F438065

General Info

Members Datasets Scaffolds Average Seq Length
413 213 413 315

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10012281|Ga0157372_100122813
Length 365
Sequence MLTSFDEATTLFVLAVPSRWHQRDSTKVPVSRDNLILSPRYNHFSSNLGVFMPLQKTDKIWHKGKLIRWEDANIHVMSHVIHYGSSVFEGVRCYAPPSGPAIFRAQEHIQRLLDSAKVYRMDVGFGLEELVAAMGDLVRTNGVWPCYIRPIVFRGYGDAGVTPVNCPVEVYIANYPWGKYLTQDDSGVDVCVSSWTRIAPNTLPALAKAGANYMNSQLIRMEATTNGYVEGIALDANGYVSEGSGENVFVVRNGVLQTAPLGNSVLPGITRDSILRIARDLGIPVSEAGIPREMLYIADEAFFTGTAAEVTPIRSVDRITVGKGNVGPITRALQREFFGIVNGTQPDRFNWLTPVQVGSKQPVGV

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
200 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 1.94
Rhizosphere 93.46
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11941869 3300004799 Bacteria 1014
2 Ga0058862_11799770 3300004803 Bacteria 1794
3 Ga0058862_11980530 3300004803 Bacteria 1026
4 Ga0065712_10116759 3300005290 Bacteria 1731
5 Ga0070658_10062424 3300005327 Bacteria 3037
6 Ga0070676_10048618 3300005328 Unclassified 2480
7 Ga0070683_100018945 3300005329 Bacteria 6107
8 Ga0070683_100037693 3300005329 Bacteria 4426
9 Ga0070683_100068665 3300005329 Unclassified 3302
10 Ga0070683_100380695 3300005329 Bacteria 1345
11 Ga0070690_100096370 3300005330 Bacteria 1955
12 Ga0070690_100342301 3300005330 Bacteria 1083
13 Ga0070670_100002314 3300005331 Bacteria 15707
14 Ga0068869_100013869 3300005334 Bacteria 5373
15 Ga0070680_100260199 3300005336 Bacteria 1468
16 Ga0068868_100011637 3300005338 Bacteria 6409
17 Ga0068868_100036398 3300005338 Bacteria 3810
18 Ga0068868_100180105 3300005338 Bacteria 1753
19 Ga0070687_100010636 3300005343 Bacteria 3990
20 Ga0070687_100028746 3300005343 Bacteria 2699
21 Ga0070661_100003673 3300005344 Bacteria 10572
22 Ga0070661_100169260 3300005344 Bacteria 1658
23 Ga0070675_100096374 3300005354 Bacteria 2485
24 Ga0070671_100032028 3300005355 Bacteria 4347
25 Ga0070671_100170183 3300005355 Bacteria 1842
26 Ga0070674_100038717 3300005356 Bacteria 3215
27 Ga0070659_100002513 3300005366 Bacteria 13022
28 Ga0070667_100048088 3300005367 Bacteria 3590
29 Ga0070709_10256318 3300005434 Bacteria 1262
30 Ga0070709_10263784 3300005434 Bacteria 1245
31 Ga0070714_100024274 3300005435 Bacteria 4988
32 Ga0070714_100133854 3300005435 Bacteria 2217
33 Ga0070714_100173174 3300005435 Bacteria 1960
34 Ga0070714_100206843 3300005435 Bacteria 1797
35 Ga0070714_100266639 3300005435 Bacteria 1587
36 Ga0070713_100016304 3300005436 Bacteria 5585
37 Ga0070713_100040157 3300005436 Bacteria 3803
38 Ga0070713_100052858 3300005436 Bacteria 3365
39 Ga0070713_100093242 3300005436 Bacteria 2594
40 Ga0070713_100175725 3300005436 Bacteria 1922
41 Ga0070713_100536321 3300005436 Bacteria 1107
42 Ga0070705_100008776 3300005440 Bacteria 5005
43 Ga0070708_100000429 3300005445 Bacteria 31270
44 Ga0070708_100001110 3300005445 Bacteria 20552
45 Ga0070708_100202869 3300005445 Bacteria 1857
46 Ga0070708_100584587 3300005445 Bacteria 1053
47 Ga0070663_100021747 3300005455 Bacteria 4272
48 Ga0070663_100035006 3300005455 Unclassified 3481
49 Ga0070678_100030645 3300005456 Bacteria 3700
50 Ga0070681_10011682 3300005458 Bacteria 8698
51 Ga0070681_10011908 3300005458 Bacteria 8626
52 Ga0070681_10167199 3300005458 Bacteria 2122
53 Ga0068867_100006087 3300005459 Bacteria 8545
54 Ga0068867_100009402 3300005459 Bacteria 6897
55 Ga0070685_10014376 3300005466 Bacteria 4192
56 Ga0070706_100001381 3300005467 Bacteria 25765
57 Ga0070706_100383902 3300005467 Bacteria 1308
58 Ga0070706_100410845 3300005467 Bacteria 1260
59 Ga0070707_100009155 3300005468 Bacteria 9186
60 Ga0070707_100142803 3300005468 Unclassified 2330
61 Ga0070707_100383405 3300005468 Bacteria 1365
62 Ga0070698_100000336 3300005471 Bacteria 48369
63 Ga0070699_100024966 3300005518 Bacteria 5152
64 Ga0070699_100074757 3300005518 Bacteria 2949
65 Ga0070679_100001599 3300005530 Bacteria 20322
66 Ga0070684_100100731 3300005535 Bacteria 2580
67 Ga0070684_100194844 3300005535 Bacteria 1845
68 Ga0070697_100002439 3300005536 Bacteria 14310
69 Ga0070697_100039296 3300005536 Bacteria 3825
70 Ga0070697_100148868 3300005536 Bacteria 1972
71 Ga0068853_100004453 3300005539 Bacteria 10854
72 Ga0070696_100035772 3300005546 Bacteria 3421
73 Ga0070693_100006131 3300005547 Bacteria 5826
74 Ga0070665_100007040 3300005548 Bacteria 11429
75 Ga0070665_100140435 3300005548 Bacteria 2419
76 Ga0068855_100000543 3300005563 Bacteria 46206
77 Ga0068855_100000926 3300005563 Bacteria 36477
78 Ga0068855_100009432 3300005563 Bacteria 11790
79 Ga0068855_100110839 3300005563 Bacteria 3150
80 Ga0068855_100223963 3300005563 Bacteria 2108
81 Ga0068855_100318137 3300005563 Bacteria 1721
82 Ga0070664_100000220 3300005564 Bacteria 40882
83 Ga0070664_100134015 3300005564 Bacteria 2177
84 Ga0068857_100000298 3300005577 Bacteria 34219
85 Ga0068857_100001937 3300005577 Bacteria 16693
86 Ga0068854_100000003 3300005578 Bacteria 330045
87 Ga0068854_100005411 3300005578 Bacteria 8059
88 Ga0068856_100000843 3300005614 Bacteria 33055
89 Ga0068856_100002725 3300005614 Bacteria 18085
90 Ga0068856_100025161 3300005614 Bacteria 5800
91 Ga0068856_100369196 3300005614 Bacteria 1454
92 Ga0068852_100463894 3300005616 Bacteria 1256
93 Ga0068859_100000251 3300005617 Bacteria 53119
94 Ga0068859_100048102 3300005617 Bacteria 4285
95 Ga0068864_100001872 3300005618 Bacteria 17279
96 Ga0068864_100011965 3300005618 Bacteria 7163
97 Ga0068866_10025103 3300005718 Bacteria 2798
98 Ga0068866_10041154 3300005718 Bacteria 2291
99 Ga0068861_100004170 3300005719 Bacteria 9688
100 Ga0068870_10021942 3300005840 Unclassified 3132
101 Ga0068863_100195591 3300005841 Bacteria 1944
102 Ga0068863_100353202 3300005841 Bacteria 1432
103 Ga0068858_100002965 3300005842 Bacteria 17043
104 Ga0068858_100043295 3300005842 Bacteria 4175
105 Ga0068858_100050897 3300005842 Bacteria 3833
106 Ga0068858_100061878 3300005842 Unclassified 3461
107 Ga0068858_100084245 3300005842 Bacteria 2957
108 Ga0068860_100014096 3300005843 Bacteria 7843
