F438098

General Info

Members Datasets Scaffolds Average Seq Length
413 296 392 142

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10089494|Ga0307509_100894943
Length 137
Sequence VSIDWNAFTPWPALAGGILIGAAVGMFALLNGRIAGISGVLGGLLRPTRGDIAWRAAFVIGLVAAPIVYALFAAWPALQVGIAGLLVGIGTRYGSGCTSGHGVCGISRLSPRSLVATAVFMAAGFATVFVLRHLFSA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2643221656 Pelomonas sp. Root405 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
12 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
13 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
14 2816332133 Acidovorax radicis 2721A Isolate Unclassified
15 2818991436 Collimonas arenae 515 Isolate Unclassified
16 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
17 2885198086 Variovorax sp. 679 Isolate Unclassified
18 2885211737 Variovorax sp. 553 Isolate Unclassified
19 2928070936 Variovorax gossypii 1167 Isolate Unclassified
20 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
172 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
173 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
204 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
205 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
296 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.24
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.11
Nodule 0
Rhizoplane 2.18
Rhizosphere 74.82
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1030708 3300002705 Bacteria 806
2 JGI25156J39149_1030732 3300002705 Bacteria 806
3 JGI25157J39369_1009102 3300002741 Bacteria 1350
4 JGI25151J46595_10002668 3300003187 Bacteria 10460
5 JGI25160J50197_1000158 3300003354 Bacteria 58363
6 JGI25161J50226_1000040 3300003374 Bacteria 124804
7 Ga0055529_1005168 3300003763 Bacteria 1915
8 Ga0055536_1000891 3300003781 Bacteria 19442
9 Ga0055530_10019470 3300003791 Bacteria 2055
10 Ga0055540_1001142 3300003792 Bacteria 16576
11 Ga0055531_10000572 3300003794 Bacteria 32155
12 Ga0055531_10008702 3300003794 Bacteria 5303
13 Ga0055543_1000167 3300004625 Bacteria 54995
14 Ga0065165_1003807 3300005262 Bacteria 10071
15 Ga0065714_10065223 3300005288 Bacteria 11706
16 Ga0070658_10619935 3300005327 Bacteria 938
17 Ga0070658_10683956 3300005327 Bacteria 890
18 Ga0070676_10000533 3300005328 Bacteria 18336
19 Ga0070690_101122517 3300005330 Bacteria 624
20 Ga0070670_100063792 3300005331 Bacteria 3161
21 Ga0070677_10000086 3300005333 Bacteria 29743
22 Ga0068869_100100441 3300005334 Bacteria 2188
23 Ga0070666_10000649 3300005335 Bacteria 20972
24 Ga0068868_100010067 3300005338 Bacteria 6831
25 Ga0070668_100004498 3300005347 Bacteria 10342
26 Ga0070669_100005531 3300005353 Bacteria 9119
27 Ga0070669_100048164 3300005353 Bacteria 3110
28 Ga0070675_100001757 3300005354 Bacteria 15981
29 Ga0070671_100000747 3300005355 Bacteria 23296
30 Ga0070671_100254071 3300005355 Bacteria 1493
31 Ga0070673_100000680 3300005364 Bacteria 18748
32 Ga0070673_100358868 3300005364 Bacteria 1295
33 Ga0070659_100130718 3300005366 Bacteria 2039
34 Ga0070667_100030456 3300005367 Bacteria 4501
35 Ga0070667_100161280 3300005367 Bacteria 1975
36 Ga0070667_100460722 3300005367 Bacteria 1162
37 Ga0070667_100810683 3300005367 Bacteria 869
38 Ga0070663_100005106 3300005455 Bacteria 7765
39 Ga0070663_100018195 3300005455 Bacteria 4600
40 Ga0070663_100055204 3300005455 Bacteria 2842
41 Ga0070663_100139815 3300005455 Bacteria 1847
42 Ga0070678_100000617 3300005456 Bacteria 17415
43 Ga0070662_100013661 3300005457 Bacteria 5406
44 Ga0070662_100120907 3300005457 Bacteria 2007
45 Ga0070662_100371986 3300005457 Bacteria 1175
46 Ga0068867_100017256 3300005459 Bacteria 5127
47 Ga0068853_100008223 3300005539 Bacteria 8373
48 Ga0068853_100030372 3300005539 Bacteria 4564
49 Ga0070672_100032926 3300005543 Bacteria 3919
50 Ga0070665_100010811 3300005548 Bacteria 9230
51 Ga0068855_100000046 3300005563 Bacteria 147225
52 Ga0068855_100146708 3300005563 Bacteria 2685
53 Ga0068855_101288035 3300005563 Bacteria 757
54 Ga0070664_100124589 3300005564 Bacteria 2259
55 Ga0070664_100240844 3300005564 Bacteria 1624
56 Ga0068857_100042095 3300005577 Bacteria 4051
57 Ga0068857_100075627 3300005577 Bacteria 3002
