007274 3300026121 Bacteria 9487
308 Ga0207683_10011349 3300026121 Bacteria 7602
309 Ga0207683_10028920 3300026121 Bacteria 4796
310 Ga0207428_10000002 3300027907 Bacteria 854851
311 Ga0207428_10004546 3300027907 Bacteria 13153
312 Ga0207428_10005192 3300027907 Bacteria 12179
313 Ga0207428_10010042 3300027907 Bacteria 8472
314 Ga0207428_10012794 3300027907 Bacteria 7360
315 Ga0207428_10072623 3300027907 Bacteria 2700
316 Ga0207428_10109367 3300027907 Bacteria 2128
317 Ga0207428_10223401 3300027907 Bacteria 1411
318 Ga0268265_10114163 3300028380 Bacteria 2211
319 Ga0268265_10185994 3300028380 Unclassified 1789
320 Ga0268264_10044165 3300028381 Bacteria 3696
321 Ga0268264_10096586 3300028381 Bacteria 2560
322 Ga0268264_10106076 3300028381 Bacteria 2452
323 Ga0268264_10232816 3300028381 Bacteria 1702
324 Ga0268264_10477171 3300028381 Bacteria 1212
325 Ga0265338_10019135 3300028800 Bacteria 7287
326 Ga0265760_10007227 3300031090 Bacteria 3181
327 Ga0265325_10027288 3300031241 Bacteria 3086
328 Ga0265339_10000077 3300031249 Bacteria 84288
329 Ga0265313_10002022 3300031595 Bacteria 18190
330 Ga0373959_0018650 3300034820 Bacteria 1307
331 Ga0373934_0122866 3300035086 Unclassified 1056
332 Ga0373951_0001996 3300035091 Bacteria 5223
333 Ga0373952_0014584 3300035092 Bacteria 1575
334 Ga0373939_0000138 3300035114 Bacteria 20969
335 Ga0373941_0000086 3300035115 Bacteria 15129
336 Ga0373945_0052217 3300035116 Unclassified 1506
337 Ga0373942_0001119 3300035207 Bacteria 7120
338 Ga0373931_0002913 3300035691 Bacteria 7634
339 Ga0373935_0219990 3300035692 Unclassified 1319
340 Ga0373935_0222364 3300035692 Bacteria 1312
341 Ga0373947_0043570 3300035725 Bacteria 2681
342 Ga0373937_0102438 3300036401 Bacteria 2658
343 Ga0373937_0307533 3300036401 Bacteria 1499
344 Ga0373925_0105114 3300037068 Unclassified 2175
345 Ga0373925_0348975 3300037068 Bacteria 1201
346 Ga0436365_0075922 3300039437 Bacteria 8900
347 Ga0451800_0432438 3300041459 Bacteria 1407
348 Ga0466957_0136256 3300044842 Bacteria 1578
349 Ga0466959_0051535 3300045049 Bacteria 3018
350 Ga0451576_0010342 3300045051 Bacteria 10713
351 Ga0495603_0286590 3300046455 Bacteria 946
352 Ga0495629_0302837 3300046459 Bacteria 1094
353 Ga0495618_0285296 3300046514 Bacteria 1029
354 Ga0495628_0389925 3300046516 Bacteria 1019
355 Ga0495586_0107758 3300046535 Unclassified 1550
356 Ga0495621_0075891 3300046539 Bacteria 1246
357 Ga0495656_0013621 3300046615 Bacteria 3030
358 Ga0495656_0034559 3300046615 Unclassified 2071
359 Ga0495634_0076419 3300046642 Bacteria 2198
360 Ga0495581_0183820 3300047315 Unclassified 1223
361 Ga0496104_0170476 3300048907 Bacteria 2087
362 Ga0496106_0183841 3300048909 Bacteria 1660
363 Ga0496106_0234394 3300048909 Unclassified 1466
364 Ga0496108_0121719 3300048911 Bacteria 2239
365 Ga0496109_0420013 3300048912 Unclassified 1263
366 Ga0496109_0469751 3300048912 Bacteria 1188
367 Ga0496113_0186758 3300048916 Unclassified 1644
368 Ga0496114_0061672 3300048917 Bacteria 3137
369 Ga0496114_0198501 3300048917 Bacteria 1757
370 nmdc:mga05p37_130790_c1 3300050507 Bacteria 3080
371 nmdc:mga05p37_147673_c1 3300050507 Bacteria 2878
372 nmdc:mga05p37_19261_c1 3300050507 Bacteria 8254
373 nmdc:mga05p37_2403_c1 3300050507 Bacteria 21790
374 nmdc:mga05p37_24040_c1 3300050507 Bacteria 7401
375 nmdc:mga05p37_33283_c1 3300050507 Bacteria 5490
376 nmdc:mga05p37_6100_c1 3300050507 Bacteria 14194
377 nmdc:mga05p37_87303_c1 3300050507 Bacteria 3844
378 nmdc:mga09592_10502_c1 3300050508 Bacteria 7533
379 nmdc:mga09592_193896_c1 3300050508 Bacteria 1759
380 nmdc:mga0qj67_211348_c1 3300050509 Unclassified 1576
381 nmdc:mga0qj67_41075_c1 3300050509 Unclassified 3637
382 nmdc:mga06r32_6729_c1 3300050510 Bacteria 10327
383 nmdc:mga06r32_73194_c1 3300050510 Bacteria 3319
384 nmdc:mga08y16_131460_c1 3300050511 Bacteria 2603
385 nmdc:mga08y16_139052_c1 3300050511 Bacteria 2525
386 nmdc:mga08y16_170921_c1 3300050511 Bacteria 2258
387 nmdc:mga08y16_233959_c1 3300050511 Bacteria 1900
388 nmdc:mga08y16_3415_c1 3300050511 Bacteria 16476
