F438075

General Info

Members Datasets Scaffolds Average Seq Length
413 314 827 310

Family's Representative Sequence

Representative Sequence 3300025284|Ga0209130_1000339|Ga0209130_10003395
Length 355
Sequence MIRMKCFFLFIRNRISCFQKKMVQYPIEWNFTSNETEPAAEWRFIHMPKVRTKDLIEQFQLELVSGEEGIHRPIDTSDLSRPGIEMAGFFTYYPADRVQLLGKTELTFFDTLTTEQKQERMKALCTEETPCIIVTRNQDVPDELLQASRESGVPLLRSAQTTTRLSSRLTNYLEGKLAPTTAVHGVLVDIYGVGVLITGQSGVGKSETALELVKRGHRLVADDSVEIRQEDEDTLVGSSPDLIEHLLEIRGLGIINVMTLFGAGAVRNYKRITLVINLEIWDQKKNYDRLGLDEEKMKIIDTELTKITLPVRPGRNLAVIIEVAAMNFRLKRMGVNAAQQFSERLMSAIELGNQE

Samples

Sample ID Description Type Environment
1 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
48 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
49 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
59 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
60 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
64 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
65 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
66 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
67 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
74 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
75 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
76 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
77 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
78 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
79 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
80 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
81 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
105 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
106 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
107 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
108 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
109 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
110 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
111 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
112 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
113 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
114 2554235283 Bacillus safensis VK Isolate Rhizosphere
115 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
116 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
117 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
118 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
119 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
120 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
121 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
122 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
123 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
124 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
125 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
126 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
127 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
128 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
129 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
130 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
131 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
132 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
133 2643221729 Bacillus sp. Root11 Isolate Unclassified
134 2643221730 Bacillus sp. Root131 Isolate Unclassified
135 2643221731 Bacillus sp. Root147 Isolate Unclassified
136 2643221732 Bacillus sp. Root239 Isolate Unclassified
137 2643221735 Bacillus sp. Root920 Isolate Unclassified
138 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
139 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
140 2671180694 Paenibacillus sp. A3 Isolate Unclassified
141 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
142 2684622632 Bacillus cereus 905 Isolate Unclassified
143 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
144 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
145 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
146 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
147 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
148 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
149 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
150 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
151 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
152 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
153 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
154 2738541295 Bacillus sp. OK085 Isolate Unclassified
155 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
156 2738541358 Bacillus sp. OV752 Isolate Unclassified
157 2738543006 Bacillus sp. OK077 Isolate Unclassified
158 2738543017 Bacillus sp. OV186 Isolate Unclassified
159 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
160 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
161 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
162 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
163 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
164 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
165 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
166 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
167 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
168 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
169 2811994870 Bacillus sp. JB4 Isolate Unclassified
170 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
171 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
172 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
173 2818991441 Niallia circulans 3243 Isolate Rhizosphere
174 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
175 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
176 2818991459 Paenibacillus sp. 597 Isolate Unclassified