58 Ga0068854_100068921 3300005578 Bacteria 2581
59 Ga0068852_100002210 3300005616 Bacteria 13355
60 Ga0068852_100083549 3300005616 Bacteria 2839
61 Ga0068864_100009116 3300005618 Bacteria 8180
62 Ga0068861_100049189 3300005719 Bacteria 3191
63 Ga0068851_10003577 3300005834 Bacteria 6924
64 Ga0068851_10140916 3300005834 Bacteria 1311
65 Ga0068870_10003300 3300005840 Bacteria 6822
66 Ga0068863_100008452 3300005841 Bacteria 10053
67 Ga0068858_100073281 3300005842 Bacteria 3179
68 Ga0068860_100276958 3300005843 Bacteria 1639
69 Ga0068862_100265468 3300005844 Bacteria 1568
70 Ga0075365_10002815 3300006038 Bacteria 8710
71 Ga0075363_100126416 3300006048 Bacteria 1432
72 Ga0075364_10023309 3300006051 Bacteria 3918
73 Ga0075364_10165883 3300006051 Bacteria 1492
74 Ga0075432_10001426 3300006058 Bacteria 7784
75 Ga0075432_10010013 3300006058 Bacteria 3220
76 Ga0075432_10043844 3300006058 Bacteria 1568
77 Ga0075362_10023506 3300006177 Bacteria 2607
78 Ga0075367_10007127 3300006178 Bacteria 5702
79 Ga0075369_10091665 3300006186 Bacteria 1357
80 Ga0075366_10383290 3300006195 Bacteria 865
81 Ga0097621_100003500 3300006237 Bacteria 10839
82 Ga0097621_100157537 3300006237 Bacteria 1950
83 Ga0075370_10002190 3300006353 Bacteria 8971
84 Ga0068871_100215722 3300006358 Bacteria 1661
85 Ga0068871_100237916 3300006358 Bacteria 1582
86 Ga0068871_100458512 3300006358 Bacteria 1144
87 Ga0075433_10886380 3300006852 Bacteria 778
88 Ga0075434_101065855 3300006871 Bacteria 822
89 Ga0068865_100247756 3300006881 Bacteria 1405
90 Ga0075436_100035233 3300006914 Bacteria 3453
91 Ga0105244_10003614 3300009036 Bacteria 10973
92 Ga0105244_10003980 3300009036 Bacteria 10353
93 Ga0105240_10739375 3300009093 Bacteria 1070
94 Ga0105240_11360048 3300009093 Bacteria 747
95 Ga0105245_10233506 3300009098 Bacteria 1780
96 Ga0105243_10000045 3300009148 Bacteria 156620
97 Ga0105243_10006191 3300009148 Bacteria 9254
98 Ga0105243_10014028 3300009148 Bacteria 6065
99 Ga0105243_11580795 3300009148 Bacteria 682
100 Ga0105241_10060994 3300009174 Bacteria 2903
101 Ga0105242_10185050 3300009176 Bacteria 1840
102 Ga0105237_10002758 3300009545 Bacteria 21357
103 Ga0105239_10099339 3300010375 Bacteria 3218
104 Ga0105239_10102223 3300010375 Bacteria 3172
105 Ga0105246_10295177 3300011119 Bacteria 1306
106 Ga0157373_10213049 3300013100 Bacteria 1362
107 Ga0157373_10701952 3300013100 Bacteria 741
108 Ga0157370_10130691 3300013104 Bacteria 2342
109 Ga0157369_10982099 3300013105 Bacteria 865
110 Ga0157374_10011589 3300013296 Bacteria 7643
111 Ga0157374_11546101 3300013296 Unclassified 687
112 Ga0157378_10153075 3300013297 Bacteria 2150
113 Ga0163162_10502591 3300013306 Bacteria 1343
114 Ga0157372_11716353 3300013307 Bacteria 722
115 Ga0157375_10002391 3300013308 Bacteria 16241
116 Ga0163163_10355021 3300014325 Bacteria 1522
117 Ga0157380_11781378 3300014326 Bacteria 675
118 Ga0182008_10002573 3300014497 Bacteria 11282
119 Ga0182008_10514227 3300014497 Bacteria 660
120 Ga0157377_10487764 3300014745 Bacteria 859
121 Ga0157379_11440832 3300014968 Bacteria 668
122 Ga0157376_10136817 3300014969 Bacteria 2193
123 Ga0182006_1003139 3300015261 Bacteria 8647
124 Ga0182007_10001099 3300015262 Bacteria 14701
125 Ga0182007_10023243 3300015262 Bacteria 2181
126 Ga0182007_10053185 3300015262 Bacteria 1333
127 Ga0182005_1000238 3300015265 Bacteria 35328
128 Ga0182005_1106527 3300015265 Bacteria 789
129 Ga0182005_1245943 3300015265 Bacteria 552
130 Ga0163161_10027245 3300017792 Bacteria 4053
131 Ga0163161_10732302 3300017792 Bacteria 826
132 Ga0206353_10762290 3300020082 Bacteria 2982
133 Ga0209436_100621 3300025208 Bacteria 15167
134 Ga0209646_1001128 3300025246 Bacteria 7861
135 Ga0209026_1000153 3300025250 Bacteria 109259
136 Ga0209026_1024665 3300025250 Bacteria 910
137 Ga0209759_1003490 3300025256 Bacteria 6239
138 Ga0209759_1006687 3300025256 Bacteria 3830
139 Ga0209455_1000151 3300025272 Bacteria 129842
140 Ga0209130_1000042 3300025284 Bacteria 257581
141 Ga0209676_1000385 3300025292 Bacteria 81044
142 Ga0209676_1000873 3300025292 Bacteria 38608
143 Ga0209758_1005683 3300025297 Bacteria 9428