389 nmdc:mga08y16_374732_c1 3300050511 Bacteria 1460
390 nmdc:mga08y16_389342_c1 3300050511 Bacteria 1428
391 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
392 nmdc:mga08y16_60250_c1 3300050511 Bacteria 3965
393 nmdc:mga08y16_82119_c1 3300050511 Bacteria 3360
394 nmdc:mga0n895_100798_c1 3300050512 Bacteria 2897
395 nmdc:mga0n895_301061_c1 3300050512 Unclassified 1625
396 nmdc:mga0n895_455275_c1 3300050512 Bacteria 1292
397 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
398 nmdc:mga0n895_62639_c1 3300050512 Bacteria 3677
399 nmdc:mga0n895_67535_c1 3300050512 Bacteria 3541
400 nmdc:mga0n895_7309_c1 3300050512 Bacteria 9468
401 nmdc:mga0n895_89936_c1 3300050512 Bacteria 3071
402 nmdc:mga0rr50_140565_c1 3300050513 Bacteria 1942
403 nmdc:mga0rr50_1728_c1 3300050513 Bacteria 12046
404 nmdc:mga0rr50_42595_c1 3300050513 Bacteria 3316
405 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
406 nmdc:mga08x19_3412_c1 3300050514 Bacteria 9477
407 nmdc:mga0a205_103810_c1 3300050515 Bacteria 2741
408 nmdc:mga0a205_138443_c1 3300050515 Bacteria 2334
409 nmdc:mga0a205_14685_c1 3300050515 Bacteria 7307
410 nmdc:mga0a205_207428_c1 3300050515 Bacteria 1849
411 nmdc:mga0a205_291612_c1 3300050515 Bacteria 1506
412 nmdc:mga0a205_627_c1 3300050515 Bacteria 28069
413 Ga0500568_0019049 3300053139 Bacteria 2992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046514 Ga0495618_0285296 Ga0495618_0285296_141_1016 285
2 3300046455 Ga0495603_0286590 Ga0495603_0286590_27_905 289
3 3300046459 Ga0495629_0302837 Ga0495629_0302837_43_948 292
4 3300028800 Ga0265338_10019135 Ga0265338_100191352 307
5 3300031241 Ga0265325_10027288 Ga0265325_100272883 307
6 3300031249 Ga0265339_10000077 Ga0265339_1000007732 307
7 3300031595 Ga0265313_10002022 Ga0265313_100020222 307
8 3300005435 Ga0070714_100065911 Ga0070714_1000659111 316
9 3300025929 Ga0207664_10114445 Ga0207664_101144451 316
10 3300044842 Ga0466957_0136256 Ga0466957_0136256_46_1197 316
11 3300045049 Ga0466959_0051535 Ga0466959_0051535_367_1518 316
12 3300050512 nmdc:mga0n895_67535_c1 nmdc:mga0n895_67535_c1_2111_3154 317
13 3300005617 Ga0068859_100129935 Ga0068859_1001299352 320
14 3300005843 Ga0068860_100126485 Ga0068860_1001264852 320
15 3300006931 Ga0097620_100129935 Ga0097620_1001299352 320
16 3300028381 Ga0268264_10044165 Ga0268264_100441653 320
17 3300025908 Ga0207643_10028246 Ga0207643_100282462 323
18 3300005617 Ga0068859_100167113 Ga0068859_1001671131 325
19 3300006931 Ga0097620_100167111 Ga0097620_1001671111 325
20 3300005841 Ga0068863_100159183 Ga0068863_1001591832 326
21 3300026088 Ga0207641_10263331 Ga0207641_102633312 326
22 3300005617 Ga0068859_100270459 Ga0068859_1002704591 327
23 3300005617 Ga0068859_100379048 Ga0068859_1003790482 327
24 3300006931 Ga0097620_100270467 Ga0097620_1002704671 327
25 3300006931 Ga0097620_100379017 Ga0097620_1003790172 327
26 3300021384 Ga0213876_10023736 Ga0213876_100237363 327
27 3300009177 Ga0105248_10238395 Ga0105248_102383952 328
28 3300031090 Ga0265760_10007227 Ga0265760_100072273 328
29 3300036401 Ga0373937_0307533 Ga0373937_0307533_171_1208 328
30 3300046516 Ga0495628_0389925 Ga0495628_0389925_22_1008 328
31 3300005843 Ga0068860_100257702 Ga0068860_1002577022 329
32 3300009094 Ga0111539_10288142 Ga0111539_102881422 330
33 3300025928 Ga0207700_10076889 Ga0207700_100768892 330
34 3300006358 Ga0068871_100012290 Ga0068871_1000122904 332
35 3300006881 Ga0068865_100041534 Ga0068865_1000415342 332
36 3300009176 Ga0105242_10012036 Ga0105242_100120363 332
37 3300014969 Ga0157376_10129299 Ga0157376_101292993 332
38 3300025934 Ga0207686_10030317 Ga0207686_100303173 332
39 3300025938 Ga0207704_10031348 Ga0207704_100313482 332
40 3300026089 Ga0207648_10088971 Ga0207648_100889713 332
41 3300048917 Ga0496114_0061672 Ga0496114_0061672_1889_2917 332
42 3300005434 Ga0070709_10015553 Ga0070709_100155533 333
43 3300009177 Ga0105248_10017857 Ga0105248_100178576 333
44 3300009177 Ga0105248_10070437 Ga0105248_100704372 333
45 3300025906 Ga0207699_10020965 Ga0207699_100209652 333