177 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
178 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
179 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
180 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
181 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
182 2842682962 Bacillus sp. R-72492 Isolate Unclassified
183 2842882022 Bacillus sp. R-71893 Isolate Unclassified
184 2849139964 Bacillus sp. R-71875 Isolate Unclassified
185 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
186 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
187 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
188 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
189 2857472729 Cohnella sp. R-74144 Isolate Unclassified
190 2857581216 Bacillus sp. R-71922 Isolate Unclassified
191 2857586860 Bacillus sp. R-71935 Isolate Unclassified
192 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
193 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
194 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
195 2860837431 Bacillus sp. WR11 Isolate Unclassified
196 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
197 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
198 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
199 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
200 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
201 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
202 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
203 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
204 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
205 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
206 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
207 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
208 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
209 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
210 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
211 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
212 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
213 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
214 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
215 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
216 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
217 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
218 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
219 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
220 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
221 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
222 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
223 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
224 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
225 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
226 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
227 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
228 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
229 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
230 2919720352 Priestia megaterium 4340 Isolate Unclassified
231 2919726948 Bacillus pumilus 4489 Isolate Unclassified
232 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
233 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
234 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
235 2929004312 Priestia megaterium 1104 Isolate Unclassified
236 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
237 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
238 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
239 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
240 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
241 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
242 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
243 2938917290 Bacillus sp. CR71 Isolate Unclassified
244 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
245 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
246 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
247 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
248 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
249 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
250 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
251 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
252 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
253 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
254 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
255 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
256 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
257 2965761152 Bacillus sp. COPE52 Isolate Unclassified
258 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
259 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
260 2969141011 Bacillus velezensis MH25 Isolate Unclassified
261 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
262 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
263 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
264 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
265 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
266 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
267 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
268 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
269 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
270 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
271 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
272 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
273 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
274 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
275 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