144 Ga0209050_1001437 3300025298 Bacteria 25610
145 Ga0209050_1004842 3300025298 Bacteria 8836
146 Ga0209050_1014012 3300025298 Bacteria 3499
147 Ga0207426_1000097 3300025302 Bacteria 265930
148 Ga0209051_1000137 3300025303 Bacteria 137784
149 Ga0209051_1000773 3300025303 Bacteria 33955
150 Ga0209257_1000205 3300025304 Bacteria 143735
151 Ga0209257_1002601 3300025304 Bacteria 17505
152 Ga0207656_10150178 3300025321 Bacteria 1103
153 Ga0207655_1000085 3300025728 Bacteria 206425
154 Ga0207655_1004192 3300025728 Bacteria 10342
155 Ga0207682_10000817 3300025893 Bacteria 14404
156 Ga0207680_10045021 3300025903 Bacteria 2599
157 Ga0207647_10226276 3300025904 Bacteria 1077
158 Ga0207645_10003482 3300025907 Bacteria 11922
159 Ga0207645_10563160 3300025907 Bacteria 773
160 Ga0207643_10197171 3300025908 Bacteria 1225
161 Ga0207705_10579930 3300025909 Bacteria 872
162 Ga0207705_10615889 3300025909 Bacteria 844
163 Ga0207695_10023730 3300025913 Bacteria 6922
164 Ga0207695_10171289 3300025913 Bacteria 2096
165 Ga0207671_10020242 3300025914 Bacteria 5068
166 Ga0207681_10024807 3300025923 Bacteria 3850
167 Ga0207681_10049562 3300025923 Bacteria 2839
168 Ga0207694_10088104 3300025924 Bacteria 2446
169 Ga0207650_10203675 3300025925 Bacteria 1586
170 Ga0207659_10002562 3300025926 Bacteria 10815
171 Ga0207687_10052220 3300025927 Bacteria 2852
172 Ga0207644_10027270 3300025931 Bacteria 3945
173 Ga0207644_10034714 3300025931 Bacteria 3531
174 Ga0207690_10427425 3300025932 Bacteria 1061
175 Ga0207706_10021246 3300025933 Bacteria 5831
176 Ga0207706_10201270 3300025933 Bacteria 1747
177 Ga0207706_10220087 3300025933 Bacteria 1662
178 Ga0207686_10335028 3300025934 Bacteria 1135
179 Ga0207709_10000011 3300025935 Bacteria 552881
180 Ga0207709_10000497 3300025935 Bacteria 35233
181 Ga0207709_10069462 3300025935 Bacteria 2230
182 Ga0207704_10288725 3300025938 Bacteria 1250
183 Ga0207691_10000384 3300025940 Bacteria 44354
184 Ga0207691_10585792 3300025940 Bacteria 945
185 Ga0207689_10145848 3300025942 Bacteria 1950
186 Ga0207689_10365042 3300025942 Bacteria 1201
187 Ga0207679_10032090 3300025945 Bacteria 3683
188 Ga0207679_10149898 3300025945 Bacteria 1896
189 Ga0207667_10000036 3300025949 Bacteria 297966
190 Ga0207667_10024812 3300025949 Bacteria 6575
191 Ga0207667_11054669 3300025949 Bacteria 798
192 Ga0207651_10005772 3300025960 Bacteria 6392
193 Ga0207651_10152211 3300025960 Bacteria 1802
194 Ga0207668_10006070 3300025972 Bacteria 7122
195 Ga0207640_10060214 3300025981 Bacteria 2509
196 Ga0207640_10278185 3300025981 Bacteria 1313
197 Ga0207658_10005873 3300025986 Bacteria 8393
198 Ga0207658_10527770 3300025986 Bacteria 1054
199 Ga0207677_10008889 3300026023 Bacteria 5632
200 Ga0207703_10056414 3300026035 Bacteria 3199
201 Ga0207639_10025680 3300026041 Bacteria 4274
202 Ga0207639_10558948 3300026041 Bacteria 1051
203 Ga0207678_10009018 3300026067 Bacteria 8780
204 Ga0207678_10059376 3300026067 Bacteria 3291
205 Ga0207678_10074895 3300026067 Bacteria 2900
206 Ga0207678_10845658 3300026067 Bacteria 808
207 Ga0207641_10365026 3300026088 Bacteria 1379
208 Ga0207648_10001063 3300026089 Bacteria 30753
209 Ga0207676_10414091 3300026095 Bacteria 1262
210 Ga0207674_10017075 3300026116 Bacteria 7921
211 Ga0207674_10054584 3300026116 Bacteria 4067
212 Ga0207674_10054909 3300026116 Bacteria 4053
213 Ga0207675_100047916 3300026118 Bacteria 3989
214 Ga0207698_10300681 3300026142 Bacteria 1493
215 Ga0207698_10333241 3300026142 Bacteria 1426
216 Ga0210000_1055664 3300027462 Bacteria 638
217 Ga0207428_10022929 3300027907 Bacteria 5259
218 Ga0207428_10114556 3300027907 Bacteria 2072
219 Ga0207428_11098744 3300027907 Bacteria 556
220 Ga0268266_10023229 3300028379 Bacteria 5280
221 Ga0268266_11143045 3300028379 Bacteria 753
222 Ga0268265_11353271 3300028380 Bacteria 713
223 Ga0268264_10011710 3300028381 Bacteria 7233
224 Ga0265334_10173821 3300028573 Bacteria 754
225 Ga0307515_10000089 3300028794 Bacteria 215736
226 Ga0307515_10265895 3300028794 Bacteria 1443
227 Ga0307512_10208327 3300030522 Bacteria 1044
228 Ga0316177_1220548 3300030731 Bacteria 607
229 Ga0316180_1094003 3300030736 Bacteria 1711
230 Ga0316182_1004301 3300030745 Bacteria 3660