109 Ga0068860_100015856 3300005843 Bacteria 7356
110 Ga0068860_100070906 3300005843 Bacteria 3312
111 Ga0070717_10025753 3300006028 Bacteria 4684
112 Ga0075364_10043738 3300006051 Bacteria 2912
113 Ga0070712_100003187 3300006175 Bacteria 10105
114 Ga0070712_100010954 3300006175 Bacteria 5737
115 Ga0070712_100088172 3300006175 Bacteria 2266
116 Ga0075362_10015384 3300006177 Bacteria 3111
117 Ga0075367_10005022 3300006178 Bacteria 6524
118 Ga0075367_10104702 3300006178 Bacteria 1732
119 Ga0075366_10000800 3300006195 Bacteria 15038
120 Ga0097621_100000752 3300006237 Bacteria 22728
121 Ga0097621_100001357 3300006237 Bacteria 16855
122 Ga0097621_100060780 3300006237 Unclassified 3098
123 Ga0097621_100198671 3300006237 Bacteria 1740
124 Ga0068871_100000717 3300006358 Bacteria 22459
125 Ga0068871_100010619 3300006358 Bacteria 6730
126 Ga0068871_100030104 3300006358 Bacteria 4272
127 Ga0068871_100098320 3300006358 Bacteria 2448
128 Ga0068871_100133628 3300006358 Bacteria 2105
129 Ga0075428_100146598 3300006844 Bacteria 2565
130 Ga0075433_10000300 3300006852 Bacteria 29722
131 Ga0075434_100003131 3300006871 Bacteria 14741
132 Ga0075434_100093824 3300006871 Bacteria 3005
133 Ga0075429_100088232 3300006880 Bacteria 2703
134 Ga0075429_100370634 3300006880 Bacteria 1253
135 Ga0068865_100029519 3300006881 Bacteria 3640
136 Ga0068865_100057648 3300006881 Bacteria 2710
137 Ga0068865_100101695 3300006881 Bacteria 2105
138 Ga0075436_100001424 3300006914 Bacteria 16254
139 Ga0075436_100003071 3300006914 Bacteria 11438
140 Ga0075436_100071842 3300006914 Bacteria 2393
141 Ga0075436_100103863 3300006914 Bacteria 1980
142 Ga0075436_100128195 3300006914 Bacteria 1778
143 Ga0097620_100000251 3300006931 Bacteria 53119
144 Ga0097620_100048100 3300006931 Bacteria 4285
145 Ga0075435_100000514 3300007076 Bacteria 23639
146 Ga0075435_100028744 3300007076 Bacteria 4362
147 Ga0075435_100063379 3300007076 Bacteria 3002
148 Ga0105240_10006848 3300009093 Bacteria 16662
149 Ga0105240_10012442 3300009093 Bacteria 11746
150 Ga0105240_10064086 3300009093 Bacteria 4568
151 Ga0105240_10138921 3300009093 Bacteria 2907
152 Ga0105240_10286136 3300009093 Bacteria 1892
153 Ga0111539_10007895 3300009094 Bacteria 13580
154 Ga0114129_10232080 3300009147 Bacteria 2485
155 Ga0105243_10030584 3300009148 Bacteria 4147
156 Ga0105241_10001985 3300009174 Bacteria 15492
157 Ga0105241_10024785 3300009174 Bacteria 4456
158 Ga0105242_10207503 3300009176 Bacteria 1744
159 Ga0105248_10017301 3300009177 Bacteria 7944
160 Ga0105248_10021338 3300009177 Bacteria 7177
161 Ga0105248_10074300 3300009177 Bacteria 3821
162 Ga0105248_10112530 3300009177 Unclassified 3070
163 Ga0105237_10079757 3300009545 Bacteria 3264
164 Ga0105237_10380738 3300009545 Bacteria 1416
165 Ga0105238_10000353 3300009551 Bacteria 49335
166 Ga0105238_10043822 3300009551 Bacteria 4526
167 Ga0105238_10328157 3300009551 Bacteria 1517
168 Ga0105249_10296715 3300009553 Bacteria 1619
169 Ga0105239_10161772 3300010375 Bacteria 2501
170 Ga0105239_10316415 3300010375 Bacteria 1759
171 Ga0105239_10373358 3300010375 Bacteria 1612
172 Ga0105239_10836642 3300010375 Bacteria 1055
173 Ga0157373_10001041 3300013100 Bacteria 21375
174 Ga0157373_10136561 3300013100 Bacteria 1724
175 Ga0157371_10097157 3300013102 Bacteria 2088
176 Ga0157370_10029523 3300013104 Bacteria 5378
177 Ga0157370_10032279 3300013104 Bacteria 5114
178 Ga0157370_10158158 3300013104 Bacteria 2108
179 Ga0157369_10000122 3300013105 Bacteria 110862
180 Ga0157369_10079974 3300013105 Bacteria 3500
181 Ga0157369_10109824 3300013105 Bacteria 2932
182 Ga0157369_10143702 3300013105 Bacteria 2523
183 Ga0157369_10199948 3300013105 Bacteria 2098
184 Ga0157369_10303290 3300013105 Bacteria 1661
185 Ga0157374_10000552 3300013296 Bacteria 33425
186 Ga0157374_10000645 3300013296 Bacteria 30745
187 Ga0157374_10000792 3300013296 Bacteria 27696
188 Ga0157374_10004583 3300013296 Bacteria 11594
189 Ga0157374_10015533 3300013296 Bacteria 6680
190 Ga0157374_10030307 3300013296 Bacteria 4910
191 Ga0157374_10049922 3300013296 Bacteria 3887
192 Ga0157378_10000029 3300013297 Bacteria 125377
193 Ga0157378_10000224 3300013297 Bacteria 55272
194 Ga0157378_10003392 3300013297 Bacteria 14166
195 Ga0157378_10078601 3300013297 Bacteria 2976
196 Ga0157378_10095400 3300013297 Bacteria 2709
197 Ga0163162_10002350 3300013306 Bacteria 17778
198 Ga0157372_10000068 3300013307 Bacteria 111270
199 Ga0157372_10000477 3300013307 Bacteria 44209
200 Ga0157372_10000638 3300013307 Bacteria 38448
201 Ga0157372_10005772 3300013307 Bacteria 13190
202 Ga0157372_10010924 3300013307 Bacteria 9663
203 Ga0157372_10012281 3300013307 Bacteria 9124
204 Ga0157372_10068484 3300013307 Bacteria 3990
205 Ga0157372_10096839 3300013307 Bacteria 3364
206 Ga0157372_10153416 3300013307 Bacteria 2659
207 Ga0157372_10156656 3300013307 Bacteria 2631
208 Ga0157372_10798859 3300013307 Bacteria 1096
209 Ga0163163_10082525 3300014325 Bacteria 3218
210 Ga0157380_10137084 3300014326 Bacteria 2096
211 Ga0157377_10026836 3300014745 Unclassified 3086
212 Ga0157379_10096560 3300014968 Bacteria 2652
213 Ga0157376_10000845 3300014969 Bacteria 20086
214 Ga0157376_10149314 3300014969 Bacteria 2106
215 Ga0157376_10207118 3300014969 Bacteria 1808
216 Ga0157376_10301100 3300014969 Bacteria 1518
217 Ga0213876_10032266 3300021384 Unclassified 2763
218 Ga0213875_10015699 3300021388 Bacteria 3683
219 Ga0224572_1005303 3300024225 Bacteria 2293
220 Ga0228598_1003937 3300024227 Bacteria 3169
221 Ga0207692_10088990 3300025898 Bacteria 1670
222 Ga0207642_10020767 3300025899 Unclassified 2571
223 Ga0207647_10016006 3300025904 Bacteria 5126
224 Ga0207647_10029710 3300025904 Bacteria 3532
225 Ga0207647_10040971 3300025904 Bacteria 2914
226 Ga0207699_10259274 3300025906 Bacteria 1201
227 Ga0207643_10075709 3300025908 Bacteria 1943
228 Ga0207705_10019064 3300025909 Bacteria 4908
229 Ga0207684_10005498 3300025910 Bacteria 11670
230 Ga0207684_10114021 3300025910 Bacteria 2314