276 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
277 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
278 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
279 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
280 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
281 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
282 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
283 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
284 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
285 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
286 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
287 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
288 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
289 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
290 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
291 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
292 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
293 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
294 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
295 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
296 8022653035 Bacillus sp. Rc4 Isolate Unclassified
297 8022792930 Bacillus sp. Xin Isolate Rhizosphere
298 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
299 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
300 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
301 8023438354 Bacillus sp. BH2 Isolate Unclassified
302 8023444577 Bacillus sp. BH32 Isolate Unclassified
303 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
304 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
305 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
306 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
307 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
308 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
309 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
310 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
311 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
312 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
313 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
314 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 41.4
Metatranscriptomes 7.99
Isolates 50.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 13.32
Nodule 0.48
Rhizoplane 5.08
Rhizosphere 45.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209130_1000339 3300025284 Bacteria 53895
2 JGI25162J39368_1005128 3300002737 Bacteria 2700
3 JGI25159J45721_1002767 3300002987 Bacteria 6491
4 JGI25159J45721_1005829 3300002987 Bacteria 3804
5 JGI25151J46595_10000011 3300003187 Bacteria 264206
6 JGI25151J46595_10001861 3300003187 Bacteria 13530
7 JGI25151J46595_10006225 3300003187 Bacteria 6035
8 JGI25151J46595_10007348 3300003187 Bacteria 5411
9 JGI25151J46595_10008597 3300003187 Bacteria 4895
10 JGI25151J46595_10008657 3300003187 Bacteria 4874
11 rootH1_10013587 3300003316 Bacteria 13243
12 rootH2_10105181 3300003320 Bacteria 11365
13 rootL2_10016501 3300003322 Bacteria 51953
14 rootH1_10160187 3300003316 Bacteria 2042
15 rootH1_10160187 3300003323 Bacteria 7944
16 Ga0006562J51391_1001534 3300003578 Bacteria 19960
17 Ga0006562J51391_1003264 3300003578 Bacteria 7214
18 Ga0055538_1000291 3300003751 Bacteria 25385
19 Ga0055538_1000550 3300003751 Bacteria 13002
20 Ga0055538_1000561 3300003751 Bacteria 12776
21 Ga0055532_1000052 3300003758 Bacteria 164911
22 Ga0055532_1000098 3300003758 Bacteria 94025
23 Ga0055532_1000617 3300003758 Bacteria 14068
24 Ga0055532_1010532 3300003758 Bacteria 1104
25 Ga0055536_1025189 3300003781 Bacteria 1702
26 Ga0055541_1000555 3300003841 Bacteria 10120
27 Ga0070670_100105771 3300005331 Bacteria 2425
28 Ga0070669_100048321 3300005353 Bacteria 3106
29 Ga0070671_100006848 3300005355 Bacteria 9121
30 Ga0068864_100315887 3300005618 Bacteria 1466
31 Ga0105251_10004686 3300009011 Bacteria 9192
32 Ga0105244_10026670 3300009036 Bacteria 3123
33 Ga0105244_10043290 3300009036 Bacteria 2324
34 Ga0105250_10000615 3300009092 Bacteria 23219
35 Ga0105245_10087829 3300009098 Bacteria 2855
36 Ga0105243_10003566 3300009148 Bacteria 12563
37 Ga0105243_10043119 3300009148 Bacteria 3535
38 Ga0105246_10001390 3300011119 Bacteria 14298
39 Ga0105246_10001625 3300011119 Bacteria 13367
40 Ga0105246_10009165 3300011119 Bacteria 6095
41 Ga0105246_10268372 3300011119 Bacteria 1363
42 Ga0157371_10019406 3300013102 Bacteria 5016
43 Ga0157372_10152007 3300013307 Bacteria 2672
44 Ga0157376_10023701 3300014969 Bacteria 4808
45 Ga0209784_100107 3300025224 Bacteria 95294
46 Ga0209784_100178 3300025224 Bacteria 53225
47 Ga0209566_100086 3300025225 Bacteria 148250
48 Ga0209566_100912 3300025225 Bacteria 13856
49 Ga0209566_100961 3300025225 Bacteria 12881
50 Ga0209147_100028 3300025229 Bacteria 383994
51 Ga0209147_100101 3300025229 Bacteria 161976
52 Ga0209147_101278 3300025229 Bacteria 9818
53 Ga0209147_102136 3300025229 Bacteria 5475
54 Ga0209437_101119 3300025233 Bacteria 8265
55 Ga0209130_1002533 3300025284 Bacteria 8957
56 Ga0209130_1002658 3300025284 Bacteria 8538
57 Ga0209130_1013575 3300025284 Bacteria 2081
58 Ga0209676_1000844 3300025292 Bacteria 39621
59 Ga0209676_1001922 3300025292 Bacteria 16788
60 Ga0209676_1011083 3300025292 Bacteria 3678
61 Ga0209676_1018081 3300025292 Bacteria 2469
62 Ga0209676_1021432 3300025292 Bacteria 2170
63 Ga0209025_1000011 3300025294 Bacteria 976387
64 Ga0209025_1000095 3300025294 Bacteria 240057
65 Ga0209025_1001238 3300025294 Bacteria 35471
66 Ga0209025_1001570 3300025294 Bacteria 28964
67 Ga0209025_1002884 3300025294 Bacteria 17223
68 Ga0209025_1003178 3300025294 Bacteria 15968
69 Ga0209025_1003372 3300025294 Bacteria 15273
70 Ga0209025_1004777 3300025294 Bacteria 11496
