F438045

General Info

Members Datasets Scaffolds Average Seq Length
413 250 826 294

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10082263|Ga0099794_100822631
Length 323
Sequence MTSCDSVADPKNGSRAEDGMAKRKKGTVGVVGLGIMGGSFARNLVESGWRVLGYDTDPKRRRALAKAGVEIAPDVAALAKAVPTIITSLPSPKALDMVVAEITATKRPSKVVIEASTFTLDDKERAERALRKAGHIPLDCPISGTGAQAAVKDLVVYASGDTRTIARLKPLFLGFSRAVHDLGEFGNGSRMKYVANLLVAIHNVASAEAMVLGIKAGLDPKRIFDLVKIGAGNSRVFELRAPMMVKNNYDAATMKIKVWQKDMDVIGSYATSLGVPTPLFSATIPVYASAMSMGHGLQDTAAVCAVLEAMAGVRRSRKRRNKR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.59
Nodule 0
Rhizoplane 7.26
Rhizosphere 77.97
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10082263 3300007265 Bacteria 1589
2 JGI25406J46586_10047703 3300003203 Bacteria 1458
3 Ga0065712_10142110 3300005290 Bacteria 1441
4 Ga0065707_10238411 3300005295 Bacteria 1164
5 Ga0070683_100033424 3300005329 Bacteria 4690
6 Ga0070683_100216330 3300005329 Bacteria 1821
7 Ga0070690_100155395 3300005330 Unclassified 1564
8 Ga0070670_100367656 3300005331 Bacteria 1265
9 Ga0070680_100105534 3300005336 Bacteria 2342
10 Ga0070691_10029776 3300005341 Bacteria 2556
11 Ga0070669_100342027 3300005353 Bacteria 1213
12 Ga0070674_100052471 3300005356 Bacteria 2813
13 Ga0070674_100246062 3300005356 Bacteria 1402
14 Ga0070688_100038185 3300005365 Bacteria 2931
15 Ga0070709_10216505 3300005434 Bacteria 1364
16 Ga0070709_10233124 3300005434 Bacteria 1318
17 Ga0070714_100018190 3300005435 Bacteria 5703
18 Ga0070714_100099169 3300005435 Bacteria 2563
19 Ga0070714_100371312 3300005435 Bacteria 1347
20 Ga0070713_100143123 3300005436 Bacteria 2120
21 Ga0070713_100205548 3300005436 Bacteria 1780
22 Ga0070694_100020732 3300005444 Bacteria 4193
23 Ga0070708_100133875 3300005445 Bacteria 2295
24 Ga0070678_100276793 3300005456 Bacteria 1417
25 Ga0070662_100092740 3300005457 Bacteria 2270
26 Ga0068867_100181075 3300005459 Bacteria 1675
27 Ga0070685_10024687 3300005466 Bacteria 3303
28 Ga0070685_10065427 3300005466 Bacteria 2140
29 Ga0070679_100340114 3300005530 Bacteria 1449
30 Ga0070684_100220623 3300005535 Bacteria 1730
31 Ga0068853_100289532 3300005539 Bacteria 1512
32 Ga0070704_100128335 3300005549 Bacteria 1961
33 Ga0068857_100103689 3300005577 Bacteria 2553
34 Ga0068859_100422355 3300005617 Bacteria 1429
35 Ga0068864_100055703 3300005618 Bacteria 3414
36 Ga0068862_100206072 3300005844 Bacteria 1775
37 Ga0081455_10000307 3300005937 Bacteria 64591
38 Ga0081455_10035536 3300005937 Bacteria 4451
39 Ga0081455_10065962 3300005937 Unclassified 3025
40 Ga0081540_1002509 3300005983 Bacteria 14917
41 Ga0081539_10009942 3300005985 Bacteria 7844
42 Ga0070717_10062267 3300006028 Bacteria 3093
43 Ga0075365_10000880 3300006038 Bacteria 12565
44 Ga0075365_10055329 3300006038 Bacteria 2633
45 Ga0075368_10004113 3300006042 Bacteria 4898
46 Ga0075368_10047204 3300006042 Bacteria 1704
47 Ga0075368_10074568 3300006042 Bacteria 1374
48 Ga0075368_10085796 3300006042 Bacteria 1284
49 Ga0075363_100003359 3300006048 Bacteria 6795
50 Ga0075363_100012282 3300006048 Bacteria 4125
51 Ga0075363_100032480 3300006048 Bacteria 2711
52 Ga0075363_100041438 3300006048 Bacteria 2429
53 Ga0075364_10002131 3300006051 Bacteria 11075
54 Ga0075364_10038148 3300006051 Bacteria 3112
55 Ga0075364_10095486 3300006051 Unclassified 1977
56 Ga0075364_10119456 3300006051 Bacteria 1764
57 Ga0070715_10038460 3300006163 Bacteria 1986
58 Ga0070712_100196953 3300006175 Bacteria 1580
59 Ga0075362_10004637 3300006177 Bacteria 4956
60 Ga0075367_10005253 3300006178 Bacteria 6401
61 Ga0075367_10016663 3300006178 Bacteria 4016
62 Ga0075367_10025758 3300006178 Bacteria 3329
63 Ga0075367_10031813 3300006178 Bacteria 3031
64 Ga0075369_10004519 3300006186 Bacteria 5149
65 Ga0075366_10003121 3300006195 Bacteria 8667
66 Ga0097621_100001458 3300006237 Bacteria 16175
67 Ga0075370_10003119 3300006353 Bacteria 7824
68 Ga0075370_10149984 3300006353 Bacteria 1366
69 Ga0068871_100003552 3300006358 Bacteria 10732
70 Ga0075428_100000068 3300006844 Bacteria 83416
71 Ga0075428_100014981 3300006844 Bacteria 8618
72 Ga0075428_100033510 3300006844 Bacteria 5671
73 Ga0075428_100036762 3300006844 Bacteria 5392
74 Ga0075428_100096376 3300006844 Unclassified 3224
75 Ga0075430_100020234 3300006846 Bacteria 5662
76 Ga0075430_100024393 3300006846 Bacteria 5147