231 Ga0265327_10001420 3300031251 Bacteria 30486
232 Ga0307509_10089494 3300031507 Bacteria 3157
233 Ga0307508_10000142 3300031616 Bacteria 85288
234 Ga0307514_10003638 3300031649 Bacteria 14632
235 Ga0307405_10022714 3300031731 Bacteria 3551
236 Ga0307405_10052981 3300031731 Bacteria 2525
237 Ga0307411_10202772 3300032005 Bacteria 1525
238 Ga0307507_10040890 3300033179 Bacteria 4649
239 Ga0307510_10131575 3300033180 Bacteria 2173
240 Ga0373944_0004177 3300035089 Bacteria 3752
241 Ga0373936_0003613 3300035113 Bacteria 5817
242 Ga0373939_0000004 3300035114 Bacteria 106519
243 Ga0373945_0000381 3300035116 Bacteria 12690
244 Ga0373943_0000176 3300035170 Bacteria 25283
245 Ga0373946_0000941 3300035171 Bacteria 9975
246 Ga0373961_0020374 3300035241 Bacteria 1754
247 Ga0373924_0266085 3300035410 Bacteria 760
248 Ga0373931_0001005 3300035691 Bacteria 11928
249 Ga0373935_0000137 3300035692 Bacteria 33661
250 Ga0373927_0015988 3300035695 Bacteria 4953
251 Ga0373947_0049904 3300035725 Bacteria 2514
252 Ga0373937_0096346 3300036401 Bacteria 2744
253 Ga0373925_0001589 3300037068 Bacteria 19217
254 Ga0395899_0021488 3300037312 Bacteria 4896
255 Ga0395900_0005097 3300037418 Bacteria 13793
256 Ga0395898_0127607 3300037466 Bacteria 2437
257 Ga0395905_0010128 3300037471 Bacteria 9189
258 Ga0395901_0008309 3300038443 Bacteria 10492
259 Ga0395901_0021971 3300038443 Bacteria 6540
260 Ga0436361_0991880 3300039447 Bacteria 1367
261 Ga0439466_0015066 3300041411 Bacteria 2810
262 Ga0439456_070197 3300042013 Bacteria 776
263 Ga0439463_013024 3300042016 Bacteria 2045
264 Ga0450902_005926 3300042137 Bacteria 1862
265 Ga0453683_0992385 3300044673 Bacteria 557
266 Ga0453684_1995027 3300044712 Bacteria 585
267 Ga0451576_0112109 3300045051 Bacteria 2839
268 Ga0495617_001543 3300046452 Bacteria 9981
269 Ga0495627_000846 3300046453 Bacteria 21913
270 Ga0495603_0007727 3300046455 Bacteria 6480
271 Ga0495591_004841 3300046458 Bacteria 6418
272 Ga0495591_037182 3300046458 Bacteria 1411
273 Ga0495638_0000625 3300046460 Bacteria 39160
274 Ga0495638_0109905 3300046460 Bacteria 1638
275 Ga0495580_0000477 3300046472 Bacteria 33379
276 Ga0495582_0005222 3300046473 Bacteria 7267
277 Ga0495605_0005769 3300046474 Bacteria 7171
278 Ga0495639_0142319 3300046475 Bacteria 1153
279 Ga0495584_0011422 3300046491 Bacteria 4547
280 Ga0495584_0076662 3300046491 Bacteria 1681
281 Ga0495585_0003146 3300046492 Bacteria 11303
282 Ga0495585_0005342 3300046492 Bacteria 8105
283 Ga0495594_0105352 3300046499 Bacteria 1588
284 Ga0495596_0148895 3300046500 Bacteria 909
285 Ga0495607_0058727 3300046501 Bacteria 2197
286 Ga0495607_0221767 3300046501 Bacteria 924
287 Ga0495583_0288285 3300046506 Bacteria 654
288 Ga0495610_0043069 3300046512 Bacteria 2252
289 Ga0495610_0211284 3300046512 Bacteria 789
290 Ga0495616_0087740 3300046513 Bacteria 1477
291 Ga0495616_0094057 3300046513 Bacteria 1414
292 Ga0495620_0027671 3300046515 Bacteria 2650
293 Ga0495628_0317146 3300046516 Bacteria 1151
294 Ga0495632_0002828 3300046519 Bacteria 12843
295 Ga0495632_0005007 3300046519 Bacteria 8878
296 Ga0495632_0005097 3300046519 Bacteria 8784
297 Ga0495632_0031628 3300046519 Bacteria 2733
298 Ga0495637_0049582 3300046520 Bacteria 1763
299 Ga0495643_0047818 3300046522 Bacteria 2315
300 Ga0495644_0000006 3300046523 Bacteria 113088
301 Ga0495648_0001976 3300046524 Bacteria 19476
302 Ga0495666_0070037 3300046526 Bacteria 1668
303 Ga0495642_0022681 3300046528 Bacteria 2474
304 Ga0495654_0062174 3300046530 Bacteria 1790
305 Ga0495586_0000933 3300046535 Bacteria 16591
306 Ga0495609_0043518 3300046538 Bacteria 2016
307 Ga0495597_0004653 3300046542 Bacteria 7466
308 Ga0495597_0014081 3300046542 Bacteria 3814
309 Ga0495597_0105129 3300046542 Bacteria 1187
310 Ga0495645_0034321 3300046543 Bacteria 3701
311 Ga0495633_0011774 3300046558 Bacteria 4696
312 Ga0495633_0022776 3300046558 Bacteria 3111
313 Ga0495656_0006972 3300046615 Bacteria 3977
314 Ga0495611_0001656 3300046648 Bacteria 10809
315 Ga0495625_0003452 3300046660 Bacteria 15748
316 Ga0495625_0173579 3300046660 Bacteria 1438
317 Ga0495661_0009917 3300046665 Bacteria 6514