231 Ga0207654_10022816 3300025911 Bacteria 3344
232 Ga0207654_10079175 3300025911 Bacteria 1973
233 Ga0207654_10243905 3300025911 Bacteria 1202
234 Ga0207707_10000409 3300025912 Bacteria 44985
235 Ga0207695_10001894 3300025913 Bacteria 32659
236 Ga0207695_10083899 3300025913 Bacteria 3218
237 Ga0207695_10145346 3300025913 Bacteria 2316
238 Ga0207695_10231746 3300025913 Bacteria 1751
239 Ga0207693_10008736 3300025915 Bacteria 8282
240 Ga0207693_10011277 3300025915 Bacteria 7236
241 Ga0207693_10013610 3300025915 Bacteria 6556
242 Ga0207693_10109669 3300025915 Bacteria 2164
243 Ga0207663_10047778 3300025916 Bacteria 2644
244 Ga0207660_10278745 3300025917 Bacteria 1326
245 Ga0207662_10023188 3300025918 Bacteria 3564
246 Ga0207649_10006270 3300025920 Bacteria 6462
247 Ga0207652_10009656 3300025921 Bacteria 7762
248 Ga0207694_10000778 3300025924 Bacteria 28635
249 Ga0207694_10068705 3300025924 Bacteria 2767
250 Ga0207694_10100583 3300025924 Bacteria 2290
251 Ga0207650_10014356 3300025925 Bacteria 5506
252 Ga0207659_10059185 3300025926 Bacteria 2753
253 Ga0207687_10052089 3300025927 Bacteria 2855
254 Ga0207700_10011309 3300025928 Bacteria 5685
255 Ga0207700_10059071 3300025928 Bacteria 2899
256 Ga0207664_10057327 3300025929 Bacteria 3096
257 Ga0207664_10260476 3300025929 Unclassified 1516
258 Ga0207664_10344723 3300025929 Bacteria 1318
259 Ga0207644_10035534 3300025931 Bacteria 3492
260 Ga0207690_10002497 3300025932 Bacteria 11125
261 Ga0207670_10030829 3300025936 Bacteria 3428
262 Ga0207704_10009139 3300025938 Bacteria 4768
263 Ga0207704_10019065 3300025938 Bacteria 3596
264 Ga0207665_10062803 3300025939 Bacteria 2521
265 Ga0207665_10092343 3300025939 Bacteria 2100
266 Ga0207665_10117954 3300025939 Bacteria 1872
267 Ga0207691_10178611 3300025940 Bacteria 1856
268 Ga0207711_10009802 3300025941 Bacteria 7967
269 Ga0207711_10275119 3300025941 Unclassified 1550
270 Ga0207689_10000769 3300025942 Bacteria 30802
271 Ga0207689_10012776 3300025942 Bacteria 7174
272 Ga0207661_10035818 3300025944 Bacteria 3870
273 Ga0207661_10079232 3300025944 Bacteria 2707
274 Ga0207661_10281918 3300025944 Bacteria 1485
275 Ga0207679_10001445 3300025945 Bacteria 14935
276 Ga0207679_10038677 3300025945 Bacteria 3401
277 Ga0207667_10000182 3300025949 Bacteria 91423
278 Ga0207667_10005043 3300025949 Bacteria 16131
279 Ga0207667_10009015 3300025949 Bacteria 11800
280 Ga0207667_10184503 3300025949 Bacteria 2142
281 Ga0207667_10588025 3300025949 Bacteria 1123
282 Ga0207640_10000002 3300025981 Bacteria 524211
283 Ga0207640_10005089 3300025981 Bacteria 7151
284 Ga0207640_10156004 3300025981 Bacteria 1683
285 Ga0207640_10275141 3300025981 Archaea 1319
286 Ga0207677_10006528 3300026023 Bacteria 6404
287 Ga0207677_10031292 3300026023 Bacteria 3407
288 Ga0207703_10016245 3300026035 Bacteria 5802
289 Ga0207703_10073444 3300026035 Bacteria 2830
290 Ga0207703_10118912 3300026035 Bacteria 2266
291 Ga0207639_10000011 3300026041 Bacteria 381897
292 Ga0207639_10428447 3300026041 Bacteria 1197
293 Ga0207678_10021096 3300026067 Bacteria 5710
294 Ga0207678_10047071 3300026067 Unclassified 3730
295 Ga0207708_10034623 3300026075 Bacteria 3842
296 Ga0207708_10121004 3300026075 Unclassified 2039
297 Ga0207702_10000169 3300026078 Bacteria 78281
298 Ga0207702_10000849 3300026078 Bacteria 31962
299 Ga0207702_10008228 3300026078 Bacteria 8817
300 Ga0207702_10101445 3300026078 Bacteria 2541
301 Ga0207702_10178610 3300026078 Bacteria 1953
302 Ga0207702_10436168 3300026078 Bacteria 1269
303 Ga0207648_10006338 3300026089 Bacteria 11765
304 Ga0207648_10020451 3300026089 Bacteria 5959
305 Ga0207676_10129927 3300026095 Bacteria 2140
306 Ga0207674_10001157 3300026116 Bacteria 34191
307 Ga0207674_10006585 3300026116 Bacteria 13653
308 Ga0207683_10061427 3300026121 Bacteria 3307
309 Ga0207698_10105681 3300026142 Bacteria 2346
310 Ga0207428_10000083 3300027907 Bacteria 132922
311 Ga0268265_10227044 3300028380 Bacteria 1638
312 Ga0268264_10067467 3300028381 Bacteria 3020
313 Ga0268264_10097488 3300028381 Bacteria 2548
314 Ga0265338_10027569 3300028800 Bacteria 5695
315 Ga0265332_10035019 3300031238 Bacteria 2181
316 Ga0265328_10022686 3300031239 Bacteria 2386
317 Ga0265340_10026601 3300031247 Bacteria 2923
318 Ga0265339_10005718 3300031249 Bacteria 8252
319 Ga0265316_10003023 3300031344 Bacteria 17186
320 Ga0307409_100055832 3300031995 Bacteria 3052
321 Ga0307411_10018368 3300032005 Bacteria 4009
322 Ga0373923_0047736 3300035111 Bacteria 1786
323 Ga0373957_0120008 3300035120 Bacteria 1064
324 Ga0373943_0108015 3300035170 Bacteria 1464
325 Ga0373931_0003650 3300035691 Bacteria 6955
326 Ga0373935_0004737 3300035692 Bacteria 8002
327 Ga0373935_0076227 3300035692 Bacteria 2171
328 Ga0373935_0236037 3300035692 Bacteria 1275
329 Ga0373947_0008533 3300035725 Bacteria 5902
330 Ga0373937_0005502 3300036401 Bacteria 10854
331 Ga0373937_0043657 3300036401 Unclassified 4093
332 Ga0373925_0004062 3300037068 Bacteria 11119
333 Ga0373925_0010516 3300037068 Bacteria 6713
334 Ga0395900_0105722 3300037418 Unclassified 2892
335 Ga0436364_0101632 3300037853 Bacteria 5553
336 Ga0436364_0195917 3300037853 Bacteria 1608
337 Ga0436364_0310721 3300037853 Bacteria 8854
338 Ga0436364_0442574 3300037853 Unclassified 1293
339 Ga0436365_0364077 3300039437 Bacteria 5731
340 Ga0436363_1045619 3300039450 Bacteria 7768
341 Ga0436362_0652425 3300039453 Bacteria 1919
342 Ga0436362_0736855 3300039453 Unclassified 1573
343 Ga0451577_0000294 3300042876 Bacteria 97046
344 Ga0451577_0054130 3300042876 Bacteria 3582
345 Ga0453683_0015004 3300044673 Bacteria 5029
346 Ga0453683_0090082 3300044673 Bacteria 1923
347 Ga0466963_0120322 3300044694 Bacteria 1806
348 Ga0453684_0000104 3300044712 Bacteria 365431
349 Ga0466971_0154913 3300044719 Bacteria 1071
350 Ga0451576_0019162 3300045051 Bacteria 7474
351 Ga0451576_0083092 3300045051 Bacteria 3332
352 Ga0451576_0363273 3300045051 Bacteria 1516
353 Ga0451576_0496475 3300045051 Bacteria 1282