77 Ga0075430_100028949 3300006846 Bacteria 4702
78 Ga0075430_100332809 3300006846 Unclassified 1255
79 Ga0075431_100000217 3300006847 Bacteria 42647
80 Ga0075431_100000602 3300006847 Bacteria 30370
81 Ga0075431_100016523 3300006847 Bacteria 7491
82 Ga0075433_10056353 3300006852 Bacteria 3432
83 Ga0075434_100004499 3300006871 Bacteria 12576
84 Ga0075434_100645278 3300006871 Bacteria 1077
85 Ga0075429_100002468 3300006880 Bacteria 15555
86 Ga0075429_100005381 3300006880 Bacteria 11016
87 Ga0075429_100051350 3300006880 Bacteria 3588
88 Ga0075429_100388617 3300006880 Bacteria 1222
89 Ga0097620_100422337 3300006931 Bacteria 1429
90 Ga0075435_100033979 3300007076 Bacteria 4037
91 Ga0075435_100340148 3300007076 Bacteria 1286
92 Ga0099795_10020051 3300007788 Bacteria 2173
93 Ga0111539_10000725 3300009094 Bacteria 42875
94 Ga0111539_10001483 3300009094 Bacteria 31339
95 Ga0111539_10013525 3300009094 Bacteria 10199
96 Ga0111539_10216855 3300009094 Unclassified 2229
97 Ga0105245_10184396 3300009098 Bacteria 1996
98 Ga0114129_10000035 3300009147 Bacteria 110735
99 Ga0114129_10000227 3300009147 Bacteria 62698
100 Ga0105243_10075972 3300009148 Bacteria 2728
101 Ga0105237_10066260 3300009545 Bacteria 3606
102 Ga0105238_10291716 3300009551 Bacteria 1613
103 Ga0105249_10121507 3300009553 Bacteria 2482
104 Ga0105239_10173981 3300010375 Bacteria 2408
105 Ga0157372_10544207 3300013307 Bacteria 1353
106 Ga0157376_10022150 3300014969 Bacteria 4947
107 Ga0163161_10130449 3300017792 Bacteria 1895
108 Ga0213875_10000918 3300021388 Bacteria 21317
109 Ga0207682_10009429 3300025893 Bacteria 3851
110 Ga0207688_10016460 3300025901 Bacteria 4010
111 Ga0207699_10096167 3300025906 Bacteria 1869
112 Ga0207699_10113836 3300025906 Bacteria 1739
113 Ga0207643_10051055 3300025908 Bacteria 2347
114 Ga0207705_10149062 3300025909 Bacteria 1752
115 Ga0207660_10223121 3300025917 Bacteria 1480
116 Ga0207662_10010784 3300025918 Bacteria 5050
117 Ga0207662_10171018 3300025918 Bacteria 1393
118 Ga0207681_10190434 3300025923 Bacteria 1569
119 Ga0207694_10254982 3300025924 Bacteria 1436
120 Ga0207659_10150000 3300025926 Bacteria 1820
121 Ga0207700_10455925 3300025928 Bacteria 1127
122 Ga0207664_10118250 3300025929 Bacteria 2214
123 Ga0207664_10143376 3300025929 Bacteria 2023
124 Ga0207690_10011454 3300025932 Bacteria 5303
125 Ga0207706_10004983 3300025933 Bacteria 12407
126 Ga0207706_10012032 3300025933 Bacteria 7884
127 Ga0207709_10052039 3300025935 Bacteria 2513
128 Ga0207709_10125475 3300025935 Bacteria 1740
129 Ga0207670_10051072 3300025936 Bacteria 2774
130 Ga0207669_10083516 3300025937 Bacteria 2054
131 Ga0207665_10121956 3300025939 Bacteria 1842
132 Ga0207691_10014634 3300025940 Bacteria 7479
133 Ga0207691_10072859 3300025940 Bacteria 3098
134 Ga0207711_10462516 3300025941 Bacteria 1181
135 Ga0207661_10064713 3300025944 Bacteria 2965
136 Ga0207661_10071565 3300025944 Bacteria 2834
137 Ga0207677_10288587 3300026023 Bacteria 1350
138 Ga0207639_10154803 3300026041 Bacteria 1924
139 Ga0207648_10095256 3300026089 Bacteria 2604
140 Ga0207676_10689717 3300026095 Bacteria 988
141 Ga0209967_1002458 3300027364 Bacteria 2400
142 Ga0209967_1015492 3300027364 Bacteria 1091
143 Ga0209588_1020732 3300027671 Bacteria 2059
144 Ga0209813_10059840 3300027866 Bacteria 1214
145 Ga0207428_10004340 3300027907 Bacteria 13544
146 Ga0207428_10005218 3300027907 Bacteria 12141
147 Ga0207428_10044183 3300027907 Bacteria 3595
148 Ga0268266_10159430 3300028379 Bacteria 2040
149 Ga0265330_10093552 3300031235 Bacteria 1289
150 Ga0265332_10003990 3300031238 Bacteria 7028
151 Ga0265325_10085725 3300031241 Bacteria 1560
152 Ga0265340_10004026 3300031247 Bacteria 8253
153 Ga0265340_10047863 3300031247 Bacteria 2080
154 Ga0265340_10069985 3300031247 Bacteria 1665
155 Ga0265339_10001909 3300031249 Bacteria 15294
156 Ga0265339_10124982 3300031249 Bacteria 1319
157 Ga0265316_10180803 3300031344 Bacteria 1570
158 Ga0265316_10378672 3300031344 Bacteria 1021
159 Ga0307513_10035639 3300031456 Bacteria 5563
160 Ga0307408_100224428 3300031548 Bacteria 1535
161 Ga0265313_10072078 3300031595 Bacteria 1588
162 Ga0316579_10013494 3300031691 Bacteria 3515
163 Ga0265314_10037086 3300031711 Bacteria 3535
164 Ga0265342_10007249 3300031712 Bacteria 8147
165 Ga0307410_10406853 3300031852 Unclassified 1101
166 Ga0307416_100014634 3300032002 Bacteria 5387
