F438023

General Info

Members Datasets Scaffolds Average Seq Length
413 263 400 155

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10237080|Ga0068851_102370802
Length 179
Sequence MAMERVLTSHWQAESAIAAWWQTRVVTELTLSDSISVAVPPDELYALVSDVTRTGEWSPICKACWWDEGSGPQVGAWFTGRNETPQRTWETRSQVVAAEPGRKFAWQVNNGWVHWEYAFEPEGGGTRLTERWEFLPAGIAGFHERYGADAETQIQQRHDAAKSGIPATLAAIKKVAEGS

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
3 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
6 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
7 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
8 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
9 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
10 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
11 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
12 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
13 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
14 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
182 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
183 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0.24
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 15.74
Nodule 0.24
Rhizoplane 7.51
Rhizosphere 72.4
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1004038 3300001978 Bacteria 1296
2 JGI24748J21848_1004728 3300002074 Bacteria 1566
3 JGI24742J22300_10000892 3300002244 Bacteria 4574
4 JGI24751J29686_10004193 3300002459 Bacteria 2923
5 Ga0055542_1018492 3300003762 Bacteria 1055
6 Ga0070676_10026370 3300005328 Bacteria 3290
7 Ga0070683_100870216 3300005329 Bacteria 864
8 Ga0070683_101753941 3300005329 Bacteria 597
9 Ga0070690_100013270 3300005330 Bacteria 4866
10 Ga0070666_10037847 3300005335 Bacteria 3209
11 Ga0070682_100012685 3300005337 Bacteria 4837
12 Ga0070682_101103326 3300005337 Unclassified 664
13 Ga0068868_100000523 3300005338 Bacteria 25742
14 Ga0070689_100003755 3300005340 Bacteria 10167
15 Ga0070691_10001245 3300005341 Bacteria 10736
16 Ga0070692_10057547 3300005345 Bacteria 2039
17 Ga0070668_100001990 3300005347 Bacteria 14937
18 Ga0070669_100007047 3300005353 Bacteria 8080
19 Ga0070675_100092906 3300005354 Bacteria 2530
20 Ga0070671_100001110 3300005355 Bacteria 19943
21 Ga0070671_100066564 3300005355 Bacteria 3003
22 Ga0070674_100001475 3300005356 Bacteria 12548
23 Ga0070673_100158414 3300005364 Bacteria 1923
24 Ga0070688_100004423 3300005365 Bacteria 7310
25 Ga0070659_100115761 3300005366 Bacteria 2167
26 Ga0070667_100002321 3300005367 Bacteria 16662
27 Ga0070667_100319540 3300005367 Bacteria 1401
28 Ga0070709_10034553 3300005434 Bacteria 3066
29 Ga0070714_100616310 3300005435 Bacteria 1043
30 Ga0070713_100440769 3300005436 Bacteria 1222
31 Ga0070710_10003258 3300005437 Bacteria 7692
32 Ga0070701_10022354 3300005438 Bacteria 3031
33 Ga0070711_100000445 3300005439 Bacteria 21522
34 Ga0070705_100009840 3300005440 Bacteria 4769
35 Ga0070694_100015413 3300005444 Bacteria 4802
36 Ga0070663_100035810 3300005455 Bacteria 3446
37 Ga0070678_100001217 3300005456 Bacteria 13631
38 Ga0070678_100779373 3300005456 Bacteria 867
39 Ga0070662_100064942 3300005457 Bacteria 2674
40 Ga0070662_100167684 3300005457 Bacteria 1722
41 Ga0068867_100001739 3300005459 Bacteria 15167
42 Ga0070685_10145210 3300005466 Bacteria 1498
43 Ga0070706_100053097 3300005467 Bacteria 3740
44 Ga0070707_100243777 3300005468 Bacteria 1749
45 Ga0070698_100049394 3300005471 Bacteria 4293
46 Ga0070679_100698216 3300005530 Bacteria 957
47 Ga0070684_100995382 3300005535 Bacteria 787
48 Ga0068853_100008266 3300005539 Bacteria 8352
49 Ga0070686_100043648 3300005544 Bacteria 2814
50 Ga0070695_100006509 3300005545 Bacteria 6905
51 Ga0070696_100002861 3300005546 Bacteria 11475
52 Ga0070693_100004910 3300005547 Bacteria 6381
53 Ga0070693_100589175 3300005547 Bacteria 801
54 Ga0070665_100003581 3300005548 Bacteria 16454
55 Ga0068855_100046495 3300005563 Bacteria 5131
56 Ga0070664_100562422 3300005564 Bacteria 1055
57 Ga0068854_100000449 3300005578 Bacteria 25455
58 Ga0068854_100114710 3300005578 Bacteria 2037
59 Ga0068856_100237911 3300005614 Bacteria 1836
60 Ga0070702_100000124 3300005615 Bacteria 23663
61 Ga0068859_100012664 3300005617 Bacteria 8480
62 Ga0068864_100757609 3300005618 Bacteria 952
63 Ga0068866_10001806 3300005718 Bacteria 8999
64 Ga0068861_100000897 3300005719 Bacteria 18077
65 Ga0068851_10237080 3300005834 Bacteria 1030
66 Ga0068851_10250502 3300005834 Bacteria 1004
67 Ga0068863_100008909 3300005841 Bacteria 9797
68 Ga0068858_100004303 3300005842 Bacteria 13997
69 Ga0068860_100009428 3300005843 Bacteria 9701
70 Ga0068862_100006422 3300005844 Bacteria 9774
71 Ga0081455_10017993 3300005937 Bacteria 6750
72 Ga0081455_10196820 3300005937 Bacteria 1513
73 Ga0075365_10388380 3300006038 Bacteria 985
74 Ga0075368_10018659 3300006042 Bacteria 2608
75 Ga0075363_100000970 3300006048 Bacteria 10202
76 Ga0075363_100001377 3300006048 Bacteria 9160
77 Ga0075363_100008435 3300006048 Bacteria 4796
78 Ga0075363_100053750 3300006048 Bacteria 2153
79 Ga0075363_100057670 3300006048 Bacteria 2085
80 Ga0075364_10000591 3300006051 Bacteria 18727
81 Ga0075364_10027128 3300006051 Bacteria 3657
82 Ga0075364_10048680 3300006051 Bacteria 2762
83 Ga0075364_10049118 3300006051 Bacteria 2751
84 Ga0075364_10099661 3300006051 Bacteria 1934
85 Ga0075364_10216921 3300006051 Bacteria 1298
86 Ga0075364_10237301 3300006051 Bacteria 1238
87 Ga0075364_10282131 3300006051 Bacteria 1130
88 Ga0070715_10067456 3300006163 Bacteria 1588
89 Ga0070716_100007127 3300006173 Bacteria 5493
90 Ga0070712_100000574 3300006175 Bacteria 21406
91 Ga0075362_10038141 3300006177 Bacteria 2110
92 Ga0075362_10053911 3300006177 Bacteria 1806
93 Ga0075362_10280315 3300006177 Bacteria 824
94 Ga0075367_10006053 3300006178 Bacteria 6078
95 Ga0075367_10111155 3300006178 Bacteria 1682
96 Ga0075369_10002844 3300006186 Bacteria 6234
97 Ga0075369_10114075 3300006186 Bacteria 1219