46 3300025941 Ga0207711_10152007 Ga0207711_101520072 333
47 3300035692 Ga0373935_0222364 Ga0373935_0222364_34_1071 333
48 3300037068 Ga0373925_0348975 Ga0373925_0348975_47_1084 333
49 3300048909 Ga0496106_0183841 Ga0496106_0183841_516_1520 333
50 3300048916 Ga0496113_0186758 Ga0496113_0186758_156_1163 334
51 3300035692 Ga0373935_0219990 Ga0373935_0219990_129_1211 335
52 3300035725 Ga0373947_0043570 Ga0373947_0043570_407_1489 335
53 3300037068 Ga0373925_0105114 Ga0373925_0105114_243_1325 335
54 3300039437 Ga0436365_0075922 Ga0436365_0075922_5920_6999 335
55 3300047315 Ga0495581_0183820 Ga0495581_0183820_93_1175 335
56 3300053139 Ga0500568_0019049 Ga0500568_0019049_337_1416 335
57 3300005334 Ga0068869_100019838 Ga0068869_1000198383 336
58 3300005353 Ga0070669_100008836 Ga0070669_1000088362 336
59 3300005354 Ga0070675_100085382 Ga0070675_1000853823 336
60 3300005364 Ga0070673_100005652 Ga0070673_1000056529 336
61 3300005364 Ga0070673_100136946 Ga0070673_1001369461 336
62 3300005367 Ga0070667_100356983 Ga0070667_1003569831 336
63 3300005438 Ga0070701_10034663 Ga0070701_100346631 336
64 3300005456 Ga0070678_100142491 Ga0070678_1001424913 336
65 3300005459 Ga0068867_100014749 Ga0068867_1000147493 336
66 3300005543 Ga0070672_100151961 Ga0070672_1001519613 336
67 3300005615 Ga0070702_100065594 Ga0070702_1000655942 336
68 3300005718 Ga0068866_10012151 Ga0068866_100121513 336
69 3300005719 Ga0068861_100018833 Ga0068861_1000188332 336
70 3300005842 Ga0068858_100049880 Ga0068858_1000498802 336
71 3300005843 Ga0068860_100191264 Ga0068860_1001912642 336
72 3300006881 Ga0068865_100008969 Ga0068865_1000089692 336
73 3300009094 Ga0111539_10006996 Ga0111539_1000699612 336
74 3300009148 Ga0105243_10010517 Ga0105243_100105174 336
75 3300014326 Ga0157380_10007303 Ga0157380_100073035 336
76 3300025907 Ga0207645_10049298 Ga0207645_100492983 336
77 3300025918 Ga0207662_10095445 Ga0207662_100954453 336
78 3300025923 Ga0207681_10016018 Ga0207681_100160182 336
79 3300025926 Ga0207659_10093558 Ga0207659_100935583 336
80 3300025934 Ga0207686_10083195 Ga0207686_100831952 336
81 3300025935 Ga0207709_10007799 Ga0207709_100077995 336
82 3300025938 Ga0207704_10170243 Ga0207704_101702431 336
83 3300025940 Ga0207691_10152231 Ga0207691_101522313 336
84 3300025942 Ga0207689_10004538 Ga0207689_100045385 336
85 3300025960 Ga0207651_10175572 Ga0207651_101755722 336
86 3300025986 Ga0207658_10251368 Ga0207658_102513681 336
87 3300026035 Ga0207703_10111368 Ga0207703_101113683 336
88 3300026089 Ga0207648_10000587 Ga0207648_1000058718 336
89 3300026118 Ga0207675_100044003 Ga0207675_1000440034 336
90 3300027907 Ga0207428_10012794 Ga0207428_100127945 336
91 3300028381 Ga0268264_10232816 Ga0268264_102328162 336
92 3300050511 nmdc:mga08y16_139052_c1 nmdc:mga08y16_139052_c1_1123_2166 336
93 3300005356 Ga0070674_100007785 Ga0070674_1000077853 337
94 3300005365 Ga0070688_100135104 Ga0070688_1001351042 337
95 3300005456 Ga0070678_100003477 Ga0070678_1000034776 337
96 3300005543 Ga0070672_100030940 Ga0070672_1000309402 337
97 3300025893 Ga0207682_10036023 Ga0207682_100360232 337
98 3300025903 Ga0207680_10181632 Ga0207680_101816321 337
99 3300025923 Ga0207681_10037875 Ga0207681_100378752 337
100 3300025936 Ga0207670_10322962 Ga0207670_103229621 337
101 3300025937 Ga0207669_10010986 Ga0207669_100109863 337
102 3300025940 Ga0207691_10055728 Ga0207691_100557283 337
103 3300025960 Ga0207651_10099691 Ga0207651_100996912 337
104 3300026121 Ga0207683_10007274 Ga0207683_100072745 337
105 3300009094 Ga0111539_10077012 Ga0111539_100770122 338
106 3300027907 Ga0207428_10072623 Ga0207428_100726232 338
107 3300034820 Ga0373959_0018650 Ga0373959_0018650_181_1206 338
108 3300035091 Ga0373951_0001996 Ga0373951_0001996_1250_2275 338
109 3300035092 Ga0373952_0014584 Ga0373952_0014584_132_1157 338
110 3300035114 Ga0373939_0000138 Ga0373939_0000138_10481_11506 338
111 3300035115 Ga0373941_0000086 Ga0373941_0000086_7113_8138 338
112 3300035207 Ga0373942_0001119 Ga0373942_0001119_2156_3181 338
113 3300035691 Ga0373931_0002913 Ga0373931_0002913_1026_2051 338