354 Ga0466958_0217369 3300045836 Bacteria 1219
355 Ga0466967_0015714 3300045976 Bacteria 5945
356 Ga0466967_0021613 3300045976 Bacteria 5231
357 Ga0495603_0162231 3300046455 Bacteria 1296
358 Ga0495629_0000002 3300046459 Bacteria 686975
359 Ga0495638_0031599 3300046460 Bacteria 3401
360 Ga0495580_0002144 3300046472 Bacteria 17318
361 Ga0495580_0005550 3300046472 Bacteria 10403
362 Ga0495580_0041294 3300046472 Unclassified 3290
363 Ga0495580_0100099 3300046472 Bacteria 2016
364 Ga0495580_0185316 3300046472 Bacteria 1437
365 Ga0495582_0001757 3300046473 Bacteria 12233
366 Ga0495606_0093324 3300046507 Bacteria 1846
367 Ga0495606_0125185 3300046507 Bacteria 1533
368 Ga0495630_0294704 3300046517 Bacteria 1240
369 Ga0495630_0345449 3300046517 Bacteria 1139
370 Ga0495637_0045875 3300046520 Bacteria 1851
371 Ga0495666_0108320 3300046526 Bacteria 1306
372 Ga0495665_0001542 3300046531 Bacteria 12287
373 Ga0495609_0008254 3300046538 Bacteria 5114
374 Ga0495667_0172451 3300046559 Bacteria 1390
375 Ga0495623_0053230 3300046679 Unclassified 2556
376 Ga0495623_0061505 3300046679 Bacteria 2355
377 Ga0495658_0014134 3300046683 Bacteria 4072
378 Ga0495658_0211094 3300046683 Bacteria 1213
379 Ga0495581_0204405 3300047315 Bacteria 1155
380 Ga0495687_038605 3300047443 Bacteria 2118
381 Ga0495675_0053697 3300047444 Unclassified 2558
382 Ga0495677_0063586 3300047445 Bacteria 1371
383 Ga0495686_0083784 3300047472 Bacteria 1944
384 Ga0495602_0072838 3300048088 Unclassified 2927
385 Ga0496101_0404154 3300048904 Bacteria 1076
386 Ga0496102_0392606 3300048905 Bacteria 1305
387 Ga0496112_0018387 3300048915 Bacteria 6579
388 Ga0496112_0019735 3300048915 Bacteria 6371
389 Ga0496112_0100412 3300048915 Bacteria 2863
390 Ga0496112_0105068 3300048915 Bacteria 2794
391 Ga0496112_0131649 3300048915 Bacteria 2472
392 Ga0496113_0291078 3300048916 Bacteria 1307
393 Ga0501249_002779 3300049679 Unclassified 3526
394 Ga0501257_035944 3300049686 Bacteria 1206
395 Ga0501257_052826 3300049686 Unclassified 1016
396 Ga0501225_0028260 3300049705 Bacteria 1542
397 nmdc:mga03683_36630_c1 3300050489 Bacteria 1997
398 nmdc:mga00v17_86205_c1 3300050491 Bacteria 1968
399 nmdc:mga0yw44_70332_c1 3300050492 Bacteria 2170
400 nmdc:mga0k408_17122_c1 3300050493 Bacteria 4033
401 nmdc:mga06z11_12383_c1 3300050494 Bacteria 3709
402 nmdc:mga07m45_28334_c1 3300050496 Bacteria 2449
403 nmdc:mga05p37_485644_c1 3300050507 Bacteria 1421
404 nmdc:mga08y16_979_c1 3300050511 Bacteria 27823
405 nmdc:mga0n895_12999_c1 3300050512 Bacteria 7489
406 nmdc:mga0n895_186364_c1 3300050512 Bacteria 2106
407 nmdc:mga0rr50_17651_c1 3300050513 Bacteria 4770
408 nmdc:mga0rr50_187430_c1 3300050513 Bacteria 1694
409 nmdc:mga0rr50_4340_c1 3300050513 Bacteria 8319
410 nmdc:mga08x19_1222_c1 3300050514 Bacteria 15986
411 nmdc:mga08x19_124514_c1 3300050514 Bacteria 1730
412 nmdc:mga08x19_20178_c1 3300050514 Bacteria 4103
413 nmdc:mga0a205_7502_c1 3300050515 Bacteria 9878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049686 Ga0501257_052826 Ga0501257_052826_21_791 252
2 3300039453 Ga0436362_0736855 Ga0436362_0736855_13_879 285
3 3300006178 Ga0075367_10104702 Ga0075367_101047022 300
4 3300028380 Ga0268265_10227044 Ga0268265_102270442 300
5 3300046460 Ga0495638_0031599 Ga0495638_0031599_1822_2796 300
6 3300014326 Ga0157380_10137084 Ga0157380_101370842 306
7 3300005842 Ga0068858_100061878 Ga0068858_1000618782 309
8 3300009177 Ga0105248_10112530 Ga0105248_101125303 309
9 3300037853 Ga0436364_0442574 Ga0436364_0442574_10_948 309
10 3300025927 Ga0207687_10052089 Ga0207687_100520892 310
11 3300049679 Ga0501249_002779 Ga0501249_002779_667_1611 310
12 3300013307 Ga0157372_10798859 Ga0157372_107988591 311
13 3300037418 Ga0395900_0105722 Ga0395900_0105722_794_1738 311
14 3300005344 Ga0070661_100169260 Ga0070661_1001692601 312
15 3300013296 Ga0157374_10015533 Ga0157374_100155336 312
16 3300014969 Ga0157376_10301100 Ga0157376_103011002 312
17 3300025940 Ga0207691_10178611 Ga0207691_101786112 312
18 3300046459 Ga0495629_0000002 Ga0495629_0000002_87539_88492 312
19 3300046683 Ga0495658_0014134 Ga0495658_0014134_1482_2435 312
20 3300005327 Ga0070658_10062424 Ga0070658_100624242 313
21 3300005329 Ga0070683_100068665 Ga0070683_1000686652 313
22 3300005355 Ga0070671_100032028 Ga0070671_1000320284 313
23 3300005366 Ga0070659_100002513 Ga0070659_1000025137 313
24 3300005367 Ga0070667_100048088 Ga0070667_1000480882 313
25 3300005435 Ga0070714_100266639 Ga0070714_1002666391 313
26 3300005455 Ga0070663_100021747 Ga0070663_1000217474 313
27 3300005455 Ga0070663_100035006 Ga0070663_1000350063 313
28 3300005458 Ga0070681_10167199 Ga0070681_101671992 313
29 3300005539 Ga0068853_100004453 Ga0068853_1000044533 313
30 3300005548 Ga0070665_100007040 Ga0070665_1000070405 313
31 3300005563 Ga0068855_100318137 Ga0068855_1003181372 313
32 3300005578 Ga0068854_100000003 Ga0068854_100000003258 313
33 3300005618 Ga0068864_100011965 Ga0068864_1000119655 313
34 3300009093 Ga0105240_10006848 Ga0105240_100068486 313
35 3300009093 Ga0105240_10138921 Ga0105240_101389212 313
36 3300009177 Ga0105248_10021338 Ga0105248_100213383 313
37 3300013104 Ga0157370_10029523 Ga0157370_100295231 313
38 3300013296 Ga0157374_10004583 Ga0157374_100045834 313
39 3300013296 Ga0157374_10049922 Ga0157374_100499222 313
40 3300014325 Ga0163163_10082525 Ga0163163_100825253 313
41 3300021384 Ga0213876_10032266 Ga0213876_100322662 313
42 3300021388 Ga0213875_10015699 Ga0213875_100156993 313
43 3300025904 Ga0207647_10029710 Ga0207647_100297103 313
44 3300025909 Ga0207705_10019064 Ga0207705_100190642 313
45 3300025913 Ga0207695_10145346 Ga0207695_101453462 313
46 3300025913 Ga0207695_10231746 Ga0207695_102317462 313
47 3300025931 Ga0207644_10035534 Ga0207644_100355343 313
48 3300025932 Ga0207690_10002497 Ga0207690_100024975 313
49 3300025941 Ga0207711_10275119 Ga0207711_102751192 313
50 3300025981 Ga0207640_10000002 Ga0207640_10000002415 313
51 3300026041 Ga0207639_10000011 Ga0207639_10000011290 313