98 Ga0075369_10136951 3300006186 Bacteria 1115
99 Ga0075369_10273702 3300006186 Bacteria 786
100 Ga0075369_10324908 3300006186 Bacteria 720
101 Ga0075369_10398997 3300006186 Bacteria 648
102 Ga0075366_10168862 3300006195 Bacteria 1327
103 Ga0075370_10004150 3300006353 Bacteria 6984
104 Ga0075370_10017755 3300006353 Bacteria 3848
105 Ga0075370_10046166 3300006353 Bacteria 2465
106 Ga0075370_10490514 3300006353 Bacteria 741
107 Ga0075430_100021870 3300006846 Bacteria 5435
108 Ga0068865_100001186 3300006881 Bacteria 15144
109 Ga0097620_100012663 3300006931 Bacteria 8480
110 Ga0105250_10014694 3300009092 Bacteria 3213
111 Ga0105245_10004057 3300009098 Bacteria 13010
112 Ga0114129_10007985 3300009147 Bacteria 15069
113 Ga0105243_10000500 3300009148 Bacteria 40085
114 Ga0105241_10009248 3300009174 Bacteria 7247
115 Ga0105241_10718941 3300009174 Bacteria 913
116 Ga0105242_10000114 3300009176 Bacteria 58418
117 Ga0105242_11620857 3300009176 Bacteria 681
118 Ga0105242_12000553 3300009176 Bacteria 622
119 Ga0105248_10001924 3300009177 Bacteria 23048
120 Ga0105237_10028127 3300009545 Bacteria 5729
121 Ga0105237_10862357 3300009545 Bacteria 912
122 Ga0105238_10161366 3300009551 Bacteria 2217
123 Ga0105249_10002176 3300009553 Bacteria 16984
124 Ga0105249_10028664 3300009553 Bacteria 5025
125 Ga0105239_10007731 3300010375 Bacteria 12306
126 Ga0105239_10052034 3300010375 Bacteria 4490
127 Ga0105239_10056297 3300010375 Bacteria 4314
128 Ga0105239_11388299 3300010375 Bacteria 811
129 Ga0105246_10516831 3300011119 Bacteria 1017
130 Ga0157378_10002755 3300013297 Bacteria 15659
131 Ga0163162_10005120 3300013306 Bacteria 12635
132 Ga0163162_10125899 3300013306 Bacteria 2668
133 Ga0157372_10002838 3300013307 Bacteria 18722
134 Ga0157372_10924155 3300013307 Bacteria 1012
135 Ga0157372_11306329 3300013307 Bacteria 837
136 Ga0157375_10002417 3300013308 Bacteria 16176
137 Ga0163163_11539632 3300014325 Bacteria 726
138 Ga0157380_10004322 3300014326 Bacteria 9851
139 Ga0157380_10064612 3300014326 Bacteria 2939
140 Ga0157377_10127302 3300014745 Bacteria 1551
141 Ga0157379_10030497 3300014968 Bacteria 4801
142 Ga0157376_10020851 3300014969 Bacteria 5079
143 Ga0163161_10001123 3300017792 Bacteria 20165
144 Ga0163161_10271524 3300017792 Bacteria 1327
145 Ga0224712_10169681 3300022467 Bacteria 978
146 Ga0209148_1001217 3300025254 Bacteria 14580
147 Ga0209025_1139351 3300025294 Bacteria 689
148 Ga0207696_1034143 3300025711 Bacteria 1521
149 Ga0207692_10023679 3300025898 Bacteria 2843
150 Ga0207642_10001201 3300025899 Bacteria 7997
151 Ga0207710_10013002 3300025900 Bacteria 3506
152 Ga0207688_10000865 3300025901 Bacteria 15291
153 Ga0207680_10654188 3300025903 Bacteria 752
154 Ga0207685_10008226 3300025905 Bacteria 2958
155 Ga0207699_10026719 3300025906 Bacteria 3186
156 Ga0207699_10455442 3300025906 Bacteria 918
157 Ga0207645_10007742 3300025907 Bacteria 7562
158 Ga0207684_10095212 3300025910 Bacteria 2540
159 Ga0207654_10259269 3300025911 Bacteria 1168
160 Ga0207671_10144581 3300025914 Bacteria 1834
161 Ga0207693_10000545 3300025915 Bacteria 34063
162 Ga0207663_10000718 3300025916 Bacteria 14773
163 Ga0207660_10335495 3300025917 Bacteria 1209
164 Ga0207657_10148019 3300025919 Bacteria 1914
165 Ga0207646_10184465 3300025922 Bacteria 1884
166 Ga0207659_11057708 3300025926 Bacteria 698
167 Ga0207687_10004900 3300025927 Bacteria 8897
168 Ga0207644_10187066 3300025931 Bacteria 1626
169 Ga0207690_10339902 3300025932 Bacteria 1184
170 Ga0207706_10001402 3300025933 Bacteria 24106
171 Ga0207706_10239372 3300025933 Bacteria 1587
172 Ga0207686_10010671 3300025934 Bacteria 5004
173 Ga0207686_10601059 3300025934 Bacteria 866
174 Ga0207709_10004975 3300025935 Bacteria 7607
175 Ga0207669_10000779 3300025937 Bacteria 13657
176 Ga0207669_10764327 3300025937 Bacteria 799
177 Ga0207704_10001786 3300025938 Bacteria 9635
178 Ga0207665_10011769 3300025939 Bacteria 5751
179 Ga0207711_10322581 3300025941 Bacteria 1427
180 Ga0207661_11047884 3300025944 Bacteria 751
181 Ga0207679_10478038 3300025945 Bacteria 1109
182 Ga0207712_10000064 3300025961 Bacteria 132823
183 Ga0207712_10001406 3300025961 Bacteria 16412
184 Ga0207712_10157901 3300025961 Bacteria 1759
185 Ga0207668_10013251 3300025972 Bacteria 5070
186 Ga0207668_10130988 3300025972 Bacteria 1915
187 Ga0207640_10003823 3300025981 Bacteria 8122
188 Ga0207640_10116663 3300025981 Bacteria 1904
189 Ga0207658_10054732 3300025986 Bacteria 2953
190 Ga0207658_10175041 3300025986 Bacteria 1771
191 Ga0207677_10065436 3300026023 Bacteria 2536
192 Ga0207703_10003340 3300026035 Bacteria 13476
193 Ga0207639_10010136 3300026041 Bacteria 6518
194 Ga0207639_10144071 3300026041 Bacteria 1989
195 Ga0207678_10032946 3300026067 Bacteria 4515
196 Ga0207702_10160549 3300026078 Bacteria 2052
197 Ga0207641_10030308 3300026088 Bacteria 4481
198 Ga0207648_10001779 3300026089 Bacteria 23616
199 Ga0207676_10140198 3300026095 Bacteria 2069
200 Ga0207675_100000487 3300026118 Bacteria 38531
201 Ga0207675_102064794 3300026118 Bacteria 587
202 Ga0207683_10000533 3300026121 Bacteria 35270
203 Ga0207698_10271268 3300026142 Bacteria 1564
204 Ga0207698_11290614 3300026142 Bacteria 745
205 Ga0268266_10003204 3300028379 Bacteria 16556
206 Ga0268265_10375947 3300028380 Bacteria 1305
207 Ga0268265_10641832 3300028380 Bacteria 1020
208 Ga0268264_10008949 3300028381 Bacteria 8310
209 Ga0307413_10102472 3300031824 Bacteria 1895
210 Ga0307410_10784227 3300031852 Bacteria 809
211 Ga0307410_11132413 3300031852 Bacteria 679
212 Ga0307406_11464095 3300031901 Bacteria 600
213 Ga0307407_10780433 3300031903 Bacteria 725
214 Ga0307412_10517481 3300031911 Bacteria 996
215 Ga0307412_10973350 3300031911 Bacteria 748
216 Ga0307409_100018228 3300031995 Bacteria 4711
217 Ga0307416_100048680 3300032002 Bacteria 3365
218 Ga0307415_100217735 3300032126 Bacteria 1528
219 Ga0373941_0178914 3300035115 Bacteria 795
220 Ga0373946_0626558 3300035171 Bacteria 559