114 3300045051 Ga0451576_0010342 Ga0451576_0010342_5765_6790 338
115 3300050511 nmdc:mga08y16_60250_c1 nmdc:mga08y16_60250_c1_2153_3187 338
116 3300005331 Ga0070670_100044571 Ga0070670_1000445713 339
117 3300005333 Ga0070677_10006598 Ga0070677_100065983 339
118 3300005340 Ga0070689_100062842 Ga0070689_1000628421 339
119 3300005344 Ga0070661_100085115 Ga0070661_1000851152 339
120 3300005354 Ga0070675_100185525 Ga0070675_1001855252 339
121 3300005354 Ga0070675_100203263 Ga0070675_1002032632 339
122 3300005355 Ga0070671_100008541 Ga0070671_1000085414 339
123 3300005364 Ga0070673_100080600 Ga0070673_1000806002 339
124 3300005366 Ga0070659_100334383 Ga0070659_1003343831 339
125 3300005543 Ga0070672_100029865 Ga0070672_1000298654 339
126 3300005564 Ga0070664_100007088 Ga0070664_1000070882 339
127 3300005578 Ga0068854_100004621 Ga0068854_1000046219 339
128 3300006358 Ga0068871_100157293 Ga0068871_1001572933 339
129 3300009101 Ga0105247_10142335 Ga0105247_101423351 339
130 3300009174 Ga0105241_10025773 Ga0105241_100257732 339
131 3300009177 Ga0105248_10172122 Ga0105248_101721223 339
132 3300009551 Ga0105238_10014276 Ga0105238_100142765 339
133 3300009553 Ga0105249_10310314 Ga0105249_103103143 339
134 3300014325 Ga0163163_10001162 Ga0163163_1000116218 339
135 3300014745 Ga0157377_10164271 Ga0157377_101642712 339
136 3300025903 Ga0207680_10008873 Ga0207680_100088732 339
137 3300025908 Ga0207643_10033392 Ga0207643_100333922 339
138 3300025920 Ga0207649_10097462 Ga0207649_100974622 339
139 3300025925 Ga0207650_10032990 Ga0207650_100329902 339
140 3300025926 Ga0207659_10010250 Ga0207659_100102504 339
141 3300025926 Ga0207659_10143166 Ga0207659_101431663 339
142 3300025931 Ga0207644_10037948 Ga0207644_100379482 339
143 3300025936 Ga0207670_10261357 Ga0207670_102613571 339
144 3300025940 Ga0207691_10037038 Ga0207691_100370384 339
145 3300025940 Ga0207691_10077975 Ga0207691_100779753 339
146 3300025941 Ga0207711_10124127 Ga0207711_101241271 339
147 3300025945 Ga0207679_10099080 Ga0207679_100990802 339
148 3300025960 Ga0207651_10050737 Ga0207651_100507372 339
149 3300025981 Ga0207640_10004709 Ga0207640_100047092 339
150 3300041459 Ga0451800_0432438 Ga0451800_0432438_127_1170 339
151 3300048909 Ga0496106_0234394 Ga0496106_0234394_363_1391 339
152 3300048917 Ga0496114_0198501 Ga0496114_0198501_718_1746 339
153 3300050511 nmdc:mga08y16_389342_c1 nmdc:mga08y16_389342_c1_354_1388 339
154 3300050512 nmdc:mga0n895_100798_c1 nmdc:mga0n895_100798_c1_294_1322 339
155 3300050513 nmdc:mga0rr50_1728_c1 nmdc:mga0rr50_1728_c1_2192_3220 339
156 3300005549 Ga0070704_100455891 Ga0070704_1004558911 340
157 3300050507 nmdc:mga05p37_2403_c1 nmdc:mga05p37_2403_c1_1156_2181 340
158 3300050515 nmdc:mga0a205_207428_c1 nmdc:mga0a205_207428_c1_800_1825 340
159 3300007076 Ga0075435_100006302 Ga0075435_1000063028 341
160 3300035086 Ga0373934_0122866 Ga0373934_0122866_14_1039 341
161 3300035116 Ga0373945_0052217 Ga0373945_0052217_94_1119 341
162 3300036401 Ga0373937_0102438 Ga0373937_0102438_133_1158 341
163 3300048907 Ga0496104_0170476 Ga0496104_0170476_1043_2068 341
164 3300026118 Ga0207675_100101807 Ga0207675_1001018072 342
165 3300005290 Ga0065712_10071066 Ga0065712_100710662 343
166 3300005293 Ga0065715_10118072 Ga0065715_101180722 343
167 3300005330 Ga0070690_100099025 Ga0070690_1000990251 343
168 3300005336 Ga0070680_100225868 Ga0070680_1002258682 343
169 3300005354 Ga0070675_100100998 Ga0070675_1001009982 343
170 3300005364 Ga0070673_100040644 Ga0070673_1000406441 343
171 3300005365 Ga0070688_100132115 Ga0070688_1001321152 343
172 3300005544 Ga0070686_100173536 Ga0070686_1001735361 343
173 3300005719 Ga0068861_100116748 Ga0068861_1001167482 343
174 3300005842 Ga0068858_100005842 Ga0068858_10000584211 343
175 3300006847 Ga0075431_100088408 Ga0075431_1000884083 343
176 3300006847 Ga0075431_100174753 Ga0075431_1001747532 343
177 3300006852 Ga0075433_10005616 Ga0075433_100056167 343
178 3300006852 Ga0075433_10015200 Ga0075433_100152004 343