71 Ga0209025_1005514 3300025294 Bacteria 10279
72 Ga0209025_1006940 3300025294 Bacteria 8615
73 Ga0209025_1008125 3300025294 Bacteria 7622
74 Ga0209025_1008227 3300025294 Bacteria 7543
75 Ga0209025_1016995 3300025294 Bacteria 4239
76 Ga0209025_1026201 3300025294 Bacteria 2935
77 Ga0207426_1021189 3300025302 Bacteria 2249
78 Ga0207696_1004066 3300025711 Bacteria 6407
79 Ga0207655_1001622 3300025728 Bacteria 19983
80 Ga0207655_1011164 3300025728 Bacteria 5371
81 Ga0207655_1029055 3300025728 Bacteria 2596
82 Ga0207713_1005814 3300025735 Bacteria 7634
83 Ga0207713_1028013 3300025735 Bacteria 2547
84 Ga0207713_1047914 3300025735 Bacteria 1725
85 Ga0207713_1054595 3300025735 Bacteria 1565
86 Ga0207710_10078316 3300025900 Bacteria 1529
87 Ga0207650_10099116 3300025925 Bacteria 2240
88 Ga0207659_10095381 3300025926 Bacteria 2231
89 Ga0207687_10251624 3300025927 Bacteria 1405
90 Ga0207709_10001045 3300025935 Bacteria 20447
91 Ga0237817_10173 3300030083 Bacteria 18383
92 Ga0237817_10597 3300030083 Bacteria 3779
93 Ga0307408_100063823 3300031548 Bacteria 2696
94 Ga0307409_100057980 3300031995 Bacteria 3005
95 Ga0307416_100121051 3300032002 Bacteria 2332
96 Ga0395899_0032917 3300037312 Bacteria 3895
97 Ga0395899_0132940 3300037312 Bacteria 1775
98 Ga0237819_00080 3300038705 Bacteria 34903
99 Ga0237819_00905 3300038705 Bacteria 9203
100 Ga0439439_0000419 3300041406 Bacteria 7121
101 Ga0439433_0006023 3300041999 Bacteria 2606
102 Ga0439449_0000519 3300042007 Bacteria 14359
103 Ga0439449_0014796 3300042007 Bacteria 2931
104 Ga0439457_008337 3300042014 Bacteria 2449
105 Ga0466969_0002462 3300044656 Bacteria 9883
106 Ga0466961_0007065 3300044693 Bacteria 7144
107 Ga0466968_0005722 3300044735 Bacteria 4663
108 Ga0466957_0272414 3300044842 Bacteria 1131
109 Ga0466959_0023386 3300045049 Bacteria 4572
110 Ga0466967_0000147 3300045976 Bacteria 27595
111 Ga0495590_0021536 3300046457 Bacteria 2284
112 Ga0495683_0015065 3300047323 Bacteria 4027
113 Ga0496100_0005657 3300048903 Bacteria 6757
114 Ga0496101_0001500 3300048904 Bacteria 13968
115 Ga0496102_0003848 3300048905 Bacteria 12708
116 Ga0496103_0006336 3300048906 Bacteria 7072
117 Ga0496104_0000326 3300048907 Bacteria 42402
118 Ga0496105_0000211 3300048908 Bacteria 39018
119 Ga0496106_0128884 3300048909 Bacteria 1983
120 Ga0496107_0001565 3300048910 Bacteria 14219
121 Ga0496108_0004293 3300048911 Bacteria 11476
122 Ga0496108_0157756 3300048911 Bacteria 1960
123 Ga0496109_0000350 3300048912 Bacteria 43110
124 Ga0496110_0003822 3300048913 Bacteria 11599
125 Ga0496110_0110145 3300048913 Bacteria 2474
126 Ga0496111_0087102 3300048914 Bacteria 2286
127 Ga0496112_0000432 3300048915 Bacteria 27731
128 Ga0496112_0081144 3300048915 Bacteria 3207
129 Ga0496113_0069719 3300048916 Bacteria 2671
130 Ga0496116_0012261 3300048919 Bacteria 7010
131 Ga0496116_0013030 3300048919 Bacteria 6744
132 Ga0496116_0018809 3300048919 Bacteria 5308
133 Ga0496116_0034163 3300048919 Bacteria 3593
134 Ga0496116_0044984 3300048919 Bacteria 2992
135 Ga0496116_0058077 3300048919 Bacteria 2525
136 Ga0496116_0070439 3300048919 Bacteria 2219
137 Ga0496117_0000087 3300048920 Bacteria 211708
138 Ga0496117_0018347 3300048920 Bacteria 5798
139 Ga0496117_0037328 3300048920 Bacteria 3621
140 Ga0496117_0042807 3300048920 Bacteria 3301
141 Ga0496118_0097562 3300048921 Bacteria 1999
142 Ga0496118_0109572 3300048921 Bacteria 1837
143 Ga0496119_0000331 3300048922 Bacteria 66145
144 Ga0496119_0001771 3300048922 Bacteria 25132
145 Ga0496119_0027184 3300048922 Bacteria 3941
146 Ga0496120_0000298 3300048923 Bacteria 83191
147 Ga0496120_0024792 3300048923 Bacteria 3733
148 Ga0496120_0061406 3300048923 Bacteria 2098
149 Ga0496121_0042383 3300048924 Bacteria 3960
150 Ga0496121_0072057 3300048924 Bacteria 2775
151 Ga0496121_0073062 3300048924 Bacteria 2750
152 Ga0496121_0148583 3300048924 Bacteria 1728
153 Ga0496121_0229325 3300048924 Bacteria 1302
154 Ga0496122_0015507 3300048925 Bacteria 7280
155 Ga0496122_0025827 3300048925 Bacteria 5086
156 Ga0496122_0026890 3300048925 Bacteria 4940
157 Ga0496122_0030107 3300048925 Bacteria 4557
158 Ga0496122_0038796 3300048925 Bacteria 3808
159 Ga0496122_0055149 3300048925 Bacteria 2977
160 Ga0496123_0003989 3300048926 Bacteria 15979
161 Ga0496124_0000824 3300048927 Bacteria 50533
162 Ga0496124_0061239 3300048927 Bacteria 3155
163 Ga0496124_0178419 3300048927 Bacteria 1637
164 Ga0496124_0342594 3300048927 Bacteria 1061
165 Ga0496125_0001505 3300048928 Bacteria 33373
166 Ga0496125_0002758 3300048928 Bacteria 22227
167 Ga0496125_0005637 3300048928 Bacteria 13821
168 Ga0496125_0011036 3300048928 Bacteria 9067
169 Ga0496126_0001009 3300048929 Bacteria 47959
170 Ga0496126_0001355 3300048929 Bacteria 38841
171 Ga0496126_0003247 3300048929 Bacteria 20777
172 Ga0501306_008019 3300049127 Bacteria 1279
173 Ga0501341_00197 3300049131 Bacteria 2179
174 Ga0501341_01170 3300049131 Bacteria 1270
175 Ga0501343_001188 3300049132 Bacteria 1720
176 Ga0501305_001606 3300049161 Bacteria 2256
177 Ga0501305_004964 3300049161 Bacteria 1590
178 Ga0501305_009808 3300049161 Bacteria 1266
179 Ga0501311_000378 3300049527 Bacteria 3008
180 Ga0501312_004500 3300049528 Bacteria 1647
181 Ga0501312_004511 3300049528 Bacteria 1647
182 Ga0501312_010251 3300049528 Bacteria 1251
183 Ga0501313_006586 3300049529 Bacteria 1262
184 Ga0501313_008548 3300049529 Bacteria 1141
185 Ga0501315_006473 3300049531 Bacteria 1305
186 Ga0501315_007167 3300049531 Bacteria 1264
187 Ga0501316_000880 3300049532 Bacteria 2330
188 Ga0501317_002906 3300049533 Bacteria 1664
189 Ga0501318_002178 3300049534 Bacteria 1663
190 Ga0501318_010474 3300049534 Bacteria 1029
191 Ga0501331_00958 3300049547 Bacteria 1322
192 Ga0501332_00403 3300049548 Bacteria 1847
193 Ga0501333_000606 3300049549 Bacteria 1711