221 Ga0373961_0105575 3300035241 Bacteria 917
222 Ga0373931_0270678 3300035691 Bacteria 1040
223 Ga0436364_1463279 3300037853 Bacteria 1443
224 Ga0439461_0004937 3300041410 Bacteria 2253
225 Ga0439466_0013134 3300041411 Bacteria 3035
226 Ga0439466_0072400 3300041411 Bacteria 1096
227 Ga0439465_0018294 3300041413 Bacteria 2189
228 Ga0439465_0026656 3300041413 Bacteria 1828
229 Ga0439465_0048898 3300041413 Bacteria 1380
230 Ga0439465_0064487 3300041413 Bacteria 1218
231 Ga0451793_0296440 3300041452 Bacteria 1648
232 Ga0451795_0606491 3300041456 Bacteria 530
233 Ga0451833_1105833 3300041491 Bacteria 715
234 Ga0451833_1497772 3300041491 Bacteria 927
235 Ga0451841_1112184 3300041498 Unclassified 794
236 Ga0439431_0000536 3300041997 Bacteria 8044
237 Ga0439431_0027380 3300041997 Bacteria 1400
238 Ga0439431_0049085 3300041997 Bacteria 1091
239 Ga0439445_0013849 3300042004 Bacteria 1956
240 Ga0439445_0034667 3300042004 Bacteria 1323
241 Ga0439445_0122434 3300042004 Bacteria 747
242 Ga0439434_0003445 3300042435 Bacteria 4624
243 Ga0439434_0004565 3300042435 Bacteria 4051
244 Ga0466965_0013261 3300044683 Bacteria 3887
245 Ga0466965_0138372 3300044683 Bacteria 1266
246 Ga0466965_0146560 3300044683 Bacteria 1232
247 Ga0466961_0137031 3300044693 Bacteria 1533
248 Ga0466961_0231884 3300044693 Bacteria 1136
249 Ga0466963_0008378 3300044694 Bacteria 6196
250 Ga0466963_0013678 3300044694 Bacteria 4990
251 Ga0466963_0099320 3300044694 Bacteria 1991
252 Ga0466964_0019337 3300044706 Bacteria 2617
253 Ga0466964_0033977 3300044706 Bacteria 2034
254 Ga0466964_0178567 3300044706 Bacteria 1005
255 Ga0466971_0037928 3300044719 Bacteria 2161
256 Ga0466971_0068988 3300044719 Bacteria 1604
257 Ga0466968_0156086 3300044735 Bacteria 1051
258 Ga0466970_0150790 3300044765 Bacteria 1283
259 Ga0466957_0007296 3300044842 Bacteria 6245
260 Ga0466957_0056216 3300044842 Bacteria 2406
261 Ga0466957_0227556 3300044842 Bacteria 1233
262 Ga0466957_0298228 3300044842 Bacteria 1082
263 Ga0466960_0070121 3300044901 Bacteria 1743
264 Ga0466960_0124579 3300044901 Bacteria 1353
265 Ga0466960_0284966 3300044901 Bacteria 927
266 Ga0466959_0269516 3300045049 Bacteria 1170
267 Ga0466959_0283675 3300045049 Bacteria 1136
268 Ga0466958_0075540 3300045836 Bacteria 2067
269 Ga0466958_0284296 3300045836 Bacteria 1060
270 Ga0466967_0043902 3300045976 Bacteria 3873
271 Ga0466967_0060249 3300045976 Bacteria 3363
272 Ga0466967_0088534 3300045976 Bacteria 2810
273 Ga0466967_0200820 3300045976 Bacteria 1888
274 Ga0466967_0359587 3300045976 Bacteria 1410
275 Ga0466967_0681409 3300045976 Bacteria 1018
276 Ga0466967_0963674 3300045976 Bacteria 849
277 Ga0466967_1083128 3300045976 Bacteria 798
278 Ga0495596_0336256 3300046500 Bacteria 588
279 Ga0495608_0105492 3300046511 Bacteria 1814
280 Ga0495630_0036054 3300046517 Bacteria 3698
281 Ga0495630_1276583 3300046517 Unclassified 554
282 Ga0495648_0024134 3300046524 Bacteria 4150
283 Ga0495648_0051418 3300046524 Bacteria 2511
284 Ga0495657_0292613 3300046675 Bacteria 972
285 Ga0495613_0383953 3300046689 Bacteria 960
286 Ga0495671_0151769 3300046692 Bacteria 1128
287 Ga0495672_0024321 3300047320 Bacteria 3904
288 Ga0495672_0068069 3300047320 Bacteria 2026
289 Ga0495672_0142781 3300047320 Bacteria 1249
290 Ga0495673_0001846 3300047469 Bacteria 15895
291 Ga0495673_0043434 3300047469 Bacteria 2012
292 Ga0495686_0088521 3300047472 Bacteria 1882
293 Ga0495686_0303171 3300047472 Bacteria 881
294 Ga0496100_0001109 3300048903 Bacteria 13048
295 Ga0496100_0001413 3300048903 Bacteria 11741
296 Ga0496101_0000014 3300048904 Bacteria 253487
297 Ga0496101_0002676 3300048904 Bacteria 10937
298 Ga0496102_0000003 3300048905 Bacteria 592263
299 Ga0496102_0001374 3300048905 Bacteria 21679
300 Ga0496102_0010813 3300048905 Bacteria 7860
301 Ga0496102_0071891 3300048905 Bacteria 3177
302 Ga0496102_0489704 3300048905 Bacteria 1151
303 Ga0496103_0000012 3300048906 Bacteria 301778
304 Ga0496103_0001003 3300048906 Bacteria 19761
305 Ga0496103_0375783 3300048906 Bacteria 913
306 Ga0496105_0076531 3300048908 Bacteria 2763
307 Ga0496106_0006025 3300048909 Bacteria 8970
308 Ga0496106_0044961 3300048909 Bacteria 3316
309 Ga0496106_0993473 3300048909 Bacteria 660
310 Ga0496107_0005525 3300048910 Bacteria 8651
311 Ga0496107_0830872 3300048910 Bacteria 675
312 Ga0496108_0023134 3300048911 Bacteria 5111
313 Ga0496108_0046284 3300048911 Bacteria 3635
314 Ga0496109_0130928 3300048912 Bacteria 2341
315 Ga0496110_0061250 3300048913 Bacteria 3321
316 Ga0496110_0144372 3300048913 Bacteria 2152
317 Ga0496111_0125766 3300048914 Bacteria 1895
318 Ga0496112_0027441 3300048915 Bacteria 5489
319 Ga0496112_0039230 3300048915 Bacteria 4627
320 Ga0496112_0083586 3300048915 Bacteria 3158
321 Ga0496114_0003040 3300048917 Bacteria 12850
322 Ga0496115_0002167 3300048918 Bacteria 14051
323 Ga0496116_0000040 3300048919 Bacteria 346900
324 Ga0496117_0000003 3300048920 Bacteria 1881097
325 Ga0496118_0000001 3300048921 Bacteria 1881100
326 Ga0496119_0127243 3300048922 Bacteria 1392
327 Ga0496121_0204003 3300048924 Bacteria 1406
328 Ga0496126_0001783 3300048929 Bacteria 31790
329 Ga0501032_0002599 3300049569 Bacteria 14121
330 Ga0501033_0633701 3300049570 Bacteria 731
331 Ga0501034_0105790 3300049571 Bacteria 2806
332 Ga0501034_0228545 3300049571 Bacteria 1810
333 Ga0501034_0485158 3300049571 Bacteria 1151
334 Ga0501034_0610431 3300049571 Bacteria 996
335 Ga0501036_0213715 3300049572 Bacteria 1620
336 Ga0501037_0000180 3300049573 Bacteria 58638
337 Ga0501038_0007628 3300049574 Bacteria 9976
338 Ga0501039_0001203 3300049575 Bacteria 19006
339 Ga0501043_0000441 3300049579 Bacteria 37336
340 Ga0501043_0132992 3300049579 Bacteria 1949
341 Ga0501043_0205069 3300049579 Bacteria 1529
342 Ga0501043_0306614 3300049579 Bacteria 1212
343 Ga0501046_0085099 3300049580 Bacteria 2438
344 Ga0501047_0028191 3300049581 Bacteria 5411
345 Ga0501047_0362071 3300049581 Bacteria 1286