179 3300006871 Ga0075434_100008263 Ga0075434_1000082637 343
180 3300006871 Ga0075434_100010218 Ga0075434_1000102187 343
181 3300006871 Ga0075434_100430180 Ga0075434_1004301801 343
182 3300007076 Ga0075435_100093881 Ga0075435_1000938812 343
183 3300009094 Ga0111539_10006826 Ga0111539_100068262 343
184 3300009094 Ga0111539_10026937 Ga0111539_100269375 343
185 3300014745 Ga0157377_10008368 Ga0157377_100083683 343
186 3300025901 Ga0207688_10052691 Ga0207688_100526912 343
187 3300025907 Ga0207645_10189893 Ga0207645_101898931 343
188 3300025926 Ga0207659_10033958 Ga0207659_100339581 343
189 3300025926 Ga0207659_10121146 Ga0207659_101211462 343
190 3300025933 Ga0207706_10092922 Ga0207706_100929222 343
191 3300025936 Ga0207670_10080936 Ga0207670_100809362 343
192 3300025941 Ga0207711_10009762 Ga0207711_100097623 343
193 3300025942 Ga0207689_10086039 Ga0207689_100860392 343
194 3300026067 Ga0207678_10124741 Ga0207678_101247412 343
195 3300026121 Ga0207683_10028920 Ga0207683_100289202 343
196 3300027907 Ga0207428_10004546 Ga0207428_100045462 343
197 3300027907 Ga0207428_10010042 Ga0207428_100100423 343
198 3300046535 Ga0495586_0107758 Ga0495586_0107758_134_1165 343
199 3300046539 Ga0495621_0075891 Ga0495621_0075891_191_1225 343
200 3300046615 Ga0495656_0013621 Ga0495656_0013621_795_1829 343
201 3300046642 Ga0495634_0076419 Ga0495634_0076419_481_1521 343
202 3300048912 Ga0496109_0420013 Ga0496109_0420013_21_1055 343
203 3300048912 Ga0496109_0469751 Ga0496109_0469751_102_1142 343
204 3300050507 nmdc:mga05p37_130790_c1 nmdc:mga05p37_130790_c1_916_1950 343
205 3300050507 nmdc:mga05p37_87303_c1 nmdc:mga05p37_87303_c1_2138_3172 343
206 3300050508 nmdc:mga09592_193896_c1 nmdc:mga09592_193896_c1_585_1619 343
207 3300050509 nmdc:mga0qj67_211348_c1 nmdc:mga0qj67_211348_c1_183_1217 343
208 3300050509 nmdc:mga0qj67_41075_c1 nmdc:mga0qj67_41075_c1_320_1354 343
209 3300050510 nmdc:mga06r32_6729_c1 nmdc:mga06r32_6729_c1_4299_5333 343
210 3300050511 nmdc:mga08y16_233959_c1 nmdc:mga08y16_233959_c1_712_1746 343
211 3300050511 nmdc:mga08y16_3415_c1 nmdc:mga08y16_3415_c1_5863_6897 343
212 3300050511 nmdc:mga08y16_374732_c1 nmdc:mga08y16_374732_c1_377_1411 343
213 3300050511 nmdc:mga08y16_82119_c1 nmdc:mga08y16_82119_c1_180_1214 343
214 3300050512 nmdc:mga0n895_301061_c1 nmdc:mga0n895_301061_c1_541_1572 343
215 3300050512 nmdc:mga0n895_62639_c1 nmdc:mga0n895_62639_c1_2396_3427 343
216 3300050512 nmdc:mga0n895_7309_c1 nmdc:mga0n895_7309_c1_4376_5407 343
217 3300050513 nmdc:mga0rr50_42595_c1 nmdc:mga0rr50_42595_c1_2255_3286 343
218 3300050515 nmdc:mga0a205_138443_c1 nmdc:mga0a205_138443_c1_225_1259 343
219 3300050515 nmdc:mga0a205_14685_c1 nmdc:mga0a205_14685_c1_4040_5071 343
220 3300050515 nmdc:mga0a205_627_c1 nmdc:mga0a205_627_c1_20659_21690 343
221 3300005364 Ga0070673_100016567 Ga0070673_1000165673 344
222 3300006237 Ga0097621_100008977 Ga0097621_1000089771 344
223 3300006881 Ga0068865_100203295 Ga0068865_1002032951 344
224 3300009094 Ga0111539_10239107 Ga0111539_102391072 344
225 3300009177 Ga0105248_10301701 Ga0105248_103017012 344
226 3300025933 Ga0207706_10162294 Ga0207706_101622942 344
227 3300025940 Ga0207691_10019192 Ga0207691_100191922 344
228 3300025941 Ga0207711_10188107 Ga0207711_101881072 344
229 3300025960 Ga0207651_10043947 Ga0207651_100439473 344
230 3300026095 Ga0207676_10027281 Ga0207676_100272812 344
231 3300005295 Ga0065707_10000906 Ga0065707_1000090619 345
232 3300005353 Ga0070669_100150882 Ga0070669_1001508821 345
233 3300005354 Ga0070675_100078732 Ga0070675_1000787323 345
234 3300005578 Ga0068854_100323024 Ga0068854_1003230242 345
235 3300006844 Ga0075428_100000010 Ga0075428_10000001056 345
236 3300006914 Ga0075436_100002423 Ga0075436_1000024232 345
237 3300007076 Ga0075435_100000051 Ga0075435_10000005151 345
238 3300009094 Ga0111539_10000001 Ga0111539_10000001144 345
239 3300009098 Ga0105245_10372787 Ga0105245_103727871 345
240 3300014326 Ga0157380_10262959 Ga0157380_102629591 345
241 3300025933 Ga0207706_10233376 Ga0207706_102333762 345
242 3300025981 Ga0207640_10140601 Ga0207640_101406012 345