318 Ga0495588_0017240 3300046674 Bacteria 3502
319 Ga0495657_0226803 3300046675 Bacteria 1131
320 Ga0495647_0005818 3300046681 Bacteria 4057
321 Ga0495658_0023732 3300046683 Bacteria 3259
322 Ga0495670_0003601 3300046691 Bacteria 7605
323 Ga0495671_0011305 3300046692 Bacteria 4921
324 Ga0495671_0012893 3300046692 Bacteria 4550
325 Ga0495649_0000304 3300046694 Bacteria 43073
326 Ga0495589_0024320 3300046794 Bacteria 3079
327 Ga0495600_0103141 3300046809 Bacteria 1859
328 Ga0495660_0004621 3300046810 Bacteria 8303
329 Ga0495660_0015760 3300046810 Bacteria 4363
330 Ga0495660_0429208 3300046810 Bacteria 574
331 Ga0495581_0086542 3300047315 Bacteria 1817
332 Ga0495672_0000271 3300047320 Bacteria 71554
333 Ga0495672_0001770 3300047320 Bacteria 20766
334 Ga0495672_0013188 3300047320 Bacteria 5713
335 Ga0495676_0023587 3300047321 Bacteria 5337
336 Ga0495680_0002119 3300047322 Bacteria 20610
337 Ga0495683_0001454 3300047323 Bacteria 15542
338 Ga0495683_0001681 3300047323 Bacteria 14074
339 Ga0495687_000502 3300047443 Bacteria 47227
340 Ga0495677_0035681 3300047445 Bacteria 1814
341 Ga0495679_016772 3300047446 Bacteria 2640
342 Ga0495673_0000551 3300047469 Bacteria 38267
343 Ga0495673_0098975 3300047469 Bacteria 1181
344 Ga0495681_0000791 3300047470 Bacteria 24342
345 Ga0495681_0009948 3300047470 Bacteria 5801
346 Ga0495626_0031697 3300048091 Bacteria 2542
347 Ga0495626_0395891 3300048091 Bacteria 534
348 Ga0496102_0581590 3300048905 Bacteria 1043
349 Ga0496104_0416507 3300048907 Bacteria 1256
350 Ga0496108_0086243 3300048911 Bacteria 2666
351 Ga0496108_1802368 3300048911 Unclassified 501
352 Ga0496111_0948021 3300048914 Bacteria 618
353 Ga0496112_0857297 3300048915 Bacteria 832
354 Ga0496116_0054622 3300048919 Bacteria 2629
355 Ga0496117_0019010 3300048920 Bacteria 5662
356 Ga0496117_0083390 3300048920 Bacteria 2090
357 Ga0496117_0178744 3300048920 Bacteria 1222
358 Ga0496118_0176225 3300048921 Bacteria 1298
359 Ga0496118_0200773 3300048921 Bacteria 1181
360 Ga0496118_0460050 3300048921 Bacteria 643
361 Ga0496119_0007458 3300048922 Bacteria 9843
362 Ga0496120_0001607 3300048923 Bacteria 26221
363 Ga0496121_0170219 3300048924 Bacteria 1583
364 Ga0496122_0328475 3300048925 Bacteria 809
365 Ga0496123_0000072 3300048926 Bacteria 198524
366 Ga0496124_0000021 3300048927 Bacteria 432123
367 Ga0496124_0001825 3300048927 Bacteria 29428
368 Ga0496124_0074270 3300048927 Bacteria 2811
369 Ga0496125_0113925 3300048928 Bacteria 1949
370 Ga0496125_0361317 3300048928 Bacteria 863
371 Ga0495678_011230 3300049459 Bacteria 4300
372 Ga0501034_0237011 3300049571 Bacteria 1772
373 Ga0501037_0245662 3300049573 Bacteria 1253
374 Ga0501044_0227743 3300049823 Bacteria 1813
375 nmdc:mga03683_93307_c1 3300050489 Bacteria 1315
376 nmdc:mga03n38_51259_c1 3300050490 Bacteria 1842
377 nmdc:mga00v17_137345_c1 3300050491 Bacteria 1566
378 nmdc:mga00v17_187507_c2 3300050491 Bacteria 936
379 nmdc:mga00v17_265534_c1 3300050491 Bacteria 1114
380 nmdc:mga0yw44_233990_c1 3300050492 Bacteria 1220
381 nmdc:mga0k408_1070_c2 3300050493 Bacteria 9350
382 nmdc:mga0k408_16909_c1 3300050493 Bacteria 4056
383 nmdc:mga0k408_372959_c1 3300050493 Bacteria 850
384 nmdc:mga06z11_788879_c1 3300050494 Bacteria 579
385 nmdc:mga06z11_93271_c1 3300050494 Bacteria 1639
386 nmdc:mga07m45_18990_c1 3300050496 Bacteria 3720
387 nmdc:mga07m45_3356_c1 3300050496 Bacteria 7719
388 nmdc:mga07m45_3515_c1 3300050496 Bacteria 7561
389 nmdc:mga0n895_776525_c1 3300050512 Bacteria 950
390 nmdc:mga0rr50_1496041_c1 3300050513 Bacteria 571
391 nmdc:mga08x19_142400_c1 3300050514 Bacteria 1620
392 Ga0500644_0022727 3300053088 Bacteria 1895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10000089 Ga0307515_10000089142 117
2 3300031251 Ga0265327_10001420 Ga0265327_100014206 117
3 3300046492 Ga0495585_0005342 Ga0495585_0005342_1464_1898 118
4 3300046501 Ga0495607_0221767 Ga0495607_0221767_321_752 118
5 3300046538 Ga0495609_0043518 Ga0495609_0043518_1208_1639 118
6 3300046660 Ga0495625_0173579 Ga0495625_0173579_572_1003 118
7 3300046665 Ga0495661_0009917 Ga0495661_0009917_2691_3122 118
8 3300003187 JGI25151J46595_10002668 JGI25151J46595_100026686 120