346 Ga0501067_0218300 3300049583 Bacteria 1062
347 Ga0501067_0264008 3300049583 Bacteria 958
348 Ga0501070_0000384 3300049586 Bacteria 40450
349 Ga0501070_0028630 3300049586 Bacteria 4672
350 Ga0501070_0050570 3300049586 Bacteria 3450
351 Ga0501072_0385998 3300049588 Bacteria 1111
352 Ga0501072_0890661 3300049588 Bacteria 695
353 Ga0501073_0080650 3300049589 Bacteria 2264
354 Ga0501073_0180301 3300049589 Bacteria 1462
355 Ga0501073_0425222 3300049589 Bacteria 918
356 Ga0501074_0349511 3300049590 Bacteria 1049
357 Ga0501074_0400989 3300049590 Bacteria 973
358 Ga0501077_0355010 3300049593 Bacteria 936
359 Ga0501080_0480586 3300049742 Bacteria 1111
360 Ga0501044_0289920 3300049823 Bacteria 1568
361 Ga0501044_0342673 3300049823 Bacteria 1415
362 Ga0501045_0308996 3300049824 Bacteria 1177
363 nmdc:mga03683_17538_c1 3300050489 Bacteria 2306
364 nmdc:mga03683_89636_c1 3300050489 Bacteria 1339
365 nmdc:mga03n38_104958_c1 3300050490 Bacteria 1368
366 nmdc:mga03n38_2780_c1 3300050490 Bacteria 5497
367 nmdc:mga03n38_401_c1 3300050490 Bacteria 10755
368 nmdc:mga03n38_4207_c1 3300050490 Bacteria 4736
369 nmdc:mga03n38_480763_c1 3300050490 Bacteria 694
370 nmdc:mga03n38_489720_c1 3300050490 Bacteria 689
371 nmdc:mga03n38_92825_c1 3300050490 Bacteria 1441
372 nmdc:mga00v17_124436_c1 3300050491 Bacteria 1644
373 nmdc:mga00v17_180572_c1 3300050491 Bacteria 1362
374 nmdc:mga00v17_287090_c1 3300050491 Bacteria 1068
375 nmdc:mga00v17_33361_c1 3300050491 Bacteria 3050
376 nmdc:mga00v17_47740_c1 3300050491 Bacteria 2594
377 nmdc:mga00v17_6165_c1 3300050491 Bacteria 6355
378 nmdc:mga00v17_7536_c1 3300050491 Bacteria 5810
379 nmdc:mga00v17_7783_c1 3300050491 Bacteria 5741
380 nmdc:mga0yw44_144303_c1 3300050492 Bacteria 1549
381 nmdc:mga0yw44_331404_c1 3300050492 Bacteria 1023
382 nmdc:mga0yw44_390373_c1 3300050492 Bacteria 940
383 nmdc:mga0k408_152733_c1 3300050493 Bacteria 1375
384 nmdc:mga06z11_217684_c1 3300050494 Bacteria 1115
385 nmdc:mga04h51_25804_c1 3300050495 Bacteria 1812
386 nmdc:mga04h51_282531_c1 3300050495 Bacteria 672
387 nmdc:mga07m45_148487_c1 3300050496 Bacteria 1359
388 nmdc:mga07m45_18146_c1 3300050496 Bacteria 3791
389 nmdc:mga07m45_21029_c1 3300050496 Bacteria 3549
390 nmdc:mga07m45_2738_c1 3300050496 Bacteria 8312
391 nmdc:mga07m45_32018_c1 3300050496 Bacteria 2915
392 nmdc:mga05p37_35880_c1 3300050507 Bacteria 6083
393 nmdc:mga0qj67_55995_c1 3300050509 Bacteria 3125
394 nmdc:mga06r32_233539_c1 3300050510 Bacteria 1827
395 nmdc:mga0sz30_370457_c1 3300050516 Bacteria 641
396 nmdc:mga0sz30_391259_c1 3300050516 Bacteria 622
397 Ga0495655_0172974 3300053083 Bacteria 692
398 Ga0495595_0054159 3300053084 Bacteria 1865
399 Ga0495619_0015369 3300053085 Bacteria 4843
400 Ga0466962_0025141 3300061719 Bacteria 2859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0425222 Ga0501073_0425222_13_426 130
2 3300044706 Ga0466964_0019337 Ga0466964_0019337_564_1073 138
3 3300046500 Ga0495596_0336256 Ga0495596_0336256_21_461 142
4 iso_pu_bacteria 2984576629 2984577285 147
5 iso_pu_bacteria 2990256926 2990260927 147
6 3300002459 JGI24751J29686_10004193 JGI24751J29686_100041934 148
7 3300005329 Ga0070683_100870216 Ga0070683_1008702161 148
8 3300005355 Ga0070671_100001110 Ga0070671_10000111016 148
9 3300005367 Ga0070667_100319540 Ga0070667_1003195402 148
10 3300005436 Ga0070713_100440769 Ga0070713_1004407692 148
11 3300005467 Ga0070706_100053097 Ga0070706_1000530973 148
12 3300005468 Ga0070707_100243777 Ga0070707_1002437772 148
13 3300005471 Ga0070698_100049394 Ga0070698_1000493942 148
14 3300005535 Ga0070684_100995382 Ga0070684_1009953822 148
15 3300005548 Ga0070665_100003581 Ga0070665_1000035815 148
16 3300005564 Ga0070664_100562422 Ga0070664_1005624222 148
17 3300005578 Ga0068854_100114710 Ga0068854_1001147102 148
18 3300005618 Ga0068864_100757609 Ga0068864_1007576092 148
19 3300005841 Ga0068863_100008909 Ga0068863_1000089094 148
20 3300005937 Ga0081455_10196820 Ga0081455_101968202 148
21 3300006038 Ga0075365_10388380 Ga0075365_103883802 148
22 3300006042 Ga0075368_10018659 Ga0075368_100186593 148
23 3300006048 Ga0075363_100001377 Ga0075363_1000013776 148
24 3300006048 Ga0075363_100008435 Ga0075363_1000084352 148
25 3300006048 Ga0075363_100053750 Ga0075363_1000537502 148
26 3300006048 Ga0075363_100057670 Ga0075363_1000576703 148
27 3300006051 Ga0075364_10048680 Ga0075364_100486801 148
28 3300006051 Ga0075364_10049118 Ga0075364_100491183 148
29 3300006051 Ga0075364_10282131 Ga0075364_102821312 148
30 3300006177 Ga0075362_10038141 Ga0075362_100381413 148
31 3300006177 Ga0075362_10053911 Ga0075362_100539112 148
32 3300006177 Ga0075362_10280315 Ga0075362_102803151 148
33 3300006178 Ga0075367_10006053 Ga0075367_100060533 148
34 3300006178 Ga0075367_10111155 Ga0075367_101111552 148
35 3300006186 Ga0075369_10002844 Ga0075369_100028443 148
36 3300006186 Ga0075369_10114075 Ga0075369_101140752 148
37 3300006186 Ga0075369_10136951 Ga0075369_101369512 148
38 3300006186 Ga0075369_10273702 Ga0075369_102737022 148
39 3300006186 Ga0075369_10324908 Ga0075369_103249082 148
40 3300006186 Ga0075369_10398997 Ga0075369_103989971 148
41 3300006195 Ga0075366_10168862 Ga0075366_101688622 148
42 3300006353 Ga0075370_10004150 Ga0075370_100041501 148
43 3300006353 Ga0075370_10017755 Ga0075370_100177555 148
44 3300006353 Ga0075370_10046166 Ga0075370_100461663 148
45 3300017792 Ga0163161_10271524 Ga0163161_102715242 148
46 3300022467 Ga0224712_10169681 Ga0224712_101696811 148
47 3300025906 Ga0207699_10455442 Ga0207699_104554421 148
48 3300025910 Ga0207684_10095212 Ga0207684_100952122 148
49 3300025922 Ga0207646_10184465 Ga0207646_101844652 148
50 3300025931 Ga0207644_10187066 Ga0207644_101870662 148
51 3300025934 Ga0207686_10601059 Ga0207686_106010592 148
52 3300025945 Ga0207679_10478038 Ga0207679_104780382 148
53 3300025961 Ga0207712_10157901 Ga0207712_101579012 148
54 3300025972 Ga0207668_10130988 Ga0207668_101309883 148
55 3300025981 Ga0207640_10116663 Ga0207640_101166632 148