167 Ga0307411_10145471 3300032005 Bacteria 1754
168 Ga0373930_0004748 3300034816 Bacteria 2228
169 Ga0373959_0022524 3300034820 Bacteria 1218
170 Ga0373940_0011312 3300035088 Bacteria 2117
171 Ga0373940_0028840 3300035088 Bacteria 1467
172 Ga0373923_0064400 3300035111 Bacteria 1563
173 Ga0373936_0001176 3300035113 Bacteria 9420
174 Ga0373936_0032741 3300035113 Bacteria 2057
175 Ga0373939_0027719 3300035114 Bacteria 1607
176 Ga0373954_0071417 3300035118 Bacteria 1650
177 Ga0373960_0009612 3300035121 Bacteria 2347
178 Ga0373943_0049516 3300035170 Bacteria 2062
179 Ga0373946_0024048 3300035171 Bacteria 2384
180 Ga0373961_0003018 3300035241 Bacteria 4247
181 Ga0373961_0057366 3300035241 Bacteria 1171
182 Ga0373962_0000899 3300035242 Bacteria 6798
183 Ga0373931_0000357 3300035691 Bacteria 18799
184 Ga0373931_0008809 3300035691 Bacteria 4800
185 Ga0373931_0027874 3300035691 Unclassified 2887
186 Ga0373935_0001908 3300035692 Bacteria 11719
187 Ga0373935_0145958 3300035692 Unclassified 1602
188 Ga0373927_0017410 3300035695 Bacteria 4729
189 Ga0373927_0386667 3300035695 Bacteria 923
190 Ga0373933_0002487 3300035724 Bacteria 10361
191 Ga0373933_0097771 3300035724 Bacteria 1818
192 Ga0373947_0002855 3300035725 Bacteria 10317
193 Ga0373947_0072176 3300035725 Bacteria 2119
194 Ga0373937_0000098 3300036401 Bacteria 81900
195 Ga0373937_0027157 3300036401 Bacteria 5174
196 Ga0373937_0449799 3300036401 Bacteria 1223
197 Ga0373925_0000075 3300037068 Bacteria 105395
198 Ga0436364_0266645 3300037853 Bacteria 19395
199 Ga0436364_1260934 3300037853 Unclassified 1347
200 Ga0436364_1306448 3300037853 Bacteria 1329
201 Ga0436365_0480378 3300039437 Bacteria 4075
202 Ga0436365_1780498 3300039437 Bacteria 3621
203 Ga0439453_0000873 3300041408 Bacteria 3600
204 Ga0451853_3286882 3300041512 Bacteria 1110
205 Ga0439446_0038782 3300042156 Bacteria 1398
206 Ga0466963_0164696 3300044694 Bacteria 1544
207 Ga0466967_0068553 3300045976 Bacteria 3168
208 Ga0495592_0000060 3300046454 Bacteria 100113
209 Ga0495629_0017051 3300046459 Bacteria 5211
210 Ga0495638_0007272 3300046460 Bacteria 7960
211 Ga0495651_0000181 3300046462 Bacteria 46803
212 Ga0495653_0000740 3300046463 Bacteria 24927
213 Ga0495605_0089714 3300046474 Bacteria 1426
214 Ga0495662_0004671 3300046476 Bacteria 6872
215 Ga0495664_0000003 3300046477 Bacteria 551602
216 Ga0495584_0007218 3300046491 Bacteria 5798
217 Ga0495608_0000011 3300046511 Bacteria 248514
218 Ga0495618_0000044 3300046514 Bacteria 95526
219 Ga0495628_0000001 3300046516 Bacteria 917742
220 Ga0495628_0039819 3300046516 Bacteria 3758
221 Ga0495630_0002317 3300046517 Bacteria 13234
222 Ga0495631_0057306 3300046518 Bacteria 1696
223 Ga0495652_0000002 3300046529 Bacteria 946606
224 Ga0495652_0220665 3300046529 Bacteria 1425
225 Ga0495640_0000002 3300046533 Bacteria 646434
226 Ga0495587_0000001 3300046536 Bacteria 724132
227 Ga0495645_0000002 3300046543 Bacteria 651644
228 Ga0495667_0000039 3300046559 Bacteria 131308
229 Ga0495634_0000010 3300046642 Bacteria 143792
230 Ga0495635_0000001 3300046663 Bacteria 704901
231 Ga0495635_0039757 3300046663 Bacteria 3253
232 Ga0495657_0000042 3300046675 Bacteria 114669
233 Ga0495599_0000013 3300046678 Bacteria 179828
234 Ga0495623_0000024 3300046679 Bacteria 96499
235 Ga0495646_0000009 3300046680 Bacteria 200698
236 Ga0495658_0045197 3300046683 Bacteria 2471
237 Ga0495624_0044630 3300046690 Bacteria 2825
238 Ga0495600_0000209 3300046809 Bacteria 33688
239 Ga0495600_0274278 3300046809 Bacteria 1069
240 Ga0495581_0046497 3300047315 Bacteria 2508
241 Ga0495604_0000069 3300047317 Bacteria 89935
242 Ga0495604_0172445 3300047317 Unclassified 1520
243 Ga0495674_0000002 3300047319 Bacteria 642785
244 Ga0495672_0057463 3300047320 Bacteria 2259
245 Ga0495672_0125275 3300047320 Bacteria 1359
246 Ga0495680_0000328 3300047322 Bacteria 53287
247 Ga0495680_0180267 3300047322 Bacteria 1525
248 Ga0495675_0000245 3300047444 Bacteria 39142
249 Ga0495684_0000016 3300047471 Bacteria 169338
250 Ga0495684_0261919 3300047471 Bacteria 1254
251 Ga0495593_0000555 3300047673 Bacteria 21201
252 Ga0495602_0000024 3300048088 Bacteria 151162
253 Ga0495602_0079218 3300048088 Bacteria 2772
254 Ga0495615_0043429 3300048090 Bacteria 1131
255 Ga0496101_0003618 3300048904 Bacteria 9646
256 Ga0496102_0001206 3300048905 Bacteria 23466