194 Ga0501333_001397 3300049549 Bacteria 1297
195 Ga0501334_00347 3300049550 Bacteria 2033
196 Ga0501334_02581 3300049550 Bacteria 1082
197 Ga0501335_000674 3300049551 Bacteria 2320
198 Ga0501335_004288 3300049551 Bacteria 1241
199 Ga0501335_004662 3300049551 Bacteria 1205
200 Ga0501336_000483 3300049552 Bacteria 1980
201 Ga0501337_002142 3300049553 Bacteria 1187
202 Ga0501338_00362 3300049554 Bacteria 1977
203 Ga0500566_0001924 3300053094 Bacteria 12211
204 Ga0500637_0007063 3300053178 Bacteria 5592
205 Ga0500637_0012448 3300053178 Bacteria 4434
206 2511176757 2510917027 Bacteria 5287437
207 2511701224 2511231119 Bacteria 4019861
208 2512636566 2512564013 Bacteria 6286191
209 2512729603 2512564039 Bacteria 8739048
210 2524191928 2524023129 Bacteria 6762600
211 2540608419 2540341094 Bacteria 4061186
212 2545558848 2545555800 Bacteria 4222588
213 2553396153 2551306519 Bacteria 5465154
214 2555468382 2554235283 Bacteria 3683090
215 2556064854 2554235469 Bacteria 3590176
216 2563929079 2563366752 Bacteria 4961801
217 2571533413 2571042143 Bacteria 6986194
218 2573037260 2571042588 Bacteria 5045676
219 2578334647 2576861424 Bacteria 5270569
220 2578933301 2576861599 Bacteria 4217202
221 2580933031 2579778775 Bacteria 5360914
222 2587741899 2585428059 Bacteria 8696589
223 2595090509 2593339131 Bacteria 5116855
224 2595318728 2593339198 Bacteria 7267884
225 2600199519 2599185353 Bacteria 2219443
226 2600402461 2600254943 Bacteria 2613887
227 2601445311 2600255229 Bacteria 1988965
228 2601640940 2600255286 Bacteria 5390125
229 2621272678 2619619294 Bacteria 5575484
230 2631983473 2630968484 Bacteria 3876276
231 2643737571 2643221543 Bacteria 6628015
232 2644422618 2643221676 Bacteria 8119172
233 2644707275 2643221729 Bacteria 6621700
234 2644714232 2643221730 Bacteria 6523787
235 2644720359 2643221731 Bacteria 5623886
236 2644726557 2643221732 Bacteria 5756404
237 2644738808 2643221735 Bacteria 3676263
238 2651530836 2648501850 Bacteria 3975476
239 2672338527 2671180330 Bacteria 5521719
240 2673820511 2671180694 Bacteria 7506943
241 2674421844 2671180844 Bacteria 4164150
242 2685153106 2684622632 Bacteria 5380049
243 2686998532 2684623153 Bacteria 3878815
244 2687499805 2687453109 Bacteria 3860091
245 2695629174 2695420354 Bacteria 3922431
246 2698320084 2695420987 Bacteria 6152737
247 2705997032 2703719227 Bacteria 5631989
248 2712197860 2711768088 Bacteria 3195027
249 2717915120 2716884898 Bacteria 3928789
250 2721508260 2718218445 Bacteria 5113413
251 2723601517 2721755693 Bacteria 6126117
252 2728532035 2728368933 Bacteria 7044283
253 2730137640 2728369359 Bacteria 5621728
254 2738815420 2738541295 Bacteria 5730091
255 2738838125 2738541299 Bacteria 4020721
256 2739157121 2738541358 Bacteria 5932299
257 2739209129 2738543006 Bacteria 5904091
258 2739269721 2738543017 Bacteria 4271950
259 2745165927 2744054657 Bacteria 5016802
260 2753811273 2751185905 Bacteria 6142767
261 2757567256 2757320391 Bacteria 4746095
262 2777761752 2775507177 Bacteria 4384303
263 2777837756 2775507192 Bacteria 4622234
264 2791215204 2788500588 Bacteria 4584915
265 2793181813 2791355222 Bacteria 5898266
266 2802440492 2802428803 Bacteria 5806948
267 2808870286 2808606364 Bacteria 4465927
268 2809053558 2808606399 Bacteria 4021018
269 2812317668 2811994870 Bacteria 3776934
270 2816865534 2816332186 Bacteria 5331395
271 2817481811 2816332295 Bacteria 4352468
272 2817620718 2816332336 Bacteria 5207640
273 2819571349 2818991441 Bacteria 5062707
274 2819582398 2818991443 Bacteria 6598732
275 2819628220 2818991451 Bacteria 4697364
276 2819675472 2818991459 Bacteria 8736032
277 2819711141 2818991465 Bacteria 5388835
278 2819722721 2818991468 Bacteria 3723169
279 2821118034 2821111986 Bacteria 6894338
280 2823529741 2823526263 Bacteria 3765752
281 2831908568 2831905167 Bacteria 3319172
282 2842686508 2842682962 Bacteria 5589973
283 2842886298 2842882022 Bacteria 6158489
284 2849143379 2849139964 Bacteria 5613304
285 2852676896 2852673933 Bacteria 3347676
286 2857459625 2857453340 Bacteria 8090534
287 2857463168 2857460504 Bacteria 5194327
288 2857471554 2857465823 Bacteria 6772595
289 2857478089 2857472729 Bacteria 6568124
290 2857583336 2857581216 Bacteria 5522813
291 2857589403 2857586860 Bacteria 4354574
292 2857597254 2857591370 Bacteria 6569758
293 2857606386 2857604169 Bacteria 5111450
294 2857609993 2857609550 Bacteria 3753890
295 2860841220 2860837431 Bacteria 4202080
296 2864739476 2864733723 Bacteria 6770668
297 2865002332 2864997549 Bacteria 5139696
298 2865008045 2865002811 Bacteria 6333767
299 2877772109 2877768649 Bacteria 3957164
300 2880172947 2880169592 Bacteria 3900066
301 2881641382 2881636855 Bacteria 5205297
302 2881645997 2881644220 Bacteria 5302661
303 2885529958 2885526491 Bacteria 7164189
304 2888579204 2888578766 Bacteria 6743310
305 2889042600 2889042446 Bacteria 7618936
306 2889052262 2889049205 Bacteria 7524325
307 2889277610 2889276214 Bacteria 5979355
308 2889299463 2889295896 Bacteria 4704906
309 2897113229 2897109615 Bacteria 4009619
310 2898911053 2898907183 Bacteria 4067722
311 2904119796 2904113452 Bacteria 7796941
312 2904167146 2904162308 Bacteria 7086713
313 2904496589 2904490793 Bacteria 7046938
314 2904528712 2904524088 Bacteria 5887454
315 2904561551 2904560550 Bacteria 4029838
316 2904599891 2904595352 Bacteria 6124848
317 2904610416 2904606771 Bacteria 4684500
318 2904761713 2904755435 Bacteria 7986759
319 2907208255 2907202186 Bacteria 6632024
320 2908667006 2908665501 Bacteria 3678115
321 2915597707 2915597211 Bacteria 6475886
322 2915610727 2915606848 Bacteria 6032732
323 2916975291 2916971899 Bacteria 4250608
324 2919094978 2919093281 Bacteria 3660974
325 2919148343 2919143609 Bacteria 6219228
326 2919165746 2919160200 Bacteria 6929020