56 3300025986 Ga0207658_10054732 Ga0207658_100547323 148
57 3300026041 Ga0207639_10144071 Ga0207639_101440712 148
58 3300026088 Ga0207641_10030308 Ga0207641_100303084 148
59 3300026095 Ga0207676_10140198 Ga0207676_101401983 148
60 3300028379 Ga0268266_10003204 Ga0268266_100032046 148
61 3300028380 Ga0268265_10641832 Ga0268265_106418322 148
62 3300031824 Ga0307413_10102472 Ga0307413_101024723 148
63 3300031852 Ga0307410_10784227 Ga0307410_107842272 148
64 3300031852 Ga0307410_11132413 Ga0307410_111324131 148
65 3300031911 Ga0307412_10517481 Ga0307412_105174812 148
66 3300031995 Ga0307409_100018228 Ga0307409_1000182286 148
67 3300032002 Ga0307416_100048680 Ga0307416_1000486802 148
68 3300032126 Ga0307415_100217735 Ga0307415_1002177352 148
69 3300041411 Ga0439466_0072400 Ga0439466_0072400_163_609 148
70 3300041413 Ga0439465_0026656 Ga0439465_0026656_1169_1615 148
71 3300041997 Ga0439431_0027380 Ga0439431_0027380_811_1257 148
72 3300042004 Ga0439445_0034667 Ga0439445_0034667_779_1225 148
73 3300042435 Ga0439434_0004565 Ga0439434_0004565_2490_2963 148
74 3300044683 Ga0466965_0146560 Ga0466965_0146560_121_570 148
75 3300044706 Ga0466964_0033977 Ga0466964_0033977_1029_1478 148
76 3300044842 Ga0466957_0056216 Ga0466957_0056216_1254_1703 148
77 3300044901 Ga0466960_0284966 Ga0466960_0284966_129_578 148
78 3300045976 Ga0466967_0200820 Ga0466967_0200820_767_1216 148
79 3300045976 Ga0466967_0681409 Ga0466967_0681409_131_580 148
80 3300048915 Ga0496112_0039230 Ga0496112_0039230_4159_4608 148
81 3300049571 Ga0501034_0485158 Ga0501034_0485158_134_583 148
82 3300049571 Ga0501034_0610431 Ga0501034_0610431_145_594 148
83 3300049579 Ga0501043_0306614 Ga0501043_0306614_706_1155 148
84 3300049581 Ga0501047_0362071 Ga0501047_0362071_367_816 148
85 3300049583 Ga0501067_0264008 Ga0501067_0264008_211_687 148
86 3300050490 nmdc:mga03n38_4207_c1 nmdc:mga03n38_4207_c1_153_602 148
87 3300050490 nmdc:mga03n38_489720_c1 nmdc:mga03n38_489720_c1_24_470 148
88 3300050490 nmdc:mga03n38_92825_c1 nmdc:mga03n38_92825_c1_365_814 148
89 3300050491 nmdc:mga00v17_180572_c1 nmdc:mga00v17_180572_c1_295_744 148
90 3300050491 nmdc:mga00v17_33361_c1 nmdc:mga00v17_33361_c1_35_484 148
91 3300050492 nmdc:mga0yw44_331404_c1 nmdc:mga0yw44_331404_c1_343_792 148
92 3300050495 nmdc:mga04h51_282531_c1 nmdc:mga04h51_282531_c1_158_607 148
93 3300050496 nmdc:mga07m45_148487_c1 nmdc:mga07m45_148487_c1_529_975 148
94 3300050496 nmdc:mga07m45_21029_c1 nmdc:mga07m45_21029_c1_1033_1482 148
95 3300050496 nmdc:mga07m45_32018_c1 nmdc:mga07m45_32018_c1_2374_2823 148
96 iso_pu_bacteria 2842134933 2842136818 148
97 iso_pu_bacteria 2643221715 2644635731 149
98 iso_pu_bacteria 2902810491 2902813659 149
99 iso_pu_bacteria 2904770941 2904773888 149
100 iso_pu_bacteria 2919420072 2919420425 149
101 iso_pu_bacteria 2919432681 2919433817 149
102 iso_pu_bacteria 2974315732 2974319153 149
103 iso_pu_bacteria 2984523437 2984527378 149
104 3300006353 Ga0075370_10490514 Ga0075370_104905142 150
105 3300028380 Ga0268265_10375947 Ga0268265_103759471 150
106 3300003762 Ga0055542_1018492 Ga0055542_10184922 152
107 3300025254 Ga0209148_1001217 Ga0209148_10012172 152
108 3300026142 Ga0207698_10271268 Ga0207698_102712681 152
109 iso_pu_bacteria 2808606700 2810363209 152
110 iso_pu_bacteria 2811994871 2812317940 152
111 iso_pu_bacteria 2946003308 2946003567 152
112 3300001978 JGI24747J21853_1004038 JGI24747J21853_10040381 153
113 3300002074 JGI24748J21848_1004728 JGI24748J21848_10047282 153
114 3300002244 JGI24742J22300_10000892 JGI24742J22300_100008924 153
115 3300005328 Ga0070676_10026370 Ga0070676_100263704 153
116 3300005329 Ga0070683_101753941 Ga0070683_1017539411 153
117 3300005330 Ga0070690_100013270 Ga0070690_1000132703 153
118 3300005335 Ga0070666_10037847 Ga0070666_100378471 153
119 3300005337 Ga0070682_100012685 Ga0070682_1000126852 153
120 3300005337 Ga0070682_101103326 Ga0070682_1011033261 153
121 3300005338 Ga0068868_100000523 Ga0068868_10000052310 153
122 3300005340 Ga0070689_100003755 Ga0070689_1000037557 153
123 3300005341 Ga0070691_10001245 Ga0070691_1000124511 153
124 3300005345 Ga0070692_10057547 Ga0070692_100575472 153
125 3300005347 Ga0070668_100001990 Ga0070668_1000019907 153
126 3300005353 Ga0070669_100007047 Ga0070669_1000070474 153
127 3300005354 Ga0070675_100092906 Ga0070675_1000929062 153
128 3300005355 Ga0070671_100066564 Ga0070671_1000665644 153
129 3300005356 Ga0070674_100001475 Ga0070674_1000014759 153
130 3300005364 Ga0070673_100158414 Ga0070673_1001584143 153
131 3300005365 Ga0070688_100004423 Ga0070688_1000044236 153
132 3300005366 Ga0070659_100115761 Ga0070659_1001157612 153
133 3300005367 Ga0070667_100002321 Ga0070667_1000023215 153
134 3300005434 Ga0070709_10034553 Ga0070709_100345533 153
135 3300005435 Ga0070714_100616310 Ga0070714_1006163101 153
136 3300005437 Ga0070710_10003258 Ga0070710_100032588 153
137 3300005438 Ga0070701_10022354 Ga0070701_100223544 153
138 3300005439 Ga0070711_100000445 Ga0070711_1000004453 153
139 3300005440 Ga0070705_100009840 Ga0070705_1000098405 153
140 3300005444 Ga0070694_100015413 Ga0070694_1000154134 153
141 3300005455 Ga0070663_100035810 Ga0070663_1000358104 153
142 3300005456 Ga0070678_100001217 Ga0070678_1000012172 153
143 3300005456 Ga0070678_100779373 Ga0070678_1007793731 153
144 3300005457 Ga0070662_100064942 Ga0070662_1000649423 153
145 3300005457 Ga0070662_100167684 Ga0070662_1001676842 153
146 3300005459 Ga0068867_100001739 Ga0068867_1000017393 153
147 3300005466 Ga0070685_10145210 Ga0070685_101452102 153
148 3300005530 Ga0070679_100698216 Ga0070679_1006982162 153
149 3300005539 Ga0068853_100008266 Ga0068853_1000082665 153
150 3300005544 Ga0070686_100043648 Ga0070686_1000436483 153
151 3300005545 Ga0070695_100006509 Ga0070695_1000065098 153
152 3300005546 Ga0070696_100002861 Ga0070696_1000028615 153
153 3300005547 Ga0070693_100004910 Ga0070693_1000049105 153