52 3300026067 Ga0207678_10021096 Ga0207678_100210966 313
53 3300026067 Ga0207678_10047071 Ga0207678_100470713 313
54 3300035120 Ga0373957_0120008 Ga0373957_0120008_24_965 313
55 3300037853 Ga0436364_0101632 Ga0436364_0101632_3880_4830 313
56 3300037853 Ga0436364_0310721 Ga0436364_0310721_4777_5739 313
57 3300039437 Ga0436365_0364077 Ga0436365_0364077_1761_2723 313
58 3300039453 Ga0436362_0652425 Ga0436362_0652425_216_1178 313
59 3300042876 Ga0451577_0054130 Ga0451577_0054130_657_1610 313
60 3300044673 Ga0453683_0090082 Ga0453683_0090082_290_1234 313
61 3300045051 Ga0451576_0083092 Ga0451576_0083092_2363_3307 313
62 3300045051 Ga0451576_0363273 Ga0451576_0363273_523_1467 313
63 3300045051 Ga0451576_0496475 Ga0451576_0496475_254_1207 313
64 3300046507 Ga0495606_0093324 Ga0495606_0093324_351_1292 313
65 3300046507 Ga0495606_0125185 Ga0495606_0125185_415_1356 313
66 3300046517 Ga0495630_0294704 Ga0495630_0294704_277_1218 313
67 3300046520 Ga0495637_0045875 Ga0495637_0045875_137_1078 313
68 3300046538 Ga0495609_0008254 Ga0495609_0008254_774_1856 313
69 3300047443 Ga0495687_038605 Ga0495687_038605_1100_2041 313
70 3300047472 Ga0495686_0083784 Ga0495686_0083784_651_1592 313
71 3300004799 Ga0058863_11941869 Ga0058863_119418691 314
72 3300004803 Ga0058862_11799770 Ga0058862_117997702 314
73 3300004803 Ga0058862_11980530 Ga0058862_119805301 314
74 3300005290 Ga0065712_10116759 Ga0065712_101167591 314
75 3300005328 Ga0070676_10048618 Ga0070676_100486183 314
76 3300005329 Ga0070683_100018945 Ga0070683_1000189452 314
77 3300005329 Ga0070683_100037693 Ga0070683_1000376932 314
78 3300005329 Ga0070683_100380695 Ga0070683_1003806951 314
79 3300005330 Ga0070690_100096370 Ga0070690_1000963702 314
80 3300005330 Ga0070690_100342301 Ga0070690_1003423011 314
81 3300005331 Ga0070670_100002314 Ga0070670_1000023146 314
82 3300005334 Ga0068869_100013869 Ga0068869_1000138693 314
83 3300005336 Ga0070680_100260199 Ga0070680_1002601992 314
84 3300005338 Ga0068868_100011637 Ga0068868_1000116372 314
85 3300005338 Ga0068868_100036398 Ga0068868_1000363982 314
86 3300005338 Ga0068868_100180105 Ga0068868_1001801052 314
87 3300005343 Ga0070687_100010636 Ga0070687_1000106363 314
88 3300005343 Ga0070687_100028746 Ga0070687_1000287462 314
89 3300005344 Ga0070661_100003673 Ga0070661_1000036734 314
90 3300005354 Ga0070675_100096374 Ga0070675_1000963742 314
91 3300005355 Ga0070671_100170183 Ga0070671_1001701832 314
92 3300005356 Ga0070674_100038717 Ga0070674_1000387172 314
93 3300005434 Ga0070709_10256318 Ga0070709_102563181 314
94 3300005434 Ga0070709_10263784 Ga0070709_102637841 314
95 3300005435 Ga0070714_100024274 Ga0070714_1000242742 314
96 3300005435 Ga0070714_100133854 Ga0070714_1001338542 314
97 3300005435 Ga0070714_100173174 Ga0070714_1001731742 314
98 3300005435 Ga0070714_100206843 Ga0070714_1002068432 314
99 3300005436 Ga0070713_100016304 Ga0070713_1000163045 314
100 3300005436 Ga0070713_100040157 Ga0070713_1000401574 314
101 3300005436 Ga0070713_100052858 Ga0070713_1000528584 314
102 3300005436 Ga0070713_100093242 Ga0070713_1000932422 314
103 3300005436 Ga0070713_100175725 Ga0070713_1001757252 314
104 3300005436 Ga0070713_100536321 Ga0070713_1005363211 314
105 3300005440 Ga0070705_100008776 Ga0070705_1000087763 314
106 3300005445 Ga0070708_100000429 Ga0070708_1000004297 314
107 3300005445 Ga0070708_100001110 Ga0070708_1000011103 314
108 3300005445 Ga0070708_100202869 Ga0070708_1002028692 314
109 3300005445 Ga0070708_100584587 Ga0070708_1005845871 314
110 3300005456 Ga0070678_100030645 Ga0070678_1000306451 314
111 3300005458 Ga0070681_10011682 Ga0070681_100116825 314
112 3300005458 Ga0070681_10011908 Ga0070681_100119087 314
113 3300005459 Ga0068867_100006087 Ga0068867_1000060876 314
114 3300005459 Ga0068867_100009402 Ga0068867_1000094025 314
115 3300005466 Ga0070685_10014376 Ga0070685_100143764 314
116 3300005467 Ga0070706_100001381 Ga0070706_1000013817 314
117 3300005467 Ga0070706_100383902 Ga0070706_1003839021 314
118 3300005467 Ga0070706_100410845 Ga0070706_1004108452 314
119 3300005468 Ga0070707_100009155 Ga0070707_1000091554 314
120 3300005468 Ga0070707_100142803 Ga0070707_1001428032 314
121 3300005468 Ga0070707_100383405 Ga0070707_1003834051 314
122 3300005471 Ga0070698_100000336 Ga0070698_10000033615 314
123 3300005518 Ga0070699_100024966 Ga0070699_1000249663 314
124 3300005518 Ga0070699_100074757 Ga0070699_1000747571 314
125 3300005530 Ga0070679_100001599 Ga0070679_10000159916 314
126 3300005535 Ga0070684_100100731 Ga0070684_1001007312 314
127 3300005535 Ga0070684_100194844 Ga0070684_1001948442 314
128 3300005536 Ga0070697_100002439 Ga0070697_10000243912 314
129 3300005536 Ga0070697_100039296 Ga0070697_1000392963 314
130 3300005536 Ga0070697_100148868 Ga0070697_1001488683 314
131 3300005546 Ga0070696_100035772 Ga0070696_1000357722 314
132 3300005547 Ga0070693_100006131 Ga0070693_1000061312 314
133 3300005548 Ga0070665_100140435 Ga0070665_1001404352 314
134 3300005563 Ga0068855_100000543 Ga0068855_1000005432 314
135 3300005563 Ga0068855_100000926 Ga0068855_10000092617 314
136 3300005563 Ga0068855_100009432 Ga0068855_1000094325 314
137 3300005563 Ga0068855_100110839 Ga0068855_1001108393 314
138 3300005563 Ga0068855_100223963 Ga0068855_1002239632 314
139 3300005564 Ga0070664_100000220 Ga0070664_10000022032 314
140 3300005564 Ga0070664_100134015 Ga0070664_1001340153 314
141 3300005577 Ga0068857_100000298 Ga0068857_10000029816 314
142 3300005577 Ga0068857_100001937 Ga0068857_10000193717 314
143 3300005578 Ga0068854_100005411 Ga0068854_1000054115 314
144 3300005614 Ga0068856_100000843 Ga0068856_1000008434 314
145 3300005614 Ga0068856_100002725 Ga0068856_10000272515 314
146 3300005614 Ga0068856_100025161 Ga0068856_1000251615 314
147 3300005614 Ga0068856_100369196 Ga0068856_1003691961 314
148 3300005616 Ga0068852_100463894 Ga0068852_1004638942 314
149 3300005617 Ga0068859_100000251 Ga0068859_10000025119 314
150 3300005617 Ga0068859_100048102 Ga0068859_1000481024 314