327 2919416176 2919414237 Bacteria 5429133
328 2919430071 2919425241 Bacteria 8055701
329 2919521890 2919517244 Bacteria 5858162
330 2919725022 2919720352 Bacteria 5986006
331 2919727554 2919726948 Bacteria 3696050
332 2925333575 2925326138 Bacteria 9652120
333 2928098313 2928093941 Bacteria 5965005
334 2928514860 2928510474 Bacteria 4815308
335 2929007744 2929004312 Bacteria 5678476
336 2929189211 2929183550 Bacteria 6377511
337 2929207184 2929206907 Bacteria 5918291
338 2929238823 2929233124 Bacteria 5948380
339 2931386025 2931384279 Bacteria 7299545
340 2936344739 2936340661 Bacteria 5139038
341 2936362552 2936361878 Bacteria 5632809
342 2938651666 2938649242 Bacteria 7118381
343 2938923043 2938917290 Bacteria 5914775
344 2939596086 2939593269 Bacteria 4798695
345 2939617559 2939615513 Bacteria 2384962
346 2939684283 2939679117 Bacteria 6921672
347 2939706236 2939702853 Bacteria 5139229
348 2945995367 2945991243 Bacteria 7008369
349 2946058070 2946053406 Bacteria 6978655
350 2947431908 2947426588 Bacteria 5357194
351 2954776826 2954773129 Bacteria 3741715
352 2956900001 2956897341 Bacteria 5447711
353 2960321280 2960319331 Bacteria 5502575
354 2960378551 2960375949 Bacteria 5361395
355 2962294450 2962290636 Bacteria 4072939
356 2964376323 2964375228 Bacteria 4909004
357 2965766439 2965761152 Bacteria 5806513
358 2968564640 2968558590 Bacteria 6956864
359 2969140413 2969136845 Bacteria 3923176
360 2969144668 2969141011 Bacteria 4118468
361 2969768796 2969765954 Bacteria 4216713
362 2969771131 2969770375 Bacteria 4271280
363 2971410151 2971403814 Bacteria 7370929
364 2971412739 2971410472 Bacteria 8311090
365 2971513738 2971511577 Bacteria 5404012
366 2971896791 2971893375 Bacteria 3929648
367 2977255903 2977254563 Bacteria 4828420
368 2979088816 2979083700 Bacteria 5894929
369 2980130470 2980125574 Bacteria 5567337
370 2980178463 2980176882 Bacteria 5397533
371 2980186532 2980182181 Bacteria 9454109
372 2980496206 2980492589 Bacteria 4072961
373 2981288564 2981284811 Bacteria 4641497
374 2981293386 2981289755 Bacteria 4641509
375 2981984375 2981980479 Bacteria 4641628
376 2981989103 2981985349 Bacteria 4641497
377 2984532079 2984527788 Bacteria 5288478
378 2984533335 2984532647 Bacteria 5288506
379 2988226611 2988225383 Bacteria 7221625
380 2990276727 2990275345 Bacteria 4887158
381 2996639180 2996632988 Bacteria 6921523
382 2996710498 2996706504 Bacteria 5757485
383 3001269192 3001267043 Bacteria 4823521
384 3001274597 3001272096 Bacteria 4729684
385 3001895142 3001892409 Bacteria 6328293
386 3006862242 3006858327 Bacteria 4317835
387 3006882938 3006879489 Bacteria 4064221
388 3006971463 3006969106 Bacteria 4739423
389 3006976570 3006973921 Bacteria 4423788
390 3006986931 3006984091 Bacteria 4207523
391 3006991402 3006988479 Bacteria 4767936
392 648168095 648028048 Bacteria 5394884
393 8002321730 8002317523 Bacteria 8051857
394 8022626613 8022621104 Bacteria 5241040
395 8022633369 8022630665 Bacteria 3886130
396 8022657251 8022653035 Bacteria 4035078
397 8022797725 8022792930 Bacteria 5693794
398 8022894330 8022893055 Bacteria 5300455
399 8022918559 8022914991 Bacteria 5584517
400 8022953354 8022948649 Bacteria 5366783
401 8023441248 8023438354 Bacteria 5779374
402 8023448820 8023444577 Bacteria 5661597
403 8051954276 8051952484 Bacteria 3926774
404 8052175643 8052174270 Bacteria 3881265
405 8054282140 8054280661 Bacteria 4232245
406 8054471995 8054465665 Bacteria 7323556
407 8054801943 8054795415 Bacteria 9785225
408 8055536329 8055531788 Bacteria 5249694
409 8056536136 8056533031 Bacteria 8964429
410 8057477660 8057473075 Bacteria 5892720
411 8057587557 8057582654 Bacteria 5218944
412 8057636310 8057632132 Bacteria 4726859
413 8057735927 8057733483 Bacteria 6578323
414 8057980069 8057977335 Bacteria 5694872
415 Ga0209130_1000339
416 JGI25162J39368_1005128
417 JGI25159J45721_1002767
418 JGI25159J45721_1005829
419 JGI25151J46595_10000011
420 JGI25151J46595_10001861
421 JGI25151J46595_10006225
422 JGI25151J46595_10007348
423 JGI25151J46595_10008597
424 JGI25151J46595_10008657
425 rootH1_10013587
426 rootH2_10105181
427 rootL2_10016501
428 rootH1_10160187
429 Ga0006562J51391_1001534
430 Ga0006562J51391_1003264
431 Ga0055538_1000291
432 Ga0055538_1000550
433 Ga0055538_1000561
434 Ga0055532_1000052
435 Ga0055532_1000098
436 Ga0055532_1000617
437 Ga0055532_1010532
438 Ga0055536_1025189
439 Ga0055541_1000555
440 Ga0070670_100105771
441 Ga0070669_100048321
442 Ga0070671_100006848
443 Ga0068864_100315887
444 Ga0105251_10004686
445 Ga0105244_10026670
446 Ga0105244_10043290
447 Ga0105250_10000615
448 Ga0105245_10087829
449 Ga0105243_10003566
450 Ga0105243_10043119
451 Ga0105246_10001390
452 Ga0105246_10001625
453 Ga0105246_10009165
454 Ga0105246_10268372
455 Ga0157371_10019406
456 Ga0157372_10152007
457 Ga0157376_10023701
458 Ga0209784_100107
459 Ga0209784_100178
460 Ga0209566_100086
461 Ga0209566_100912
462 Ga0209566_100961
463 Ga0209147_100028
464 Ga0209147_100101
465 Ga0209147_101278
466 Ga0209147_102136
467 Ga0209437_101119
468 Ga0209130_1002533
469 Ga0209130_1002658
470 Ga0209130_1013575
471 Ga0209676_1000844
472 Ga0209676_1001922
473 Ga0209676_1011083
474 Ga0209676_1018081
475 Ga0209676_1021432
476 Ga0209025_1000011
477 Ga0209025_1000095
478 Ga0209025_1001238
479 Ga0209025_1001570
480 Ga0209025_1002884
481 Ga0209025_1003178
482 Ga0209025_1003372
483 Ga0209025_1004777
484 Ga0209025_1005514
485 Ga0209025_1006940
486 Ga0209025_1008125
487 Ga0209025_1008227
488 Ga0209025_1016995
489 Ga0209025_1026201
490 Ga0207426_1021189
491 Ga0207696_1004066
492 Ga0207655_1001622
493 Ga0207655_1011164
494 Ga0207655_1029055
495 Ga0207713_1005814
496 Ga0207713_1028013
497 Ga0207713_1047914
498 Ga0207713_1054595
499 Ga0207710_10078316
500 Ga0207650_10099116