257 Ga0496102_0482253 3300048905 Unclassified 1161
258 Ga0496104_0001937 3300048907 Bacteria 17935
259 Ga0496104_0003403 3300048907 Bacteria 13734
260 Ga0496104_0015391 3300048907 Bacteria 6927
261 Ga0496105_0007102 3300048908 Bacteria 8638
262 Ga0496105_0078472 3300048908 Bacteria 2726
263 Ga0496105_0098706 3300048908 Bacteria 2411
264 Ga0496105_0230853 3300048908 Unclassified 1504
265 Ga0496106_0005172 3300048909 Bacteria 9662
266 Ga0496107_0000601 3300048910 Bacteria 20084
267 Ga0496108_0003482 3300048911 Bacteria 12623
268 Ga0496108_0007425 3300048911 Bacteria 8885
269 Ga0496108_0214621 3300048911 Bacteria 1671
270 Ga0496109_0003972 3300048912 Bacteria 12347
271 Ga0496109_0052660 3300048912 Bacteria 3710
272 Ga0496110_0001677 3300048913 Bacteria 16256
273 Ga0496110_0143589 3300048913 Bacteria 2158
274 Ga0496110_0247386 3300048913 Bacteria 1623
275 Ga0496111_0000535 3300048914 Bacteria 19672
276 Ga0496111_0059084 3300048914 Bacteria 2778
277 Ga0496112_0016516 3300048915 Bacteria 6918
278 Ga0496112_0032487 3300048915 Bacteria 5068
279 Ga0496113_0004152 3300048916 Bacteria 8837
280 Ga0496113_0099506 3300048916 Bacteria 2252
281 Ga0496114_0088495 3300048917 Bacteria 2627
282 Ga0496114_0246836 3300048917 Bacteria 1571
283 Ga0496115_0129169 3300048918 Bacteria 2082
284 Ga0496115_0247997 3300048918 Bacteria 1467
285 Ga0496121_0000225 3300048924 Bacteria 122351
286 Ga0501032_0056592 3300049569 Bacteria 2636
287 Ga0501032_0173952 3300049569 Bacteria 1411
288 Ga0501034_0025281 3300049571 Bacteria 6045
289 Ga0501034_0048101 3300049571 Bacteria 4304
290 Ga0501034_0135086 3300049571 Bacteria 2447
291 Ga0501034_0141766 3300049571 Bacteria 2382
292 Ga0501034_0252506 3300049571 Bacteria 1708
293 Ga0501036_0026273 3300049572 Bacteria 4913
294 Ga0501036_0058089 3300049572 Bacteria 3277
295 Ga0501036_0095536 3300049572 Bacteria 2512
296 Ga0501036_0121245 3300049572 Bacteria 2208
297 Ga0501036_0157022 3300049572 Bacteria 1918
298 Ga0501036_0554669 3300049572 Bacteria 954
299 Ga0501037_0034931 3300049573 Bacteria 3708
300 Ga0501037_0035778 3300049573 Bacteria 3659
301 Ga0501037_0397449 3300049573 Bacteria 945
302 Ga0501038_0033874 3300049574 Bacteria 4494
303 Ga0501039_0106202 3300049575 Bacteria 2193
304 Ga0501040_0094181 3300049576 Unclassified 2084
305 Ga0501040_0228289 3300049576 Bacteria 1325
306 Ga0501041_0272850 3300049577 Bacteria 1064
307 Ga0501042_0273624 3300049578 Bacteria 1219
308 Ga0501043_0047680 3300049579 Bacteria 3368
309 Ga0501043_0229976 3300049579 Bacteria 1432
310 Ga0501046_0014619 3300049580 Bacteria 6613
311 Ga0501047_0218040 3300049581 Bacteria 1764
312 Ga0501047_0233383 3300049581 Bacteria 1692
313 Ga0501047_0358786 3300049581 Bacteria 1293
314 Ga0501048_0065868 3300049582 Bacteria 2561
315 Ga0501068_0032180 3300049584 Bacteria 3117
316 Ga0501068_0055034 3300049584 Bacteria 2410
317 Ga0501068_0291549 3300049584 Bacteria 1043
318 Ga0501070_0046008 3300049586 Bacteria 3629
319 Ga0501072_0014777 3300049588 Bacteria 5986
320 Ga0501072_0111890 3300049588 Bacteria 2174
321 Ga0501073_0049271 3300049589 Bacteria 2954
322 Ga0501073_0129221 3300049589 Bacteria 1751
323 Ga0501073_0199746 3300049589 Bacteria 1383
324 Ga0501073_0229528 3300049589 Bacteria 1282
325 Ga0501074_0052200 3300049590 Bacteria 2952
326 Ga0501074_0148012 3300049590 Bacteria 1679
327 Ga0501075_0057695 3300049591 Bacteria 2923
328 Ga0501075_0057873 3300049591 Bacteria 2919
329 Ga0501076_0013656 3300049592 Bacteria 6094
330 Ga0501076_0052082 3300049592 Bacteria 3242
331 Ga0501076_0078296 3300049592 Bacteria 2653
332 Ga0501076_0283493 3300049592 Bacteria 1357
333 Ga0501077_0005408 3300049593 Bacteria 7765
334 Ga0501077_0077941 3300049593 Bacteria 2100
335 Ga0501079_0009679 3300049741 Bacteria 7308
336 Ga0501080_0027061 3300049742 Bacteria 5332
337 Ga0501080_0033462 3300049742 Bacteria 4797
338 Ga0501081_0012691 3300049743 Bacteria 5540
339 Ga0501081_0213836 3300049743 Bacteria 1401
340 Ga0501081_0225345 3300049743 Bacteria 1364
341 Ga0501083_0112482 3300049744 Bacteria 1789
342 Ga0501035_0079886 3300049822 Bacteria 2888
343 Ga0501044_0067303 3300049823 Bacteria 3649
344 Ga0501044_0081667 3300049823 Bacteria 3271
345 Ga0501044_0192418 3300049823 Bacteria 2002
346 Ga0501044_0403286 3300049823 Bacteria 1279
347 Ga0501045_0271970 3300049824 Bacteria 1261