154 3300005547 Ga0070693_100589175 Ga0070693_1005891751 153
155 3300005563 Ga0068855_100046495 Ga0068855_1000464952 153
156 3300005578 Ga0068854_100000449 Ga0068854_10000044911 153
157 3300005614 Ga0068856_100237911 Ga0068856_1002379112 153
158 3300005615 Ga0070702_100000124 Ga0070702_10000012419 153
159 3300005617 Ga0068859_100012664 Ga0068859_1000126641 153
160 3300005718 Ga0068866_10001806 Ga0068866_100018065 153
161 3300005719 Ga0068861_100000897 Ga0068861_1000008974 153
162 3300005834 Ga0068851_10237080 Ga0068851_102370802 153
163 3300005834 Ga0068851_10250502 Ga0068851_102505022 153
164 3300005842 Ga0068858_100004303 Ga0068858_1000043034 153
165 3300005843 Ga0068860_100009428 Ga0068860_1000094289 153
166 3300005844 Ga0068862_100006422 Ga0068862_1000064229 153
167 3300005937 Ga0081455_10017993 Ga0081455_100179932 153
168 3300006048 Ga0075363_100000970 Ga0075363_1000009707 153
169 3300006051 Ga0075364_10000591 Ga0075364_1000059117 153
170 3300006051 Ga0075364_10027128 Ga0075364_100271284 153
171 3300006051 Ga0075364_10099661 Ga0075364_100996612 153
172 3300006051 Ga0075364_10216921 Ga0075364_102169212 153
173 3300006051 Ga0075364_10237301 Ga0075364_102373012 153
174 3300006163 Ga0070715_10067456 Ga0070715_100674562 153
175 3300006173 Ga0070716_100007127 Ga0070716_1000071276 153
176 3300006175 Ga0070712_100000574 Ga0070712_10000057419 153
177 3300006846 Ga0075430_100021870 Ga0075430_1000218702 153
178 3300006881 Ga0068865_100001186 Ga0068865_10000118610 153
179 3300006931 Ga0097620_100012663 Ga0097620_1000126631 153
180 3300009092 Ga0105250_10014694 Ga0105250_100146942 153
181 3300009098 Ga0105245_10004057 Ga0105245_100040576 153
182 3300009147 Ga0114129_10007985 Ga0114129_1000798515 153
183 3300009148 Ga0105243_10000500 Ga0105243_1000050018 153
184 3300009174 Ga0105241_10009248 Ga0105241_100092486 153
185 3300009174 Ga0105241_10718941 Ga0105241_107189412 153
186 3300009176 Ga0105242_10000114 Ga0105242_1000011425 153
187 3300009176 Ga0105242_11620857 Ga0105242_116208571 153
188 3300009176 Ga0105242_12000553 Ga0105242_120005532 153
189 3300009177 Ga0105248_10001924 Ga0105248_1000192410 153
190 3300009545 Ga0105237_10028127 Ga0105237_100281271 153
191 3300009545 Ga0105237_10862357 Ga0105237_108623572 153
192 3300009551 Ga0105238_10161366 Ga0105238_101613663 153
193 3300009553 Ga0105249_10002176 Ga0105249_100021769 153
194 3300009553 Ga0105249_10028664 Ga0105249_100286646 153
195 3300010375 Ga0105239_10007731 Ga0105239_100077314 153
196 3300010375 Ga0105239_10052034 Ga0105239_100520345 153
197 3300010375 Ga0105239_10056297 Ga0105239_100562972 153
198 3300010375 Ga0105239_11388299 Ga0105239_113882991 153
199 3300011119 Ga0105246_10516831 Ga0105246_105168311 153
200 3300013297 Ga0157378_10002755 Ga0157378_100027558 153
201 3300013306 Ga0163162_10005120 Ga0163162_100051209 153
202 3300013306 Ga0163162_10125899 Ga0163162_101258993 153
203 3300013307 Ga0157372_10002838 Ga0157372_1000283812 153
204 3300013307 Ga0157372_10924155 Ga0157372_109241552 153
205 3300013307 Ga0157372_11306329 Ga0157372_113063291 153
206 3300013308 Ga0157375_10002417 Ga0157375_1000241716 153
207 3300014325 Ga0163163_11539632 Ga0163163_115396321 153
208 3300014326 Ga0157380_10004322 Ga0157380_100043223 153
209 3300014326 Ga0157380_10064612 Ga0157380_100646121 153
210 3300014745 Ga0157377_10127302 Ga0157377_101273021 153
211 3300014968 Ga0157379_10030497 Ga0157379_100304974 153
212 3300014969 Ga0157376_10020851 Ga0157376_100208512 153
213 3300017792 Ga0163161_10001123 Ga0163161_100011239 153
214 3300025294 Ga0209025_1139351 Ga0209025_11393511 153
215 3300025711 Ga0207696_1034143 Ga0207696_10341432 153
216 3300025898 Ga0207692_10023679 Ga0207692_100236792 153
217 3300025899 Ga0207642_10001201 Ga0207642_100012014 153
218 3300025900 Ga0207710_10013002 Ga0207710_100130024 153
219 3300025901 Ga0207688_10000865 Ga0207688_1000086512 153
220 3300025903 Ga0207680_10654188 Ga0207680_106541881 153
221 3300025905 Ga0207685_10008226 Ga0207685_100082262 153
222 3300025906 Ga0207699_10026719 Ga0207699_100267193 153
223 3300025907 Ga0207645_10007742 Ga0207645_100077426 153
224 3300025911 Ga0207654_10259269 Ga0207654_102592692 153
225 3300025914 Ga0207671_10144581 Ga0207671_101445812 153
226 3300025915 Ga0207693_10000545 Ga0207693_1000054511 153
227 3300025916 Ga0207663_10000718 Ga0207663_100007187 153
228 3300025917 Ga0207660_10335495 Ga0207660_103354951 153
229 3300025919 Ga0207657_10148019 Ga0207657_101480191 153
230 3300025926 Ga0207659_11057708 Ga0207659_110577081 153
231 3300025927 Ga0207687_10004900 Ga0207687_100049009 153
232 3300025932 Ga0207690_10339902 Ga0207690_103399022 153
233 3300025933 Ga0207706_10001402 Ga0207706_1000140220 153
234 3300025933 Ga0207706_10239372 Ga0207706_102393722 153
235 3300025934 Ga0207686_10010671 Ga0207686_100106713 153
236 3300025935 Ga0207709_10004975 Ga0207709_100049754 153
237 3300025937 Ga0207669_10000779 Ga0207669_1000077911 153
238 3300025937 Ga0207669_10764327 Ga0207669_107643272 153
239 3300025938 Ga0207704_10001786 Ga0207704_100017862 153
240 3300025939 Ga0207665_10011769 Ga0207665_100117697 153
241 3300025941 Ga0207711_10322581 Ga0207711_103225812 153
242 3300025944 Ga0207661_11047884 Ga0207661_110478841 153
243 3300025961 Ga0207712_10000064 Ga0207712_1000006433 153
244 3300025961 Ga0207712_10001406 Ga0207712_100014069 153
245 3300025972 Ga0207668_10013251 Ga0207668_100132512 153
246 3300025981 Ga0207640_10003823 Ga0207640_100038236 153
247 3300025986 Ga0207658_10175041 Ga0207658_101750413 153
248 3300026023 Ga0207677_10065436 Ga0207677_100654362 153
249 3300026035 Ga0207703_10003340 Ga0207703_100033408 153
250 3300026041 Ga0207639_10010136 Ga0207639_100101362 153
251 3300026067 Ga0207678_10032946 Ga0207678_100329462 153
252 3300026078 Ga0207702_10160549 Ga0207702_101605491 153
253 3300026089 Ga0207648_10001779 Ga0207648_100017797 153
254 3300026118 Ga0207675_100000487 Ga0207675_10000048726 153