501 Ga0207659_10095381
502 Ga0207687_10251624
503 Ga0207709_10001045
504 Ga0237817_10173
505 Ga0237817_10597
506 Ga0307408_100063823
507 Ga0307409_100057980
508 Ga0307416_100121051
509 Ga0395899_0032917
510 Ga0395899_0132940
511 Ga0237819_00080
512 Ga0237819_00905
513 Ga0439439_0000419
514 Ga0439433_0006023
515 Ga0439449_0000519
516 Ga0439449_0014796
517 Ga0439457_008337
518 Ga0466969_0002462
519 Ga0466961_0007065
520 Ga0466968_0005722
521 Ga0466957_0272414
522 Ga0466959_0023386
523 Ga0466967_0000147
524 Ga0495590_0021536
525 Ga0495683_0015065
526 Ga0496100_0005657
527 Ga0496101_0001500
528 Ga0496102_0003848
529 Ga0496103_0006336
530 Ga0496104_0000326
531 Ga0496105_0000211
532 Ga0496106_0128884
533 Ga0496107_0001565
534 Ga0496108_0004293
535 Ga0496108_0157756
536 Ga0496109_0000350
537 Ga0496110_0003822
538 Ga0496110_0110145
539 Ga0496111_0087102
540 Ga0496112_0000432
541 Ga0496112_0081144
542 Ga0496113_0069719
543 Ga0496116_0012261
544 Ga0496116_0013030
545 Ga0496116_0018809
546 Ga0496116_0034163
547 Ga0496116_0044984
548 Ga0496116_0058077
549 Ga0496116_0070439
550 Ga0496117_0000087
551 Ga0496117_0018347
552 Ga0496117_0037328
553 Ga0496117_0042807
554 Ga0496118_0097562
555 Ga0496118_0109572
556 Ga0496119_0000331
557 Ga0496119_0001771
558 Ga0496119_0027184
559 Ga0496120_0000298
560 Ga0496120_0024792
561 Ga0496120_0061406
562 Ga0496121_0042383
563 Ga0496121_0072057
564 Ga0496121_0073062
565 Ga0496121_0148583
566 Ga0496121_0229325
567 Ga0496122_0015507
568 Ga0496122_0025827
569 Ga0496122_0026890
570 Ga0496122_0030107
571 Ga0496122_0038796
572 Ga0496122_0055149
573 Ga0496123_0003989
574 Ga0496124_0000824
575 Ga0496124_0061239
576 Ga0496124_0178419
577 Ga0496124_0342594
578 Ga0496125_0001505
579 Ga0496125_0002758
580 Ga0496125_0005637
581 Ga0496125_0011036
582 Ga0496126_0001009
583 Ga0496126_0001355
584 Ga0496126_0003247
585 Ga0501306_008019
586 Ga0501341_00197
587 Ga0501341_01170
588 Ga0501343_001188
589 Ga0501305_001606
590 Ga0501305_004964
591 Ga0501305_009808
592 Ga0501311_000378
593 Ga0501312_004500
594 Ga0501312_004511
595 Ga0501312_010251
596 Ga0501313_006586
597 Ga0501313_008548
598 Ga0501315_006473
599 Ga0501315_007167
600 Ga0501316_000880
601 Ga0501317_002906
602 Ga0501318_002178
603 Ga0501318_010474
604 Ga0501331_00958
605 Ga0501332_00403
606 Ga0501333_000606
607 Ga0501333_001397
608 Ga0501334_00347
609 Ga0501334_02581
610 Ga0501335_000674
611 Ga0501335_004288
612 Ga0501335_004662
613 Ga0501336_000483
614 Ga0501337_002142
615 Ga0501338_00362
616 Ga0500566_0001924
617 Ga0500637_0007063
618 Ga0500637_0012448
619 2511176757
620 2511701224
621 2512636566
622 2512729603
623 2524191928
624 2540608419
625 2545558848
626 2553396153
627 2555468382
628 2556064854
629 2563929079
630 2571533413
631 2573037260
632 2578334647
633 2578933301
634 2580933031
635 2587741899
636 2595090509
637 2595318728
638 2600199519
639 2600402461
640 2601445311
641 2601640940
642 2621272678
643 2631983473
644 2643737571
645 2644422618
646 2644707275
647 2644714232
648 2644720359
649 2644726557
650 2644738808
651 2651530836
652 2672338527
653 2673820511
654 2674421844
655 2685153106
656 2686998532
657 2687499805
658 2695629174
659 2698320084
660 2705997032
661 2712197860
662 2717915120
663 2721508260
664 2723601517
665 2728532035
666 2730137640
667 2738815420
668 2738838125
669 2739157121
670 2739209129
671 2739269721
672 2745165927
673 2753811273
674 2757567256
675 2777761752
676 2777837756
677 2791215204
678 2793181813
679 2802440492
680 2808870286
681 2809053558
682 2812317668
683 2816865534
684 2817481811
685 2817620718
686 2819571349
687 2819582398
688 2819628220
689 2819675472
690 2819711141
691 2819722721
692 2821118034
693 2823529741
694 2831908568
695 2842686508
696 2842886298
697 2849143379
698 2852676896
699 2857459625
700 2857463168
701 2857471554
702 2857478089
703 2857583336
704 2857589403
705 2857597254
706 2857606386
707 2857609993
708 2860841220
709 2864739476
710 2865002332
711 2865008045
712 2877772109
713 2880172947
714 2881641382
715 2881645997
716 2885529958
717 2888579204
718 2889042600
719 2889052262
720 2889277610
721 2889299463
722 2897113229
723 2898911053
724 2904119796
725 2904167146
726 2904496589
727 2904528712
728 2904561551
729 2904599891
730 2904610416
731 2904761713
732 2907208255
733 2908667006
734 2915597707
735 2915610727
736 2916975291
737 2919094978
738 2919148343
739 2919165746
740 2919416176
741 2919430071
742 2919521890
743 2919725022
744 2919727554
745 2925333575
746 2928098313
747 2928514860
748 2929007744
749 2929189211
750 2929207184
751 2929238823
752 2931386025
753 2936344739
754 2936362552
755 2938651666
756 2938923043
757 2939596086
758 2939617559
759 2939684283
760 2939706236
761 2945995367
762 2946058070
763 2947431908
764 2954776826
765 2956900001
766 2960321280
767 2960378551
768 2962294450
769 2964376323
770 2965766439
771 2968564640
772 2969140413
773 2969144668
774 2969768796
775 2969771131
776 2971410151
777 2971412739
778 2971513738
779 2971896791
780 2977255903
781 2979088816
782 2980130470
783 2980178463
784 2980186532
785 2980496206
786 2981288564
787 2981293386
788 2981984375
789 2981989103
790 2984532079
791 2984533335
792 2988226611
793 2990276727
794 2996639180
795 2996710498
796 3001269192
797 3001274597
798 3001895142
799 3006862242
800 3006882938
801 3006971463
802 3006976570
803 3006986931
804 3006991402
805 648168095
806 8002321730
807 8022626613
808 8022633369
809 8022657251
810 8022797725
811 8022894330
812 8022918559
813 8022953354
814 8023441248
815 8023448820
816 8051954276
817 8052175643
818 8054282140
819 8054471995
820 8054801943
821 8055536329
822 8056536136
823 8057477660
824 8057587557
825 8057636310
826 8057735927
827 8057980069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07475