348 Ga0501045_0291890 3300049824 Unclassified 1213
349 Ga0501045_0292629 3300049824 Bacteria 1212
350 nmdc:mga03683_15662_c1 3300050489 Bacteria 2834
351 nmdc:mga03683_3107_c1 3300050489 Bacteria 5282
352 nmdc:mga03n38_12584_c1 3300050490 Bacteria 3189
353 nmdc:mga03n38_40912_c1 3300050490 Bacteria 2017
354 nmdc:mga00v17_146439_c1 3300050491 Unclassified 1516
355 nmdc:mga00v17_189614_c1 3300050491 Bacteria 1328
356 nmdc:mga00v17_25314_c1 3300050491 Bacteria 3449
357 nmdc:mga0yw44_142628_c1 3300050492 Bacteria 1558
358 nmdc:mga0yw44_40027_c1 3300050492 Unclassified 2782
359 nmdc:mga0k408_5072_c1 3300050493 Bacteria 6978
360 nmdc:mga06z11_174360_c1 3300050494 Bacteria 1237
361 nmdc:mga06z11_34168_c1 3300050494 Bacteria 2494
362 nmdc:mga06z11_39702_c1 3300050494 Bacteria 2344
363 nmdc:mga06z11_47337_c1 3300050494 Bacteria 2184
364 nmdc:mga06z11_68706_c1 3300050494 Bacteria 1868
365 nmdc:mga06z11_74459_c1 3300050494 Bacteria 1805
366 nmdc:mga04h51_23134_c1 3300050495 Bacteria 1889
367 nmdc:mga04h51_42036_c1 3300050495 Bacteria 1497
368 nmdc:mga05p37_203_c1 3300050507 Bacteria 59589
369 nmdc:mga05p37_76_c1 3300050507 Bacteria 86726
370 nmdc:mga09592_218764_c1 3300050508 Bacteria 1650
371 nmdc:mga09592_2614_c1 3300050508 Bacteria 14574
372 nmdc:mga09592_29272_c1 3300050508 Bacteria 4580
373 nmdc:mga09592_72985_c1 3300050508 Bacteria 2915
374 nmdc:mga0qj67_3805_c1 3300050509 Bacteria 10900
375 nmdc:mga0qj67_381171_c1 3300050509 Bacteria 1139
376 nmdc:mga0qj67_98026_c1 3300050509 Bacteria 2361
377 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
378 nmdc:mga06r32_1490_c1 3300050510 Bacteria 21045
379 nmdc:mga06r32_426044_c1 3300050510 Bacteria 1308
380 nmdc:mga06r32_8156_c1 3300050510 Bacteria 9422
381 nmdc:mga08y16_152042_c1 3300050511 Unclassified 2405
382 nmdc:mga08y16_33512_c1 3300050511 Bacteria 5394
383 nmdc:mga08y16_961_c1 3300050511 Bacteria 28000
384 nmdc:mga0n895_109601_c1 3300050512 Bacteria 2776
385 nmdc:mga0n895_9151_c1 3300050512 Bacteria 8647
386 nmdc:mga0rr50_359833_c1 3300050513 Bacteria 1225
387 nmdc:mga08x19_41107_c1 3300050514 Bacteria 2945
388 nmdc:mga0a205_580_c2 3300050515 Bacteria 27924
389 nmdc:mga0sz30_35740_c1 3300050516 Bacteria 2075
390 Ga0495601_0000001 3300053077 Bacteria 549454
391 Ga0495601_0184097 3300053077 Bacteria 1365
392 Ga0495612_0000017 3300053078 Bacteria 152112
393 Ga0495595_0000010 3300053084 Bacteria 178819
394 Ga0495619_0000004 3300053085 Bacteria 500068
395 Ga0500641_0004194 3300053096 Bacteria 5089
396 Ga0500562_025676 3300053108 Bacteria 1543
397 Ga0500593_110529 3300053117 Bacteria 1130
398 Ga0500595_003170 3300053119 Bacteria 7783
399 Ga0500595_037471 3300053119 Bacteria 1581
400 Ga0500588_0026153 3300053146 Bacteria 1630
401 Ga0500616_0004397 3300053153 Bacteria 10067
402 Ga0500616_0083260 3300053153 Bacteria 1603
403 Ga0500636_0007380 3300053177 Bacteria 6358
404 Ga0501084_0026027 3300054114 Bacteria 4880
405 Ga0501084_0070622 3300054114 Bacteria 2924
406 Ga0501084_0077923 3300054114 Bacteria 2778
407 Ga0501084_0175710 3300054114 Bacteria 1808
408 Ga0501084_0383858 3300054114 Bacteria 1187
409 Ga0501082_0000510 3300060353 Bacteria 34491
410 Ga0501082_0009645 3300060353 Bacteria 8310
411 Ga0501082_0137714 3300060353 Bacteria 2118
412 Ga0530510_0188081 3300061734 Unclassified 1532
413 Ga0530510_0392331 3300061734 Bacteria 1045
414 Ga0099794_10082263
415 JGI25406J46586_10047703
416 Ga0065712_10142110
417 Ga0065707_10238411
418 Ga0070683_100033424
419 Ga0070683_100216330
420 Ga0070690_100155395
421 Ga0070670_100367656
422 Ga0070680_100105534
423 Ga0070691_10029776
424 Ga0070669_100342027
425 Ga0070674_100052471
426 Ga0070674_100246062
427 Ga0070688_100038185
428 Ga0070709_10216505
429 Ga0070709_10233124
430 Ga0070714_100018190
431 Ga0070714_100099169
432 Ga0070714_100371312
433 Ga0070713_100143123
434 Ga0070713_100205548
435 Ga0070694_100020732
436 Ga0070708_100133875
437 Ga0070678_100276793
438 Ga0070662_100092740
439 Ga0068867_100181075
440 Ga0070685_10024687
441 Ga0070685_10065427
442 Ga0070679_100340114
443 Ga0070684_100220623
444 Ga0068853_100289532
445 Ga0070704_100128335
446 Ga0068857_100103689
447 Ga0068859_100422355
448 Ga0068864_100055703
449 Ga0068862_100206072
450 Ga0081455_10000307
451 Ga0081455_10035536
452 Ga0081455_10065962
453 Ga0081540_1002509