255 3300026118 Ga0207675_102064794 Ga0207675_1020647941 153
256 3300026121 Ga0207683_10000533 Ga0207683_1000053326 153
257 3300026142 Ga0207698_11290614 Ga0207698_112906142 153
258 3300028381 Ga0268264_10008949 Ga0268264_100089491 153
259 3300031901 Ga0307406_11464095 Ga0307406_114640951 153
260 3300031903 Ga0307407_10780433 Ga0307407_107804331 153
261 3300031911 Ga0307412_10973350 Ga0307412_109733502 153
262 3300035115 Ga0373941_0178914 Ga0373941_0178914_226_687 153
263 3300035171 Ga0373946_0626558 Ga0373946_0626558_31_516 153
264 3300035241 Ga0373961_0105575 Ga0373961_0105575_415_876 153
265 3300035691 Ga0373931_0270678 Ga0373931_0270678_204_677 153
266 3300037853 Ga0436364_1463279 Ga0436364_1463279_907_1392 153
267 3300041410 Ga0439461_0004937 Ga0439461_0004937_687_1157 153
268 3300041411 Ga0439466_0013134 Ga0439466_0013134_2500_2961 153
269 3300041413 Ga0439465_0018294 Ga0439465_0018294_318_779 153
270 3300041413 Ga0439465_0048898 Ga0439465_0048898_97_558 153
271 3300041413 Ga0439465_0064487 Ga0439465_0064487_566_1036 153
272 3300041452 Ga0451793_0296440 Ga0451793_0296440_577_1041 153
273 3300041456 Ga0451795_0606491 Ga0451795_0606491_48_512 153
274 3300041491 Ga0451833_1105833 Ga0451833_1105833_79_555 153
275 3300041491 Ga0451833_1497772 Ga0451833_1497772_285_749 153
276 3300041498 Ga0451841_1112184 Ga0451841_1112184_216_680 153
277 3300041997 Ga0439431_0000536 Ga0439431_0000536_4885_5355 153
278 3300041997 Ga0439431_0049085 Ga0439431_0049085_94_555 153
279 3300042004 Ga0439445_0013849 Ga0439445_0013849_463_933 153
280 3300042004 Ga0439445_0122434 Ga0439445_0122434_30_491 153
281 3300042435 Ga0439434_0003445 Ga0439434_0003445_2530_3000 153
282 3300044683 Ga0466965_0013261 Ga0466965_0013261_22_501 153
283 3300044683 Ga0466965_0138372 Ga0466965_0138372_720_1181 153
284 3300044693 Ga0466961_0137031 Ga0466961_0137031_138_602 153
285 3300044693 Ga0466961_0231884 Ga0466961_0231884_271_759 153
286 3300044694 Ga0466963_0008378 Ga0466963_0008378_4777_5265 153
287 3300044694 Ga0466963_0013678 Ga0466963_0013678_3405_3869 153
288 3300044694 Ga0466963_0099320 Ga0466963_0099320_1215_1679 153
289 3300044706 Ga0466964_0178567 Ga0466964_0178567_96_575 153
290 3300044719 Ga0466971_0037928 Ga0466971_0037928_541_1020 153
291 3300044719 Ga0466971_0068988 Ga0466971_0068988_408_869 153
292 3300044735 Ga0466968_0156086 Ga0466968_0156086_250_729 153
293 3300044765 Ga0466970_0150790 Ga0466970_0150790_288_767 153
294 3300044842 Ga0466957_0007296 Ga0466957_0007296_5413_5874 153
295 3300044842 Ga0466957_0227556 Ga0466957_0227556_452_931 153
296 3300044842 Ga0466957_0298228 Ga0466957_0298228_382_870 153
297 3300044901 Ga0466960_0070121 Ga0466960_0070121_1061_1522 153
298 3300044901 Ga0466960_0124579 Ga0466960_0124579_129_593 153
299 3300045049 Ga0466959_0269516 Ga0466959_0269516_403_882 153
300 3300045049 Ga0466959_0283675 Ga0466959_0283675_43_507 153
301 3300045836 Ga0466958_0075540 Ga0466958_0075540_1559_2023 153
302 3300045836 Ga0466958_0284296 Ga0466958_0284296_373_861 153
303 3300045976 Ga0466967_0043902 Ga0466967_0043902_1563_2027 153
304 3300045976 Ga0466967_0060249 Ga0466967_0060249_2149_2610 153
305 3300045976 Ga0466967_0088534 Ga0466967_0088534_2079_2543 153
306 3300045976 Ga0466967_0359587 Ga0466967_0359587_121_582 153
307 3300045976 Ga0466967_0963674 Ga0466967_0963674_121_582 153
308 3300045976 Ga0466967_1083128 Ga0466967_1083128_247_711 153
309 3300046511 Ga0495608_0105492 Ga0495608_0105492_15_479 153
310 3300046517 Ga0495630_0036054 Ga0495630_0036054_1210_1695 153
311 3300046517 Ga0495630_1276583 Ga0495630_1276583_40_504 153
312 3300046524 Ga0495648_0024134 Ga0495648_0024134_3198_3662 153
313 3300046524 Ga0495648_0051418 Ga0495648_0051418_857_1321 153
314 3300046675 Ga0495657_0292613 Ga0495657_0292613_423_887 153
315 3300046689 Ga0495613_0383953 Ga0495613_0383953_264_728 153
316 3300046692 Ga0495671_0151769 Ga0495671_0151769_210_674 153
317 3300047320 Ga0495672_0024321 Ga0495672_0024321_3260_3724 153
318 3300047320 Ga0495672_0068069 Ga0495672_0068069_1466_1930 153
319 3300047320 Ga0495672_0142781 Ga0495672_0142781_653_1138 153
320 3300047469 Ga0495673_0001846 Ga0495673_0001846_2840_3304 153
321 3300047469 Ga0495673_0043434 Ga0495673_0043434_1422_1886 153
322 3300047472 Ga0495686_0088521 Ga0495686_0088521_972_1436 153
323 3300047472 Ga0495686_0303171 Ga0495686_0303171_28_492 153
324 3300048903 Ga0496100_0001109 Ga0496100_0001109_9161_9625 153
325 3300048903 Ga0496100_0001413 Ga0496100_0001413_2865_3326 153
326 3300048904 Ga0496101_0000014 Ga0496101_0000014_37327_37791 153
327 3300048904 Ga0496101_0002676 Ga0496101_0002676_8316_8777 153
328 3300048905 Ga0496102_0000003 Ga0496102_0000003_516014_516520 153
329 3300048905 Ga0496102_0001374 Ga0496102_0001374_316_777 153
330 3300048905 Ga0496102_0010813 Ga0496102_0010813_6360_6821 153
331 3300048905 Ga0496102_0071891 Ga0496102_0071891_1185_1649 153
332 3300048905 Ga0496102_0489704 Ga0496102_0489704_626_1087 153
333 3300048906 Ga0496103_0000012 Ga0496103_0000012_225526_226032 153
334 3300048906 Ga0496103_0001003 Ga0496103_0001003_15031_15492 153
335 3300048906 Ga0496103_0375783 Ga0496103_0375783_130_591 153
336 3300048908 Ga0496105_0076531 Ga0496105_0076531_838_1299 153
337 3300048909 Ga0496106_0006025 Ga0496106_0006025_5899_6360 153
338 3300048909 Ga0496106_0044961 Ga0496106_0044961_1260_1724 153
339 3300048909 Ga0496106_0993473 Ga0496106_0993473_36_500 153
340 3300048910 Ga0496107_0005525 Ga0496107_0005525_4162_4623 153
341 3300048910 Ga0496107_0830872 Ga0496107_0830872_22_486 153
342 3300048911 Ga0496108_0023134 Ga0496108_0023134_4280_4744 153
343 3300048911 Ga0496108_0046284 Ga0496108_0046284_2409_2870 153
344 3300048912 Ga0496109_0130928 Ga0496109_0130928_1853_2317 153
345 3300048913 Ga0496110_0061250 Ga0496110_0061250_2290_2754 153
346 3300048913 Ga0496110_0144372 Ga0496110_0144372_1465_1926 153
347 3300048914 Ga0496111_0125766 Ga0496111_0125766_1314_1775 153