Hpr_kinase_C

HPr Serine kinase C-terminal domain

175

345

0.99

PF02603

Hpr_kinase_N

HPr Serine kinase N terminus

50

173

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qmh-assembly2.cif.gz_J structure of v267f mutant hprk/p 0.9437 134 309
1kkl-assembly1.cif.gz_B-2 l.casei hprk/p in complex with b.subtilis hpr 0.9416 134 304
3tqf-assembly2.cif.gz_B structure of the hpr(ser) kinase/phosphatase from coxiella burnetii 0.9376 136 288
2qmh-assembly2.cif.gz_J structure of v267f mutant hprk/p 0.9285 134 309
1kkm-assembly1.cif.gz_B l.casei hprk/p in complex with b.subtilis p-ser-hpr 0.9258 134 309
ID Description Score Start End Superfamily
1ko7A01 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;HprK N-terminal domain-like 0.9708 5 132 3.40.1390.20
1ko7A01 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;HprK N-terminal domain-like 0.9562 5 132 3.40.1390.20
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9348 136 287 3.40.50.300
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9165 136 287 3.40.50.300
2qmhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9105 134 304 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A317YKF1-F1-model_v4 HPr kinase/phosphorylase 0.9936 138 223 GO:0000155
GO:0005524
GO:0006109
AF-A0A661J1U8-F1-model_v4 HPr kinase/phosphorylase 0.988 133 217 GO:0000155
GO:0005524
GO:0006109
AF-A0A5N9VWD7-F1-model_v4 deleted 0.9866 5 115
AF-A0A3D3FJ41-F1-model_v4 HPr kinase/phosphorylase 0.984 132 271 GO:0000155
GO:0005524
GO:0006109
AF-A0A7D7PVF7-F1-model_v4 HPr kinase/phosphorylase (EC 2.7.1.-, EC 2.7.4.-) 0.9795 138 240 GO:0000155
GO:0005524
GO:0006109

Map