454 Ga0081539_10009942
455 Ga0070717_10062267
456 Ga0075365_10000880
457 Ga0075365_10055329
458 Ga0075368_10004113
459 Ga0075368_10047204
460 Ga0075368_10074568
461 Ga0075368_10085796
462 Ga0075363_100003359
463 Ga0075363_100012282
464 Ga0075363_100032480
465 Ga0075363_100041438
466 Ga0075364_10002131
467 Ga0075364_10038148
468 Ga0075364_10095486
469 Ga0075364_10119456
470 Ga0070715_10038460
471 Ga0070712_100196953
472 Ga0075362_10004637
473 Ga0075367_10005253
474 Ga0075367_10016663
475 Ga0075367_10025758
476 Ga0075367_10031813
477 Ga0075369_10004519
478 Ga0075366_10003121
479 Ga0097621_100001458
480 Ga0075370_10003119
481 Ga0075370_10149984
482 Ga0068871_100003552
483 Ga0075428_100000068
484 Ga0075428_100014981
485 Ga0075428_100033510
486 Ga0075428_100036762
487 Ga0075428_100096376
488 Ga0075430_100020234
489 Ga0075430_100024393
490 Ga0075430_100028949
491 Ga0075430_100332809
492 Ga0075431_100000217
493 Ga0075431_100000602
494 Ga0075431_100016523
495 Ga0075433_10056353
496 Ga0075434_100004499
497 Ga0075434_100645278
498 Ga0075429_100002468
499 Ga0075429_100005381
500 Ga0075429_100051350
501 Ga0075429_100388617
502 Ga0097620_100422337
503 Ga0075435_100033979
504 Ga0075435_100340148
505 Ga0099795_10020051
506 Ga0111539_10000725
507 Ga0111539_10001483
508 Ga0111539_10013525
509 Ga0111539_10216855
510 Ga0105245_10184396
511 Ga0114129_10000035
512 Ga0114129_10000227
513 Ga0105243_10075972
514 Ga0105237_10066260
515 Ga0105238_10291716
516 Ga0105249_10121507
517 Ga0105239_10173981
518 Ga0157372_10544207
519 Ga0157376_10022150
520 Ga0163161_10130449
521 Ga0213875_10000918
522 Ga0207682_10009429
523 Ga0207688_10016460
524 Ga0207699_10096167
525 Ga0207699_10113836
526 Ga0207643_10051055
527 Ga0207705_10149062
528 Ga0207660_10223121
529 Ga0207662_10010784
530 Ga0207662_10171018
531 Ga0207681_10190434
532 Ga0207694_10254982
533 Ga0207659_10150000
534 Ga0207700_10455925
535 Ga0207664_10118250
536 Ga0207664_10143376
537 Ga0207690_10011454
538 Ga0207706_10004983
539 Ga0207706_10012032
540 Ga0207709_10052039
541 Ga0207709_10125475
542 Ga0207670_10051072
543 Ga0207669_10083516
544 Ga0207665_10121956
545 Ga0207691_10014634
546 Ga0207691_10072859
547 Ga0207711_10462516
548 Ga0207661_10064713
549 Ga0207661_10071565
550 Ga0207677_10288587
551 Ga0207639_10154803
552 Ga0207648_10095256
553 Ga0207676_10689717
554 Ga0209967_1002458
555 Ga0209967_1015492
556 Ga0209588_1020732
557 Ga0209813_10059840
558 Ga0207428_10004340
559 Ga0207428_10005218
560 Ga0207428_10044183
561 Ga0268266_10159430
562 Ga0265330_10093552
563 Ga0265332_10003990
564 Ga0265325_10085725
565 Ga0265340_10004026
566 Ga0265340_10047863
567 Ga0265340_10069985
568 Ga0265339_10001909
569 Ga0265339_10124982
570 Ga0265316_10180803
571 Ga0265316_10378672
572 Ga0307513_10035639
573 Ga0307408_100224428
574 Ga0265313_10072078
575 Ga0316579_10013494
576 Ga0265314_10037086
577 Ga0265342_10007249
578 Ga0307410_10406853
579 Ga0307416_100014634
580 Ga0307411_10145471
581 Ga0373930_0004748
582 Ga0373959_0022524
583 Ga0373940_0011312
584 Ga0373940_0028840
585 Ga0373923_0064400
586 Ga0373936_0001176
587 Ga0373936_0032741
588 Ga0373939_0027719
589 Ga0373954_0071417
590 Ga0373960_0009612
591 Ga0373943_0049516
592 Ga0373946_0024048
593 Ga0373961_0003018
594 Ga0373961_0057366
595 Ga0373962_0000899
596 Ga0373931_0000357
597 Ga0373931_0008809
598 Ga0373931_0027874
599 Ga0373935_0001908
600 Ga0373935_0145958
601 Ga0373927_0017410
602 Ga0373927_0386667
603 Ga0373933_0002487
604 Ga0373933_0097771
605 Ga0373947_0002855
606 Ga0373947_0072176
607 Ga0373937_0000098
608 Ga0373937_0027157
609 Ga0373937_0449799
610 Ga0373925_0000075
611 Ga0436364_0266645
612 Ga0436364_1260934
613 Ga0436364_1306448
614 Ga0436365_0480378
615 Ga0436365_1780498
616 Ga0439453_0000873
617 Ga0451853_3286882
618 Ga0439446_0038782
619 Ga0466963_0164696
620 Ga0466967_0068553
621 Ga0495592_0000060
622 Ga0495629_0017051
623 Ga0495638_0007272
624 Ga0495651_0000181
625 Ga0495653_0000740
626 Ga0495605_0089714
627 Ga0495662_0004671
628 Ga0495664_0000003
629 Ga0495584_0007218
630 Ga0495608_0000011
631 Ga0495618_0000044
632 Ga0495628_0000001
633 Ga0495628_0039819
634 Ga0495630_0002317
635 Ga0495631_0057306
636 Ga0495652_0000002
637 Ga0495652_0220665
638 Ga0495640_0000002
639 Ga0495587_0000001
640 Ga0495645_0000002
641 Ga0495667_0000039
642 Ga0495634_0000010