151 3300005618 Ga0068864_100001872 Ga0068864_10000187210 314
152 3300005718 Ga0068866_10025103 Ga0068866_100251032 314
153 3300005718 Ga0068866_10041154 Ga0068866_100411542 314
154 3300005719 Ga0068861_100004170 Ga0068861_1000041708 314
155 3300005840 Ga0068870_10021942 Ga0068870_100219421 314
156 3300005841 Ga0068863_100195591 Ga0068863_1001955912 314
157 3300005841 Ga0068863_100353202 Ga0068863_1003532022 314
158 3300005842 Ga0068858_100002965 Ga0068858_1000029659 314
159 3300005842 Ga0068858_100043295 Ga0068858_1000432953 314
160 3300005842 Ga0068858_100050897 Ga0068858_1000508974 314
161 3300005842 Ga0068858_100084245 Ga0068858_1000842452 314
162 3300005843 Ga0068860_100014096 Ga0068860_1000140963 314
163 3300005843 Ga0068860_100015856 Ga0068860_1000158567 314
164 3300005843 Ga0068860_100070906 Ga0068860_1000709063 314
165 3300006028 Ga0070717_10025753 Ga0070717_100257534 314
166 3300006051 Ga0075364_10043738 Ga0075364_100437382 314
167 3300006175 Ga0070712_100003187 Ga0070712_1000031877 314
168 3300006175 Ga0070712_100010954 Ga0070712_1000109544 314
169 3300006175 Ga0070712_100088172 Ga0070712_1000881721 314
170 3300006177 Ga0075362_10015384 Ga0075362_100153842 314
171 3300006178 Ga0075367_10005022 Ga0075367_100050226 314
172 3300006195 Ga0075366_10000800 Ga0075366_1000080011 314
173 3300006237 Ga0097621_100000752 Ga0097621_1000007529 314
174 3300006237 Ga0097621_100001357 Ga0097621_1000013574 314
175 3300006237 Ga0097621_100060780 Ga0097621_1000607802 314
176 3300006237 Ga0097621_100198671 Ga0097621_1001986711 314
177 3300006358 Ga0068871_100000717 Ga0068871_10000071717 314
178 3300006358 Ga0068871_100010619 Ga0068871_1000106192 314
179 3300006358 Ga0068871_100030104 Ga0068871_1000301043 314
180 3300006358 Ga0068871_100098320 Ga0068871_1000983202 314
181 3300006358 Ga0068871_100133628 Ga0068871_1001336282 314
182 3300006844 Ga0075428_100146598 Ga0075428_1001465982 314
183 3300006852 Ga0075433_10000300 Ga0075433_1000030027 314
184 3300006871 Ga0075434_100003131 Ga0075434_1000031311 314
185 3300006871 Ga0075434_100093824 Ga0075434_1000938243 314
186 3300006880 Ga0075429_100088232 Ga0075429_1000882322 314
187 3300006880 Ga0075429_100370634 Ga0075429_1003706341 314
188 3300006881 Ga0068865_100029519 Ga0068865_1000295193 314
189 3300006881 Ga0068865_100057648 Ga0068865_1000576483 314
190 3300006881 Ga0068865_100101695 Ga0068865_1001016952 314
191 3300006914 Ga0075436_100001424 Ga0075436_1000014242 314
192 3300006914 Ga0075436_100003071 Ga0075436_1000030719 314
193 3300006914 Ga0075436_100071842 Ga0075436_1000718422 314
194 3300006914 Ga0075436_100103863 Ga0075436_1001038633 314
195 3300006914 Ga0075436_100128195 Ga0075436_1001281952 314
196 3300006931 Ga0097620_100000251 Ga0097620_10000025119 314
197 3300006931 Ga0097620_100048100 Ga0097620_1000481004 314
198 3300007076 Ga0075435_100000514 Ga0075435_1000005147 314
199 3300007076 Ga0075435_100028744 Ga0075435_1000287445 314
200 3300007076 Ga0075435_100063379 Ga0075435_1000633793 314
201 3300009093 Ga0105240_10012442 Ga0105240_100124429 314
202 3300009093 Ga0105240_10064086 Ga0105240_100640863 314
203 3300009093 Ga0105240_10286136 Ga0105240_102861362 314
204 3300009094 Ga0111539_10007895 Ga0111539_1000789511 314
205 3300009147 Ga0114129_10232080 Ga0114129_102320802 314
206 3300009148 Ga0105243_10030584 Ga0105243_100305843 314
207 3300009174 Ga0105241_10001985 Ga0105241_100019854 314
208 3300009174 Ga0105241_10024785 Ga0105241_100247854 314
209 3300009176 Ga0105242_10207503 Ga0105242_102075032 314
210 3300009177 Ga0105248_10017301 Ga0105248_100173016 314
211 3300009177 Ga0105248_10074300 Ga0105248_100743002 314
212 3300009545 Ga0105237_10079757 Ga0105237_100797572 314
213 3300009545 Ga0105237_10380738 Ga0105237_103807381 314
214 3300009551 Ga0105238_10000353 Ga0105238_1000035325 314
215 3300009551 Ga0105238_10043822 Ga0105238_100438223 314
216 3300009551 Ga0105238_10328157 Ga0105238_103281571 314
217 3300009553 Ga0105249_10296715 Ga0105249_102967152 314
218 3300010375 Ga0105239_10161772 Ga0105239_101617722 314
219 3300010375 Ga0105239_10316415 Ga0105239_103164152 314
220 3300010375 Ga0105239_10373358 Ga0105239_103733581 314
221 3300010375 Ga0105239_10836642 Ga0105239_108366421 314
222 3300013100 Ga0157373_10001041 Ga0157373_100010414 314
223 3300013100 Ga0157373_10136561 Ga0157373_101365612 314
224 3300013102 Ga0157371_10097157 Ga0157371_100971572 314
225 3300013104 Ga0157370_10032279 Ga0157370_100322796 314
226 3300013104 Ga0157370_10158158 Ga0157370_101581581 314
227 3300013105 Ga0157369_10000122 Ga0157369_1000012251 314
228 3300013105 Ga0157369_10079974 Ga0157369_100799742 314
229 3300013105 Ga0157369_10109824 Ga0157369_101098243 314
230 3300013105 Ga0157369_10143702 Ga0157369_101437022 314
231 3300013105 Ga0157369_10199948 Ga0157369_101999481 314
232 3300013105 Ga0157369_10303290 Ga0157369_103032902 314
233 3300013296 Ga0157374_10000552 Ga0157374_100005528 314
234 3300013296 Ga0157374_10000645 Ga0157374_1000064513 314
235 3300013296 Ga0157374_10000792 Ga0157374_100007924 314
236 3300013296 Ga0157374_10030307 Ga0157374_100303072 314
237 3300013297 Ga0157378_10000029 Ga0157378_1000002926 314
238 3300013297 Ga0157378_10000224 Ga0157378_1000022443 314
239 3300013297 Ga0157378_10003392 Ga0157378_100033924 314
240 3300013297 Ga0157378_10078601 Ga0157378_100786013 314
241 3300013297 Ga0157378_10095400 Ga0157378_100954003 314
242 3300013306 Ga0163162_10002350 Ga0163162_100023509 314
243 3300013307 Ga0157372_10000068 Ga0157372_1000006861 314
244 3300013307 Ga0157372_10000477 Ga0157372_1000047737 314
245 3300013307 Ga0157372_10000638 Ga0157372_1000063820 314
246 3300013307 Ga0157372_10005772 Ga0157372_1000577213 314
247 3300013307 Ga0157372_10010924 Ga0157372_100109242 314
248 3300013307 Ga0157372_10012281 Ga0157372_100122813 314
249 3300013307 Ga0157372_10068484 Ga0157372_100684842 314
250 3300013307 Ga0157372_10096839 Ga0157372_100968394 314
251 3300013307 Ga0157372_10153416 Ga0157372_101534162 314