9 3300025297 Ga0209758_1005683 Ga0209758_100568312 120
10 3300003354 JGI25160J50197_1000158 JGI25160J50197_100015840 121
11 3300003374 JGI25161J50226_1000040 JGI25161J50226_100004083 121
12 3300003791 Ga0055530_10019470 Ga0055530_100194702 121
13 3300004625 Ga0055543_1000167 Ga0055543_100016731 121
14 3300005262 Ga0065165_1003807 Ga0065165_10038078 121
15 3300005564 Ga0070664_100124589 Ga0070664_1001245893 121
16 3300025208 Ga0209436_100621 Ga0209436_1006219 121
17 3300025284 Ga0209130_1000042 Ga0209130_100004237 121
18 3300025298 Ga0209050_1004842 Ga0209050_10048426 121
19 3300025302 Ga0207426_1000097 Ga0207426_100009743 121
20 3300027462 Ga0210000_1055664 Ga0210000_10556642 122
21 3300044673 Ga0453683_0992385 Ga0453683_0992385_94_531 122
22 3300028573 Ga0265334_10173821 Ga0265334_101738212 123
23 3300046506 Ga0495583_0288285 Ga0495583_0288285_49_480 123
24 3300005331 Ga0070670_100063792 Ga0070670_1000637922 124
25 3300013296 Ga0157374_11546101 Ga0157374_115461012 124
26 3300025925 Ga0207650_10203675 Ga0207650_102036753 124
27 3300025945 Ga0207679_10149898 Ga0207679_101498984 124
28 3300048911 Ga0496108_1802368 Ga0496108_1802368_54_488 124
29 3300046519 Ga0495632_0005007 Ga0495632_0005007_755_1186 125
30 3300046810 Ga0495660_0429208 Ga0495660_0429208_15_392 125
31 3300005353 Ga0070669_100005531 Ga0070669_1000055318 134
32 3300025923 Ga0207681_10024807 Ga0207681_100248073 134
33 3300031507 Ga0307509_10089494 Ga0307509_100894943 134
34 3300031616 Ga0307508_10000142 Ga0307508_1000014220 134
35 3300033179 Ga0307507_10040890 Ga0307507_100408904 134
36 3300028794 Ga0307515_10265895 Ga0307515_102658953 135
37 3300030522 Ga0307512_10208327 Ga0307512_102083272 135
38 3300031649 Ga0307514_10003638 Ga0307514_100036386 135
39 3300039447 Ga0436361_0991880 Ga0436361_0991880_617_1042 138
40 3300046558 Ga0495633_0011774 Ga0495633_0011774_2905_3330 138
41 iso_pu_bacteria 2816332133 2816474625 138
42 3300003794 Ga0055531_10008702 Ga0055531_100087026 139
43 3300025298 Ga0209050_1014012 Ga0209050_10140125 139
44 3300025304 Ga0209257_1002601 Ga0209257_10026017 139
45 3300030736 Ga0316180_1094003 Ga0316180_10940035 139
46 3300030745 Ga0316182_1004301 Ga0316182_10043015 139
47 3300035089 Ga0373944_0004177 Ga0373944_0004177_1499_1927 139
48 3300035113 Ga0373936_0003613 Ga0373936_0003613_2570_2998 139
49 3300035116 Ga0373945_0000381 Ga0373945_0000381_2910_3338 139
50 3300035170 Ga0373943_0000176 Ga0373943_0000176_1455_1883 139
51 3300035171 Ga0373946_0000941 Ga0373946_0000941_1507_1935 139
52 3300035410 Ga0373924_0266085 Ga0373924_0266085_167_595 139
53 3300035692 Ga0373935_0000137 Ga0373935_0000137_31214_31642 139
54 3300035695 Ga0373927_0015988 Ga0373927_0015988_968_1396 139
55 3300035725 Ga0373947_0049904 Ga0373947_0049904_580_1008 139
56 3300037068 Ga0373925_0001589 Ga0373925_0001589_15135_15563 139
57 3300046455 Ga0495603_0007727 Ga0495603_0007727_5633_6061 139
58 3300046472 Ga0495580_0000477 Ga0495580_0000477_30688_31116 139
59 3300046473 Ga0495582_0005222 Ga0495582_0005222_2031_2459 139
60 3300046475 Ga0495639_0142319 Ga0495639_0142319_466_894 139
61 3300046499 Ga0495594_0105352 Ga0495594_0105352_304_732 139
62 3300046526 Ga0495666_0070037 Ga0495666_0070037_787_1215 139
63 3300046535 Ga0495586_0000933 Ga0495586_0000933_13572_14000 139
64 3300046674 Ga0495588_0017240 Ga0495588_0017240_1857_2285 139
65 3300046681 Ga0495647_0005818 Ga0495647_0005818_3051_3479 139
66 3300046683 Ga0495658_0023732 Ga0495658_0023732_2359_2787 139
67 3300047315 Ga0495581_0086542 Ga0495581_0086542_888_1316 139
68 3300047321 Ga0495676_0023587 Ga0495676_0023587_4015_4443 139
69 3300047445 Ga0495677_0035681 Ga0495677_0035681_1144_1563 139
70 3300047446 Ga0495679_016772 Ga0495679_016772_749_1168 139
71 3300048925 Ga0496122_0328475 Ga0496122_0328475_97_525 139
72 3300048928 Ga0496125_0361317 Ga0496125_0361317_269_697 139
73 iso_pu_bacteria 2513020051 2513227346 139
74 iso_pu_bacteria 2599185214 2599627084 139
75 iso_pu_bacteria 2599185226 2599676555 139
76 iso_pu_bacteria 2599185227 2599684823 139
77 iso_pu_bacteria 2599185229 2599696741 139
78 iso_pu_bacteria 2643221565 2643844414 139