643 Ga0495635_0000001
644 Ga0495635_0039757
645 Ga0495657_0000042
646 Ga0495599_0000013
647 Ga0495623_0000024
648 Ga0495646_0000009
649 Ga0495658_0045197
650 Ga0495624_0044630
651 Ga0495600_0000209
652 Ga0495600_0274278
653 Ga0495581_0046497
654 Ga0495604_0000069
655 Ga0495604_0172445
656 Ga0495674_0000002
657 Ga0495672_0057463
658 Ga0495672_0125275
659 Ga0495680_0000328
660 Ga0495680_0180267
661 Ga0495675_0000245
662 Ga0495684_0000016
663 Ga0495684_0261919
664 Ga0495593_0000555
665 Ga0495602_0000024
666 Ga0495602_0079218
667 Ga0495615_0043429
668 Ga0496101_0003618
669 Ga0496102_0001206
670 Ga0496102_0482253
671 Ga0496104_0001937
672 Ga0496104_0003403
673 Ga0496104_0015391
674 Ga0496105_0007102
675 Ga0496105_0078472
676 Ga0496105_0098706
677 Ga0496105_0230853
678 Ga0496106_0005172
679 Ga0496107_0000601
680 Ga0496108_0003482
681 Ga0496108_0007425
682 Ga0496108_0214621
683 Ga0496109_0003972
684 Ga0496109_0052660
685 Ga0496110_0001677
686 Ga0496110_0143589
687 Ga0496110_0247386
688 Ga0496111_0000535
689 Ga0496111_0059084
690 Ga0496112_0016516
691 Ga0496112_0032487
692 Ga0496113_0004152
693 Ga0496113_0099506
694 Ga0496114_0088495
695 Ga0496114_0246836
696 Ga0496115_0129169
697 Ga0496115_0247997
698 Ga0496121_0000225
699 Ga0501032_0056592
700 Ga0501032_0173952
701 Ga0501034_0025281
702 Ga0501034_0048101
703 Ga0501034_0135086
704 Ga0501034_0141766
705 Ga0501034_0252506
706 Ga0501036_0026273
707 Ga0501036_0058089
708 Ga0501036_0095536
709 Ga0501036_0121245
710 Ga0501036_0157022
711 Ga0501036_0554669
712 Ga0501037_0034931
713 Ga0501037_0035778
714 Ga0501037_0397449
715 Ga0501038_0033874
716 Ga0501039_0106202
717 Ga0501040_0094181
718 Ga0501040_0228289
719 Ga0501041_0272850
720 Ga0501042_0273624
721 Ga0501043_0047680
722 Ga0501043_0229976
723 Ga0501046_0014619
724 Ga0501047_0218040
725 Ga0501047_0233383
726 Ga0501047_0358786
727 Ga0501048_0065868
728 Ga0501068_0032180
729 Ga0501068_0055034
730 Ga0501068_0291549
731 Ga0501070_0046008
732 Ga0501072_0014777
733 Ga0501072_0111890
734 Ga0501073_0049271
735 Ga0501073_0129221
736 Ga0501073_0199746
737 Ga0501073_0229528
738 Ga0501074_0052200
739 Ga0501074_0148012
740 Ga0501075_0057695
741 Ga0501075_0057873
742 Ga0501076_0013656
743 Ga0501076_0052082
744 Ga0501076_0078296
745 Ga0501076_0283493
746 Ga0501077_0005408
747 Ga0501077_0077941
748 Ga0501079_0009679
749 Ga0501080_0027061
750 Ga0501080_0033462
751 Ga0501081_0012691
752 Ga0501081_0213836
753 Ga0501081_0225345
754 Ga0501083_0112482
755 Ga0501035_0079886
756 Ga0501044_0067303
757 Ga0501044_0081667
758 Ga0501044_0192418
759 Ga0501044_0403286
760 Ga0501045_0271970
761 Ga0501045_0291890
762 Ga0501045_0292629
763 nmdc:mga03683_15662_c1
764 nmdc:mga03683_3107_c1
765 nmdc:mga03n38_12584_c1
766 nmdc:mga03n38_40912_c1
767 nmdc:mga00v17_146439_c1
768 nmdc:mga00v17_189614_c1
769 nmdc:mga00v17_25314_c1
770 nmdc:mga0yw44_142628_c1
771 nmdc:mga0yw44_40027_c1
772 nmdc:mga0k408_5072_c1
773 nmdc:mga06z11_174360_c1
774 nmdc:mga06z11_34168_c1
775 nmdc:mga06z11_39702_c1
776 nmdc:mga06z11_47337_c1
777 nmdc:mga06z11_68706_c1
778 nmdc:mga06z11_74459_c1
779 nmdc:mga04h51_23134_c1
780 nmdc:mga04h51_42036_c1
781 nmdc:mga05p37_203_c1
782 nmdc:mga05p37_76_c1
783 nmdc:mga09592_218764_c1
784 nmdc:mga09592_2614_c1
785 nmdc:mga09592_29272_c1
786 nmdc:mga09592_72985_c1
787 nmdc:mga0qj67_3805_c1
788 nmdc:mga0qj67_381171_c1
789 nmdc:mga0qj67_98026_c1
790 nmdc:mga06r32_134_c1
791 nmdc:mga06r32_1490_c1
792 nmdc:mga06r32_426044_c1
793 nmdc:mga06r32_8156_c1
794 nmdc:mga08y16_152042_c1
795 nmdc:mga08y16_33512_c1
796 nmdc:mga08y16_961_c1
797 nmdc:mga0n895_109601_c1
798 nmdc:mga0n895_9151_c1
799 nmdc:mga0rr50_359833_c1
800 nmdc:mga08x19_41107_c1
801 nmdc:mga0a205_580_c2
802 nmdc:mga0sz30_35740_c1
803 Ga0495601_0000001
804 Ga0495601_0184097
805 Ga0495612_0000017
806 Ga0495595_0000010
807 Ga0495619_0000004
808 Ga0500641_0004194
809 Ga0500562_025676
810 Ga0500593_110529
811 Ga0500595_003170
812 Ga0500595_037471
813 Ga0500588_0026153
814 Ga0500616_0004397
815 Ga0500616_0083260
816 Ga0500636_0007380
817 Ga0501084_0026027
818 Ga0501084_0070622
819 Ga0501084_0077923
820 Ga0501084_0175710
821 Ga0501084_0383858
822 Ga0501082_0000510
823 Ga0501082_0009645
824 Ga0501082_0137714
825 Ga0530510_0188081
826 Ga0530510_0392331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