243 3300027907 Ga0207428_10000002 Ga0207428_10000002157 345
244 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_169325_170365 345
245 3300050512 nmdc:mga0n895_4_c1 nmdc:mga0n895_4_c1_12451_13506 345
246 3300050513 nmdc:mga0rr50_4_c1 nmdc:mga0rr50_4_c1_171593_172648 345
247 3300050514 nmdc:mga08x19_3412_c1 nmdc:mga08x19_3412_c1_1852_2907 345
248 3300005353 Ga0070669_100018770 Ga0070669_1000187703 346
249 3300005440 Ga0070705_100035798 Ga0070705_1000357982 346
250 3300005444 Ga0070694_100035121 Ga0070694_1000351212 346
251 3300005546 Ga0070696_100053259 Ga0070696_1000532592 346
252 3300005549 Ga0070704_100250041 Ga0070704_1002500412 346
253 3300005578 Ga0068854_100047278 Ga0068854_1000472782 346
254 3300005615 Ga0070702_100004659 Ga0070702_1000046593 346
255 3300005719 Ga0068861_100007306 Ga0068861_1000073063 346
256 3300005842 Ga0068858_100030641 Ga0068858_1000306419 346
257 3300005843 Ga0068860_100065177 Ga0068860_1000651773 346
258 3300009147 Ga0114129_10174916 Ga0114129_101749162 346
259 3300025907 Ga0207645_10005333 Ga0207645_100053336 346
260 3300025923 Ga0207681_10011515 Ga0207681_100115154 346
261 3300025981 Ga0207640_10039065 Ga0207640_100390651 346
262 3300026075 Ga0207708_10054299 Ga0207708_100542992 346
263 3300026089 Ga0207648_10011991 Ga0207648_100119915 346
264 3300026118 Ga0207675_100007972 Ga0207675_1000079723 346
265 3300028381 Ga0268264_10106076 Ga0268264_101060763 346
266 3300050507 nmdc:mga05p37_147673_c1 nmdc:mga05p37_147673_c1_1008_2054 346
267 3300050507 nmdc:mga05p37_24040_c1 nmdc:mga05p37_24040_c1_6277_7323 346
268 3300050512 nmdc:mga0n895_89936_c1 nmdc:mga0n895_89936_c1_1974_3020 346
269 3300005290 Ga0065712_10004096 Ga0065712_100040961 347
270 3300005338 Ga0068868_100294942 Ga0068868_1002949422 347
271 3300005354 Ga0070675_100124283 Ga0070675_1001242832 347
272 3300005355 Ga0070671_100009176 Ga0070671_1000091762 347
273 3300005356 Ga0070674_100019093 Ga0070674_1000190932 347
274 3300005367 Ga0070667_100001111 Ga0070667_1000011115 347
275 3300005441 Ga0070700_100141483 Ga0070700_1001414832 347
276 3300005459 Ga0068867_100119373 Ga0068867_1001193731 347
277 3300005468 Ga0070707_100213637 Ga0070707_1002136371 347
278 3300005543 Ga0070672_100060235 Ga0070672_1000602353 347
279 3300005545 Ga0070695_100207360 Ga0070695_1002073602 347
280 3300005546 Ga0070696_100155499 Ga0070696_1001554992 347
281 3300005617 Ga0068859_100134559 Ga0068859_1001345592 347
282 3300005719 Ga0068861_100150787 Ga0068861_1001507872 347
283 3300005841 Ga0068863_100012883 Ga0068863_1000128836 347
284 3300005843 Ga0068860_100031965 Ga0068860_1000319654 347
285 3300006846 Ga0075430_100003568 Ga0075430_10000356811 347
286 3300006847 Ga0075431_100017648 Ga0075431_1000176484 347
287 3300006931 Ga0097620_100134557 Ga0097620_1001345572 347
288 3300009094 Ga0111539_10027956 Ga0111539_100279566 347
289 3300009094 Ga0111539_10349292 Ga0111539_103492922 347
290 3300009098 Ga0105245_10325583 Ga0105245_103255832 347
291 3300009147 Ga0114129_10012603 Ga0114129_1001260310 347
292 3300009147 Ga0114129_10016056 Ga0114129_100160561 347
293 3300009147 Ga0114129_10016482 Ga0114129_1001648212 347
294 3300009176 Ga0105242_10114026 Ga0105242_101140262 347
295 3300013306 Ga0163162_10117792 Ga0163162_101177922 347
296 3300013308 Ga0157375_10106938 Ga0157375_101069382 347
297 3300014325 Ga0163163_10469814 Ga0163163_104698141 347
298 3300014326 Ga0157380_10003729 Ga0157380_100037297 347
299 3300014968 Ga0157379_10090672 Ga0157379_100906722 347
300 3300025893 Ga0207682_10006704 Ga0207682_100067044 347
301 3300025907 Ga0207645_10040845 Ga0207645_100408452 347
302 3300025923 Ga0207681_10028379 Ga0207681_100283792 347
303 3300025925 Ga0207650_10105635 Ga0207650_101056352 347
304 3300025931 Ga0207644_10039956 Ga0207644_100399561 347
305 3300025936 Ga0207670_10043037 Ga0207670_100430372 347
306 3300025940 Ga0207691_10007325 Ga0207691_100073256 347
307 3300025941 Ga0207711_10009194 Ga0207711_100091948 347
308 3300025961 Ga0207712_10294914 Ga0207712_102949142 347