252 3300013307 Ga0157372_10156656 Ga0157372_101566562 314
253 3300014745 Ga0157377_10026836 Ga0157377_100268362 314
254 3300014968 Ga0157379_10096560 Ga0157379_100965603 314
255 3300014969 Ga0157376_10000845 Ga0157376_100008454 314
256 3300014969 Ga0157376_10149314 Ga0157376_101493142 314
257 3300014969 Ga0157376_10207118 Ga0157376_102071182 314
258 3300024225 Ga0224572_1005303 Ga0224572_10053032 314
259 3300024227 Ga0228598_1003937 Ga0228598_10039372 314
260 3300025898 Ga0207692_10088990 Ga0207692_100889901 314
261 3300025899 Ga0207642_10020767 Ga0207642_100207672 314
262 3300025904 Ga0207647_10016006 Ga0207647_100160063 314
263 3300025904 Ga0207647_10040971 Ga0207647_100409711 314
264 3300025906 Ga0207699_10259274 Ga0207699_102592741 314
265 3300025908 Ga0207643_10075709 Ga0207643_100757092 314
266 3300025910 Ga0207684_10005498 Ga0207684_100054989 314
267 3300025910 Ga0207684_10114021 Ga0207684_101140212 314
268 3300025911 Ga0207654_10022816 Ga0207654_100228163 314
269 3300025911 Ga0207654_10079175 Ga0207654_100791752 314
270 3300025911 Ga0207654_10243905 Ga0207654_102439051 314
271 3300025912 Ga0207707_10000409 Ga0207707_1000040936 314
272 3300025913 Ga0207695_10001894 Ga0207695_1000189425 314
273 3300025913 Ga0207695_10083899 Ga0207695_100838993 314
274 3300025915 Ga0207693_10008736 Ga0207693_100087362 314
275 3300025915 Ga0207693_10011277 Ga0207693_100112774 314
276 3300025915 Ga0207693_10013610 Ga0207693_100136103 314
277 3300025915 Ga0207693_10109669 Ga0207693_101096692 314
278 3300025916 Ga0207663_10047778 Ga0207663_100477782 314
279 3300025917 Ga0207660_10278745 Ga0207660_102787452 314
280 3300025918 Ga0207662_10023188 Ga0207662_100231883 314
281 3300025920 Ga0207649_10006270 Ga0207649_100062703 314
282 3300025921 Ga0207652_10009656 Ga0207652_100096562 314
283 3300025924 Ga0207694_10000778 Ga0207694_100007782 314
284 3300025924 Ga0207694_10068705 Ga0207694_100687053 314
285 3300025924 Ga0207694_10100583 Ga0207694_101005832 314
286 3300025925 Ga0207650_10014356 Ga0207650_100143565 314
287 3300025926 Ga0207659_10059185 Ga0207659_100591852 314
288 3300025928 Ga0207700_10011309 Ga0207700_100113096 314
289 3300025928 Ga0207700_10059071 Ga0207700_100590713 314
290 3300025929 Ga0207664_10057327 Ga0207664_100573272 314
291 3300025929 Ga0207664_10260476 Ga0207664_102604761 314
292 3300025929 Ga0207664_10344723 Ga0207664_103447232 314
293 3300025936 Ga0207670_10030829 Ga0207670_100308293 314
294 3300025938 Ga0207704_10009139 Ga0207704_100091393 314
295 3300025938 Ga0207704_10019065 Ga0207704_100190653 314
296 3300025939 Ga0207665_10062803 Ga0207665_100628032 314
297 3300025939 Ga0207665_10092343 Ga0207665_100923432 314
298 3300025939 Ga0207665_10117954 Ga0207665_101179542 314
299 3300025941 Ga0207711_10009802 Ga0207711_100098022 314
300 3300025942 Ga0207689_10000769 Ga0207689_1000076912 314
301 3300025942 Ga0207689_10012776 Ga0207689_100127764 314
302 3300025944 Ga0207661_10035818 Ga0207661_100358182 314
303 3300025944 Ga0207661_10079232 Ga0207661_100792322 314
304 3300025944 Ga0207661_10281918 Ga0207661_102819182 314
305 3300025945 Ga0207679_10001445 Ga0207679_1000144510 314
306 3300025945 Ga0207679_10038677 Ga0207679_100386772 314
307 3300025949 Ga0207667_10000182 Ga0207667_100001827 314
308 3300025949 Ga0207667_10005043 Ga0207667_100050434 314
309 3300025949 Ga0207667_10009015 Ga0207667_100090156 314
310 3300025949 Ga0207667_10184503 Ga0207667_101845032 314
311 3300025949 Ga0207667_10588025 Ga0207667_105880251 314
312 3300025981 Ga0207640_10005089 Ga0207640_100050895 314
313 3300025981 Ga0207640_10156004 Ga0207640_101560042 314
314 3300025981 Ga0207640_10275141 Ga0207640_102751411 314
315 3300026023 Ga0207677_10006528 Ga0207677_100065284 314
316 3300026023 Ga0207677_10031292 Ga0207677_100312922 314
317 3300026035 Ga0207703_10016245 Ga0207703_100162454 314
318 3300026035 Ga0207703_10073444 Ga0207703_100734442 314
319 3300026035 Ga0207703_10118912 Ga0207703_101189122 314
320 3300026041 Ga0207639_10428447 Ga0207639_104284471 314
321 3300026075 Ga0207708_10034623 Ga0207708_100346232 314
322 3300026075 Ga0207708_10121004 Ga0207708_101210042 314
323 3300026078 Ga0207702_10000169 Ga0207702_1000016940 314
324 3300026078 Ga0207702_10000849 Ga0207702_100008495 314
325 3300026078 Ga0207702_10008228 Ga0207702_100082284 314
326 3300026078 Ga0207702_10101445 Ga0207702_101014452 314
327 3300026078 Ga0207702_10178610 Ga0207702_101786102 314
328 3300026078 Ga0207702_10436168 Ga0207702_104361681 314
329 3300026089 Ga0207648_10006338 Ga0207648_100063382 314
330 3300026089 Ga0207648_10020451 Ga0207648_100204513 314
331 3300026095 Ga0207676_10129927 Ga0207676_101299272 314
332 3300026116 Ga0207674_10001157 Ga0207674_1000115726 314
333 3300026116 Ga0207674_10006585 Ga0207674_100065852 314
334 3300026121 Ga0207683_10061427 Ga0207683_100614273 314
335 3300026142 Ga0207698_10105681 Ga0207698_101056811 314
336 3300027907 Ga0207428_10000083 Ga0207428_10000083111 314
337 3300028381 Ga0268264_10067467 Ga0268264_100674673 314
338 3300028381 Ga0268264_10097488 Ga0268264_100974882 314
339 3300028800 Ga0265338_10027569 Ga0265338_100275693 314
340 3300031238 Ga0265332_10035019 Ga0265332_100350192 314
341 3300031239 Ga0265328_10022686 Ga0265328_100226861 314
342 3300031247 Ga0265340_10026601 Ga0265340_100266013 314
343 3300031249 Ga0265339_10005718 Ga0265339_100057184 314
344 3300031344 Ga0265316_10003023 Ga0265316_100030236 314
345 3300031995 Ga0307409_100055832 Ga0307409_1000558322 314
346 3300032005 Ga0307411_10018368 Ga0307411_100183685 314
347 3300035111 Ga0373923_0047736 Ga0373923_0047736_490_1434 314
348 3300035170 Ga0373943_0108015 Ga0373943_0108015_91_1035 314
349 3300035691 Ga0373931_0003650 Ga0373931_0003650_4582_5526 314
350 3300035692 Ga0373935_0004737 Ga0373935_0004737_2592_3536 314
351 3300035692 Ga0373935_0076227 Ga0373935_0076227_498_1442 314
352 3300035692 Ga0373935_0236037 Ga0373935_0236037_203_1147 314
353 3300035725 Ga0373947_0008533 Ga0373947_0008533_2621_3565 314