27

183

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

27

117

0.93

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

186

307

0.93

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

6

138

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zov-assembly2.cif.gz_B crystal structure of monomeric sarcosine oxidase from bacillus sp. ns-129 0.9599 13 41
4h2n-assembly1.cif.gz_A crystal structure of mhpco, y270f mutant 0.9564 10 41
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9521 13 302
1kdg-assembly1.cif.gz_B crystal structure of the flavin domain of cellobiose dehydrogenase 0.9456 14 41
3all-assembly1.cif.gz_A crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant y270a 0.9402 10 41
ID Description Score Start End Superfamily
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9624 11 170 3.40.50.720
af_F4IAP5_485_617_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9572 172 302 1.10.1040.10
af_A0A1D6LWN3_490_603_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9553 176 281 1.10.1040.10
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9544 14 165 3.40.50.720
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9509 14 170 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L7NB45-F1-model_v4 NAD(P)-dependent oxidoreductase 0.976 11 303 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A158GYG0-F1-model_v4 6-phosphogluconate dehydrogenase, NAD-binding 0.9729 11 300 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A327K2K4-F1-model_v4 deleted 0.9713 54 303
AF-A0A6J7IMJ6-F1-model_v4 Unannotated protein 0.9702 12 298 GO:0016491
GO:0050661
GO:0051287
AF-A0A6L7NB45-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9694 11 303 GO:0016054
GO:0016616
GO:0050661
GO:0051287

Map