309 3300025986 Ga0207658_10003584 Ga0207658_100035843 347
310 3300026035 Ga0207703_10259334 Ga0207703_102593342 347
311 3300026075 Ga0207708_10063732 Ga0207708_100637322 347
312 3300026088 Ga0207641_10005952 Ga0207641_100059523 347
313 3300026089 Ga0207648_10083494 Ga0207648_100834942 347
314 3300026118 Ga0207675_100018088 Ga0207675_1000180882 347
315 3300027907 Ga0207428_10223401 Ga0207428_102234012 347
316 3300028380 Ga0268265_10114163 Ga0268265_101141632 347
317 3300028381 Ga0268264_10096586 Ga0268264_100965862 347
318 3300028381 Ga0268264_10477171 Ga0268264_104771711 347
319 3300046615 Ga0495656_0034559 Ga0495656_0034559_677_1720 347
320 3300050507 nmdc:mga05p37_33283_c1 nmdc:mga05p37_33283_c1_742_1785 347
321 3300050507 nmdc:mga05p37_6100_c1 nmdc:mga05p37_6100_c1_8180_9223 347
322 3300050510 nmdc:mga06r32_73194_c1 nmdc:mga06r32_73194_c1_1339_2385 347
323 3300005290 Ga0065712_10132014 Ga0065712_101320142 348
324 3300005293 Ga0065715_10015778 Ga0065715_100157783 348
325 3300005328 Ga0070676_10055833 Ga0070676_100558333 348
326 3300005333 Ga0070677_10021405 Ga0070677_100214052 348
327 3300005344 Ga0070661_100112112 Ga0070661_1001121122 348
328 3300005347 Ga0070668_100014867 Ga0070668_1000148674 348
329 3300005354 Ga0070675_100036660 Ga0070675_1000366602 348
330 3300005355 Ga0070671_100217727 Ga0070671_1002177272 348
331 3300005356 Ga0070674_100099372 Ga0070674_1000993723 348
332 3300005364 Ga0070673_100024138 Ga0070673_1000241382 348
333 3300005367 Ga0070667_100037373 Ga0070667_1000373733 348
334 3300005441 Ga0070700_100066597 Ga0070700_1000665971 348
335 3300005441 Ga0070700_100154339 Ga0070700_1001543392 348
336 3300005444 Ga0070694_100236237 Ga0070694_1002362372 348
337 3300005466 Ga0070685_10118418 Ga0070685_101184182 348
338 3300005468 Ga0070707_100370302 Ga0070707_1003703021 348
339 3300005471 Ga0070698_100026431 Ga0070698_1000264316 348
340 3300005471 Ga0070698_100107326 Ga0070698_1001073262 348
341 3300005536 Ga0070697_100032903 Ga0070697_1000329033 348
342 3300005544 Ga0070686_100095560 Ga0070686_1000955602 348
343 3300005564 Ga0070664_100005998 Ga0070664_1000059987 348
344 3300005617 Ga0068859_100598325 Ga0068859_1005983251 348
345 3300005844 Ga0068862_100170762 Ga0068862_1001707622 348
346 3300006058 Ga0075432_10007994 Ga0075432_100079942 348
347 3300006844 Ga0075428_100450406 Ga0075428_1004504062 348
348 3300006852 Ga0075433_10002959 Ga0075433_100029598 348
349 3300006880 Ga0075429_100018356 Ga0075429_1000183564 348
350 3300006931 Ga0097620_100598242 Ga0097620_1005982422 348
351 3300009094 Ga0111539_10012720 Ga0111539_100127202 348
352 3300009094 Ga0111539_10095444 Ga0111539_100954442 348
353 3300009147 Ga0114129_10005134 Ga0114129_1000513412 348
354 3300013306 Ga0163162_10006792 Ga0163162_100067929 348
355 3300013308 Ga0157375_10008338 Ga0157375_100083387 348
356 3300014326 Ga0157380_10001150 Ga0157380_100011508 348
357 3300014326 Ga0157380_10259106 Ga0157380_102591062 348
358 3300014745 Ga0157377_10001921 Ga0157377_100019217 348
359 3300014968 Ga0157379_10036316 Ga0157379_100363162 348
360 3300025893 Ga0207682_10000612 Ga0207682_100006123 348
361 3300025901 Ga0207688_10000544 Ga0207688_100005444 348
362 3300025922 Ga0207646_10286236 Ga0207646_102862361 348
363 3300025923 Ga0207681_10057016 Ga0207681_100570163 348
364 3300025925 Ga0207650_10173483 Ga0207650_101734832 348
365 3300025926 Ga0207659_10092574 Ga0207659_100925742 348
366 3300025942 Ga0207689_10076286 Ga0207689_100762862 348
367 3300025945 Ga0207679_10014671 Ga0207679_100146713 348
368 3300025972 Ga0207668_10057831 Ga0207668_100578312 348
369 3300026067 Ga0207678_10055307 Ga0207678_100553072 348
370 3300026075 Ga0207708_10016789 Ga0207708_100167892 348
371 3300026089 Ga0207648_10074851 Ga0207648_100748512 348
372 3300026116 Ga0207674_10152920 Ga0207674_101529202 348
373 3300027907 Ga0207428_10005192 Ga0207428_100051922 348
374 3300027907 Ga0207428_10109367 Ga0207428_101093672 348
375 3300028380 Ga0268265_10185994 Ga0268265_101859941 348
376 3300048911 Ga0496108_0121719 Ga0496108_0121719_247_1293 348