354 3300036401 Ga0373937_0005502 Ga0373937_0005502_524_1468 314
355 3300036401 Ga0373937_0043657 Ga0373937_0043657_944_1888 314
356 3300037068 Ga0373925_0004062 Ga0373925_0004062_2339_3283 314
357 3300037068 Ga0373925_0010516 Ga0373925_0010516_2520_3464 314
358 3300037853 Ga0436364_0195917 Ga0436364_0195917_343_1290 314
359 3300039450 Ga0436363_1045619 Ga0436363_1045619_5414_6382 314
360 3300042876 Ga0451577_0000294 Ga0451577_0000294_36064_37011 314
361 3300044673 Ga0453683_0015004 Ga0453683_0015004_3624_4571 314
362 3300044694 Ga0466963_0120322 Ga0466963_0120322_662_1606 314
363 3300044712 Ga0453684_0000104 Ga0453684_0000104_204501_205448 314
364 3300044719 Ga0466971_0154913 Ga0466971_0154913_78_1022 314
365 3300045051 Ga0451576_0019162 Ga0451576_0019162_3817_4764 314
366 3300045836 Ga0466958_0217369 Ga0466958_0217369_122_1066 314
367 3300045976 Ga0466967_0015714 Ga0466967_0015714_25_969 314
368 3300045976 Ga0466967_0021613 Ga0466967_0021613_1204_2148 314
369 3300046455 Ga0495603_0162231 Ga0495603_0162231_154_1101 314
370 3300046472 Ga0495580_0002144 Ga0495580_0002144_13734_14678 314
371 3300046472 Ga0495580_0005550 Ga0495580_0005550_944_1888 314
372 3300046472 Ga0495580_0041294 Ga0495580_0041294_1119_2066 314
373 3300046472 Ga0495580_0100099 Ga0495580_0100099_556_1503 314
374 3300046472 Ga0495580_0185316 Ga0495580_0185316_245_1189 314
375 3300046473 Ga0495582_0001757 Ga0495582_0001757_4148_5092 314
376 3300046517 Ga0495630_0345449 Ga0495630_0345449_171_1115 314
377 3300046526 Ga0495666_0108320 Ga0495666_0108320_308_1252 314
378 3300046531 Ga0495665_0001542 Ga0495665_0001542_7900_8844 314
379 3300046559 Ga0495667_0172451 Ga0495667_0172451_28_972 314
380 3300046679 Ga0495623_0053230 Ga0495623_0053230_521_1465 314
381 3300046679 Ga0495623_0061505 Ga0495623_0061505_579_1523 314
382 3300046683 Ga0495658_0211094 Ga0495658_0211094_216_1160 314
383 3300047315 Ga0495581_0204405 Ga0495581_0204405_117_1061 314
384 3300047444 Ga0495675_0053697 Ga0495675_0053697_954_1898 314
385 3300047445 Ga0495677_0063586 Ga0495677_0063586_120_1091 314
386 3300048088 Ga0495602_0072838 Ga0495602_0072838_788_1732 314
387 3300048904 Ga0496101_0404154 Ga0496101_0404154_69_1013 314
388 3300048905 Ga0496102_0392606 Ga0496102_0392606_83_1027 314
389 3300048915 Ga0496112_0018387 Ga0496112_0018387_1474_2418 314
390 3300048915 Ga0496112_0019735 Ga0496112_0019735_17_964 314
391 3300048915 Ga0496112_0100412 Ga0496112_0100412_795_1739 314
392 3300048915 Ga0496112_0105068 Ga0496112_0105068_110_1054 314
393 3300048915 Ga0496112_0131649 Ga0496112_0131649_801_1745 314
394 3300048916 Ga0496113_0291078 Ga0496113_0291078_47_994 314
395 3300049686 Ga0501257_035944 Ga0501257_035944_191_1135 314
396 3300049705 Ga0501225_0028260 Ga0501225_0028260_428_1372 314
397 3300050489 nmdc:mga03683_36630_c1 nmdc:mga03683_36630_c1_20_991 314
398 3300050491 nmdc:mga00v17_86205_c1 nmdc:mga00v17_86205_c1_707_1678 314
399 3300050492 nmdc:mga0yw44_70332_c1 nmdc:mga0yw44_70332_c1_20_991 314
400 3300050493 nmdc:mga0k408_17122_c1 nmdc:mga0k408_17122_c1_2067_3038 314
401 3300050494 nmdc:mga06z11_12383_c1 nmdc:mga06z11_12383_c1_1012_1983 314
402 3300050496 nmdc:mga07m45_28334_c1 nmdc:mga07m45_28334_c1_1395_2366 314
403 3300050507 nmdc:mga05p37_485644_c1 nmdc:mga05p37_485644_c1_314_1285 314
404 3300050511 nmdc:mga08y16_979_c1 nmdc:mga08y16_979_c1_12080_13051 314
405 3300050512 nmdc:mga0n895_12999_c1 nmdc:mga0n895_12999_c1_5138_6085 314
406 3300050512 nmdc:mga0n895_186364_c1 nmdc:mga0n895_186364_c1_1042_2013 314
407 3300050513 nmdc:mga0rr50_17651_c1 nmdc:mga0rr50_17651_c1_3250_4194 314
408 3300050513 nmdc:mga0rr50_187430_c1 nmdc:mga0rr50_187430_c1_78_1025 314
409 3300050513 nmdc:mga0rr50_4340_c1 nmdc:mga0rr50_4340_c1_1278_2225 314
410 3300050514 nmdc:mga08x19_1222_c1 nmdc:mga08x19_1222_c1_3988_4935 314
411 3300050514 nmdc:mga08x19_124514_c1 nmdc:mga08x19_124514_c1_381_1325 314
412 3300050514 nmdc:mga08x19_20178_c1 nmdc:mga08x19_20178_c1_2315_3262 314
413 3300050515 nmdc:mga0a205_7502_c1 nmdc:mga0a205_7502_c1_8884_9831 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

86

316

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u0g-assembly2.cif.gz_B crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei 0.9174 4 304
1i1k-assembly1.cif.gz_A crystal structure of eschelichia coli branched-chain amino acid aminotransferase. 0.9156 5 304
1a3g-assembly1.cif.gz_A branched-chain amino acid aminotransferase from escherichia coli 0.9143 5 304
6nst-assembly1.cif.gz_C crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9135 1 305
3u0g-assembly1.cif.gz_C crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei 0.9129 4 304
ID Description Score Start End Superfamily
af_P0AB80_137_302_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9131 135 299 3.30.470.10
5mr0A02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9116 136 291 3.20.10.10
6h65B02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9089 134 293 3.20.10.10
af_I1JRF2_385_551_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9071 130 291 3.20.10.10
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.905 134 292 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A349S5M3-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9642 170 305 GO:0005829
GO:0006532
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A532D543-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9625 167 304 GO:0005829
GO:0008652
GO:0009082
GO:0052655
GO:0052656
AF-A0A2R6AU00-F1-model_v4 Branched-chain amino acid aminotransferase 0.9555 161 277 GO:0008483
GO:0008652
GO:0009082
AF-A0A3D2SHC0-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9546 162 263 GO:0004084
GO:0005829
GO:0006532
GO:0009098
GO:0009099
AF-A0A259LQ31-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9537 161 305 GO:0004084
GO:0005829
GO:0006532
GO:0009098
GO:0009099

Feature Viewer

pLDDT pTM Quality
86.18 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map