79 iso_pu_bacteria 2643221585 2643936930 139
80 iso_pu_bacteria 2643221654 2644303618 139
81 iso_pu_bacteria 2643221656 2644318095 139
82 iso_pu_bacteria 2643221672 2644401042 139
83 iso_pu_bacteria 2808606382 2808961051 139
84 iso_pu_bacteria 2818991436 2819541733 139
85 iso_pu_bacteria 2834028612 2834033003 139
86 iso_pu_bacteria 2885198086 2885200039 139
87 iso_pu_bacteria 2885211737 2885213731 139
88 iso_pu_bacteria 2928070936 2928072672 139
89 iso_pu_bacteria 2928130867 2928131460 139
90 iso_pu_bacteria 8056569372 8056574083 139
91 3300005327 Ga0070658_10683956 Ga0070658_106839562 140
92 3300005328 Ga0070676_10000533 Ga0070676_100005337 140
93 3300005330 Ga0070690_101122517 Ga0070690_1011225171 140
94 3300005333 Ga0070677_10000086 Ga0070677_1000008610 140
95 3300005334 Ga0068869_100100441 Ga0068869_1001004413 140
96 3300005335 Ga0070666_10000649 Ga0070666_100006497 140
97 3300005338 Ga0068868_100010067 Ga0068868_1000100675 140
98 3300005347 Ga0070668_100004498 Ga0070668_1000044986 140
99 3300005353 Ga0070669_100048164 Ga0070669_1000481643 140
100 3300005354 Ga0070675_100001757 Ga0070675_1000017579 140
101 3300005355 Ga0070671_100000747 Ga0070671_10000074717 140
102 3300005364 Ga0070673_100000680 Ga0070673_10000068022 140
103 3300005367 Ga0070667_100030456 Ga0070667_1000304567 140
104 3300005455 Ga0070663_100005106 Ga0070663_10000510610 140
105 3300005456 Ga0070678_100000617 Ga0070678_1000006179 140
106 3300005457 Ga0070662_100120907 Ga0070662_1001209072 140
107 3300005459 Ga0068867_100017256 Ga0068867_1000172561 140
108 3300005539 Ga0068853_100008223 Ga0068853_10000822312 140
109 3300005543 Ga0070672_100032926 Ga0070672_1000329267 140
110 3300005548 Ga0070665_100010811 Ga0070665_1000108118 140
111 3300005616 Ga0068852_100002210 Ga0068852_10000221012 140
112 3300005618 Ga0068864_100009116 Ga0068864_10000911610 140
113 3300005719 Ga0068861_100049189 Ga0068861_1000491893 140
114 3300005834 Ga0068851_10003577 Ga0068851_100035775 140
115 3300005840 Ga0068870_10003300 Ga0068870_1000330011 140
116 3300005841 Ga0068863_100008452 Ga0068863_1000084525 140
117 3300005842 Ga0068858_100073281 Ga0068858_1000732815 140
118 3300005843 Ga0068860_100276958 Ga0068860_1002769583 140
119 3300005844 Ga0068862_100265468 Ga0068862_1002654681 140
120 3300006237 Ga0097621_100003500 Ga0097621_10000350012 140
121 3300006358 Ga0068871_100458512 Ga0068871_1004585121 140
122 3300006881 Ga0068865_100247756 Ga0068865_1002477562 140
123 3300013296 Ga0157374_10011589 Ga0157374_100115895 140
124 3300013297 Ga0157378_10153075 Ga0157378_101530752 140
125 3300013306 Ga0163162_10502591 Ga0163162_105025913 140
126 3300013308 Ga0157375_10002391 Ga0157375_100023917 140
127 3300014325 Ga0163163_10355021 Ga0163163_103550212 140
128 3300014326 Ga0157380_11781378 Ga0157380_117813782 140
129 3300014745 Ga0157377_10487764 Ga0157377_104877642 140
130 3300014969 Ga0157376_10136817 Ga0157376_101368173 140
131 3300017792 Ga0163161_10027245 Ga0163161_100272453 140
132 3300025893 Ga0207682_10000817 Ga0207682_1000081711 140
133 3300025903 Ga0207680_10045021 Ga0207680_100450213 140
134 3300025907 Ga0207645_10003482 Ga0207645_100034826 140
135 3300025908 Ga0207643_10197171 Ga0207643_101971711 140
136 3300025909 Ga0207705_10615889 Ga0207705_106158892 140
137 3300025923 Ga0207681_10049562 Ga0207681_100495624 140
138 3300025926 Ga0207659_10002562 Ga0207659_100025628 140
139 3300025931 Ga0207644_10027270 Ga0207644_100272705 140
140 3300025933 Ga0207706_10201270 Ga0207706_102012702 140
141 3300025938 Ga0207704_10288725 Ga0207704_102887252 140
142 3300025940 Ga0207691_10000384 Ga0207691_1000038430 140
143 3300025942 Ga0207689_10145848 Ga0207689_101458482 140
144 3300025960 Ga0207651_10005772 Ga0207651_100057721 140
145 3300025972 Ga0207668_10006070 Ga0207668_100060702 140
146 3300025986 Ga0207658_10005873 Ga0207658_100058737 140
147 3300026023 Ga0207677_10008889 Ga0207677_100088896 140
148 3300026035 Ga0207703_10056414 Ga0207703_100564142 140
149 3300026041 Ga0207639_10558948 Ga0207639_105589482 140
150 3300026067 Ga0207678_10009018 Ga0207678_1000901811 140
151 3300026088 Ga0207641_10365026 Ga0207641_103650262 140