377 3300050507 nmdc:mga05p37_19261_c1 nmdc:mga05p37_19261_c1_1761_2810 348
378 3300050508 nmdc:mga09592_10502_c1 nmdc:mga09592_10502_c1_1462_2511 348
379 3300050511 nmdc:mga08y16_131460_c1 nmdc:mga08y16_131460_c1_1327_2373 348
380 3300050511 nmdc:mga08y16_170921_c1 nmdc:mga08y16_170921_c1_869_1918 348
381 3300050512 nmdc:mga0n895_455275_c1 nmdc:mga0n895_455275_c1_145_1194 348
382 3300050513 nmdc:mga0rr50_140565_c1 nmdc:mga0rr50_140565_c1_131_1180 348
383 3300050515 nmdc:mga0a205_103810_c1 nmdc:mga0a205_103810_c1_1056_2105 348
384 3300050515 nmdc:mga0a205_291612_c1 nmdc:mga0a205_291612_c1_30_1079 348
385 3300009177 Ga0105248_10011934 Ga0105248_100119344 349
386 3300001977 JGI24746J21847_1009946 JGI24746J21847_10099461 350
387 3300005328 Ga0070676_10009638 Ga0070676_100096382 350
388 3300005338 Ga0068868_100030094 Ga0068868_1000300943 350
389 3300005340 Ga0070689_100107757 Ga0070689_1001077572 350
390 3300005353 Ga0070669_100002449 Ga0070669_1000024496 350
391 3300005456 Ga0070678_100221004 Ga0070678_1002210042 350
392 3300005457 Ga0070662_100039022 Ga0070662_1000390222 350
393 3300005548 Ga0070665_100020412 Ga0070665_1000204124 350
394 3300005719 Ga0068861_100007846 Ga0068861_1000078464 350
395 3300005840 Ga0068870_10001125 Ga0068870_100011253 350
396 3300005842 Ga0068858_100019331 Ga0068858_1000193314 350
397 3300005843 Ga0068860_100013169 Ga0068860_1000131697 350
398 3300005844 Ga0068862_100007993 Ga0068862_1000079932 350
399 3300006358 Ga0068871_100114348 Ga0068871_1001143482 350
400 3300006881 Ga0068865_100090078 Ga0068865_1000900782 350
401 3300014326 Ga0157380_10066115 Ga0157380_100661152 350
402 3300017792 Ga0163161_10158810 Ga0163161_101588102 350
403 3300025315 Ga0207697_10003717 Ga0207697_100037174 350
404 3300025908 Ga0207643_10000450 Ga0207643_100004503 350
405 3300025918 Ga0207662_10045298 Ga0207662_100452982 350
406 3300025926 Ga0207659_10020797 Ga0207659_100207974 350
407 3300025933 Ga0207706_10008269 Ga0207706_100082694 350
408 3300025936 Ga0207670_10161192 Ga0207670_101611922 350
409 3300025942 Ga0207689_10001850 Ga0207689_1000185013 350
410 3300025961 Ga0207712_10004928 Ga0207712_100049286 350
411 3300026075 Ga0207708_10086865 Ga0207708_100868652 350
412 3300026118 Ga0207675_100005152 Ga0207675_1000051523 350
413 3300026121 Ga0207683_10011349 Ga0207683_100113494 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

88

390

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.9156 44 346
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.9041 44 346
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.8792 41 346
3nur-assembly1.cif.gz_A crystal structure of a putative amidohydrolase from staphylococcus aureus 0.8649 43 346
4qs5-assembly2.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw2 from novosphingobium aromaticivorans dsm 12444 (target efi-505250) with bound manganese and 3-methoxy-4-hydroxy-5-nitrobenzoic acid, the d314n mutant 0.8602 36 346
ID Description Score Start End Superfamily
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8989 44 346 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8903 44 346 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8791 41 346 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8713 44 346 3.20.20.140
3nurA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.863 44 346 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1Q8BAW3-F1-model_v4 Amidohydrolase-related domain-containing protein 0.978 38 349 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A537IZG3-F1-model_v4 Amidohydrolase 0.9563 83 189 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A1F3XBC2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.953 43 350 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8DJU2-F1-model_v4 Amidohydrolase 0.9494 110 350 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8MFH9-F1-model_v4 Amidohydrolase 0.9489 108 350 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
85.57 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map