348 3300048915 Ga0496112_0027441 Ga0496112_0027441_4788_5252 153
349 3300048915 Ga0496112_0083586 Ga0496112_0083586_1028_1489 153
350 3300048917 Ga0496114_0003040 Ga0496114_0003040_8188_8649 153
351 3300048918 Ga0496115_0002167 Ga0496115_0002167_8001_8462 153
352 3300048919 Ga0496116_0000040 Ga0496116_0000040_270654_271160 153
353 3300048920 Ga0496117_0000003 Ga0496117_0000003_75744_76250 153
354 3300048921 Ga0496118_0000001 Ga0496118_0000001_75747_76253 153
355 3300048922 Ga0496119_0127243 Ga0496119_0127243_124_588 153
356 3300048924 Ga0496121_0204003 Ga0496121_0204003_841_1305 153
357 3300048929 Ga0496126_0001783 Ga0496126_0001783_2768_3232 153
358 3300049569 Ga0501032_0002599 Ga0501032_0002599_8088_8555 153
359 3300049570 Ga0501033_0633701 Ga0501033_0633701_169_636 153
360 3300049571 Ga0501034_0105790 Ga0501034_0105790_351_839 153
361 3300049571 Ga0501034_0228545 Ga0501034_0228545_379_846 153
362 3300049572 Ga0501036_0213715 Ga0501036_0213715_317_805 153
363 3300049573 Ga0501037_0000180 Ga0501037_0000180_32072_32539 153
364 3300049574 Ga0501038_0007628 Ga0501038_0007628_1422_1889 153
365 3300049575 Ga0501039_0001203 Ga0501039_0001203_5723_6190 153
366 3300049579 Ga0501043_0000441 Ga0501043_0000441_24952_25419 153
367 3300049579 Ga0501043_0132992 Ga0501043_0132992_101_601 153
368 3300049579 Ga0501043_0205069 Ga0501043_0205069_607_1095 153
369 3300049580 Ga0501046_0085099 Ga0501046_0085099_1146_1634 153
370 3300049581 Ga0501047_0028191 Ga0501047_0028191_4560_5048 153
371 3300049583 Ga0501067_0218300 Ga0501067_0218300_180_668 153
372 3300049586 Ga0501070_0000384 Ga0501070_0000384_11204_11671 153
373 3300049586 Ga0501070_0028630 Ga0501070_0028630_3885_4373 153
374 3300049586 Ga0501070_0050570 Ga0501070_0050570_101_562 153
375 3300049588 Ga0501072_0385998 Ga0501072_0385998_52_540 153
376 3300049588 Ga0501072_0890661 Ga0501072_0890661_191_658 153
377 3300049589 Ga0501073_0080650 Ga0501073_0080650_1517_1984 153
378 3300049589 Ga0501073_0180301 Ga0501073_0180301_666_1130 153
379 3300049590 Ga0501074_0349511 Ga0501074_0349511_71_559 153
380 3300049590 Ga0501074_0400989 Ga0501074_0400989_439_903 153
381 3300049593 Ga0501077_0355010 Ga0501077_0355010_312_779 153
382 3300049742 Ga0501080_0480586 Ga0501080_0480586_190_678 153
383 3300049823 Ga0501044_0289920 Ga0501044_0289920_841_1329 153
384 3300049823 Ga0501044_0342673 Ga0501044_0342673_607_1074 153
385 3300049824 Ga0501045_0308996 Ga0501045_0308996_679_1146 153
386 3300050489 nmdc:mga03683_17538_c1 nmdc:mga03683_17538_c1_1124_1588 153
387 3300050489 nmdc:mga03683_89636_c1 nmdc:mga03683_89636_c1_461_925 153
388 3300050490 nmdc:mga03n38_104958_c1 nmdc:mga03n38_104958_c1_564_1028 153
389 3300050490 nmdc:mga03n38_2780_c1 nmdc:mga03n38_2780_c1_716_1255 153
390 3300050490 nmdc:mga03n38_401_c1 nmdc:mga03n38_401_c1_9664_10128 153
391 3300050490 nmdc:mga03n38_480763_c1 nmdc:mga03n38_480763_c1_39_503 153
392 3300050491 nmdc:mga00v17_124436_c1 nmdc:mga00v17_124436_c1_304_768 153
393 3300050491 nmdc:mga00v17_287090_c1 nmdc:mga00v17_287090_c1_171_638 153
394 3300050491 nmdc:mga00v17_47740_c1 nmdc:mga00v17_47740_c1_1727_2191 153
395 3300050491 nmdc:mga00v17_6165_c1 nmdc:mga00v17_6165_c1_4876_5346 153
396 3300050491 nmdc:mga00v17_7536_c1 nmdc:mga00v17_7536_c1_5124_5588 153
397 3300050491 nmdc:mga00v17_7783_c1 nmdc:mga00v17_7783_c1_4982_5446 153
398 3300050492 nmdc:mga0yw44_144303_c1 nmdc:mga0yw44_144303_c1_60_524 153
399 3300050492 nmdc:mga0yw44_390373_c1 nmdc:mga0yw44_390373_c1_362_826 153
400 3300050493 nmdc:mga0k408_152733_c1 nmdc:mga0k408_152733_c1_338_802 153
401 3300050494 nmdc:mga06z11_217684_c1 nmdc:mga06z11_217684_c1_184_648 153
402 3300050495 nmdc:mga04h51_25804_c1 nmdc:mga04h51_25804_c1_375_839 153
403 3300050496 nmdc:mga07m45_18146_c1 nmdc:mga07m45_18146_c1_461_922 153
404 3300050496 nmdc:mga07m45_2738_c1 nmdc:mga07m45_2738_c1_1044_1505 153
405 3300050507 nmdc:mga05p37_35880_c1 nmdc:mga05p37_35880_c1_5158_5619 153
406 3300050509 nmdc:mga0qj67_55995_c1 nmdc:mga0qj67_55995_c1_1471_1932 153
407 3300050510 nmdc:mga06r32_233539_c1 nmdc:mga06r32_233539_c1_1196_1657 153
408 3300050516 nmdc:mga0sz30_370457_c1 nmdc:mga0sz30_370457_c1_80_541 153
409 3300050516 nmdc:mga0sz30_391259_c1 nmdc:mga0sz30_391259_c1_49_510 153
410 3300053083 Ga0495655_0172974 Ga0495655_0172974_61_525 153
411 3300053084 Ga0495595_0054159 Ga0495595_0054159_154_618 153
412 3300053085 Ga0495619_0015369 Ga0495619_0015369_3160_3624 153
413 3300061719 Ga0466962_0025141 Ga0466962_0025141_50_529 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

28

173

0.86

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

37

156

0.77

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

38

177

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8024 2 152
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.8019 2 151
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.7919 2 151
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7759 5 153
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.7732 5 152
ID Description Score Start End Superfamily
af_O07748_5_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8578 4 152 3.30.530.20
af_P9WM73_75_221_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8343 4 153 3.30.530.20
af_O07748_5_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.831 4 152 3.30.530.20
af_P9WM73_75_221_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.824 4 153 3.30.530.20
3tfzE00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7911 5 152 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A367APA8-F1-model_v4 SRPBCC family protein 0.9862 1 152
AF-A0A1W9Z3C6-F1-model_v4 Polyketide cyclase 0.986 1 153
AF-L1MJF8-F1-model_v4 Polyketide cyclase/dehydrase 0.9848 3 152
AF-A0A5S4ZF84-F1-model_v4 deleted 0.9839 1 152
AF-A0A6P0GI02-F1-model_v4 SRPBCC family protein 0.9818 1 153

Feature Viewer

pLDDT pTM Quality
95.83 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map