152 3300026089 Ga0207648_10001063 Ga0207648_1000106329 140
153 3300026095 Ga0207676_10414091 Ga0207676_104140912 140
154 3300026118 Ga0207675_100047916 Ga0207675_1000479163 140
155 3300026142 Ga0207698_10333241 Ga0207698_103332412 140
156 3300028379 Ga0268266_10023229 Ga0268266_1002322910 140
157 3300028380 Ga0268265_11353271 Ga0268265_113532711 140
158 3300028381 Ga0268264_10011710 Ga0268264_100117108 140
159 3300030731 Ga0316177_1220548 Ga0316177_12205482 140
160 3300033180 Ga0307510_10131575 Ga0307510_101315754 140
161 3300038443 Ga0395901_0008309 Ga0395901_0008309_4270_4701 140
162 3300044712 Ga0453684_1995027 Ga0453684_1995027_48_479 140
163 3300045051 Ga0451576_0112109 Ga0451576_0112109_1864_2295 140
164 3300046528 Ga0495642_0022681 Ga0495642_0022681_1946_2377 140
165 3300046558 Ga0495633_0022776 Ga0495633_0022776_1723_2154 140
166 3300049573 Ga0501037_0245662 Ga0501037_0245662_328_759 140
167 3300049823 Ga0501044_0227743 Ga0501044_0227743_1082_1513 140
168 3300003794 Ga0055531_10000572 Ga0055531_1000057226 141
169 3300005288 Ga0065714_10065223 Ga0065714_100652237 141
170 3300005327 Ga0070658_10619935 Ga0070658_106199352 141
171 3300005355 Ga0070671_100254071 Ga0070671_1002540713 141
172 3300005364 Ga0070673_100358868 Ga0070673_1003588682 141
173 3300005366 Ga0070659_100130718 Ga0070659_1001307182 141
174 3300005367 Ga0070667_100161280 Ga0070667_1001612802 141
175 3300005367 Ga0070667_100460722 Ga0070667_1004607222 141
176 3300005367 Ga0070667_100810683 Ga0070667_1008106831 141
177 3300005455 Ga0070663_100055204 Ga0070663_1000552043 141
178 3300005455 Ga0070663_100139815 Ga0070663_1001398153 141
179 3300005457 Ga0070662_100013661 Ga0070662_1000136614 141
180 3300005457 Ga0070662_100371986 Ga0070662_1003719862 141
181 3300005539 Ga0068853_100030372 Ga0068853_1000303725 141
182 3300005563 Ga0068855_100000046 Ga0068855_100000046113 141
183 3300005563 Ga0068855_101288035 Ga0068855_1012880352 141
184 3300005564 Ga0070664_100240844 Ga0070664_1002408442 141
185 3300005577 Ga0068857_100042095 Ga0068857_1000420954 141
186 3300005577 Ga0068857_100075627 Ga0068857_1000756273 141
187 3300005578 Ga0068854_100068921 Ga0068854_1000689213 141
188 3300005616 Ga0068852_100083549 Ga0068852_1000835494 141
189 3300005834 Ga0068851_10140916 Ga0068851_101409163 141
190 3300006038 Ga0075365_10002815 Ga0075365_1000281510 141
191 3300006048 Ga0075363_100126416 Ga0075363_1001264163 141
192 3300006051 Ga0075364_10023309 Ga0075364_100233093 141
193 3300006051 Ga0075364_10165883 Ga0075364_101658832 141
194 3300006058 Ga0075432_10001426 Ga0075432_1000142611 141
195 3300006058 Ga0075432_10010013 Ga0075432_100100135 141
196 3300006058 Ga0075432_10043844 Ga0075432_100438442 141
197 3300006177 Ga0075362_10023506 Ga0075362_100235063 141
198 3300006178 Ga0075367_10007127 Ga0075367_100071274 141
199 3300006186 Ga0075369_10091665 Ga0075369_100916653 141
200 3300006237 Ga0097621_100157537 Ga0097621_1001575374 141
201 3300006353 Ga0075370_10002190 Ga0075370_100021907 141
202 3300006358 Ga0068871_100215722 Ga0068871_1002157222 141
203 3300006358 Ga0068871_100237916 Ga0068871_1002379163 141
204 3300006852 Ga0075433_10886380 Ga0075433_108863802 141
205 3300006871 Ga0075434_101065855 Ga0075434_1010658552 141
206 3300006914 Ga0075436_100035233 Ga0075436_1000352332 141
207 3300009036 Ga0105244_10003614 Ga0105244_1000361410 141
208 3300009036 Ga0105244_10003980 Ga0105244_100039803 141
209 3300009093 Ga0105240_10739375 Ga0105240_107393751 141
210 3300009098 Ga0105245_10233506 Ga0105245_102335063 141
211 3300009148 Ga0105243_10000045 Ga0105243_1000004511 141
212 3300009148 Ga0105243_10006191 Ga0105243_100061915 141
213 3300009148 Ga0105243_10014028 Ga0105243_100140284 141
214 3300009148 Ga0105243_11580795 Ga0105243_115807951 141
215 3300009174 Ga0105241_10060994 Ga0105241_100609944 141
216 3300009176 Ga0105242_10185050 Ga0105242_101850503 141
217 3300010375 Ga0105239_10099339 Ga0105239_100993394 141
218 3300010375 Ga0105239_10102223 Ga0105239_101022232 141
219 3300011119 Ga0105246_10295177 Ga0105246_102951773 141
220 3300013100 Ga0157373_10213049 Ga0157373_102130492 141
221 3300013100 Ga0157373_10701952 Ga0157373_107019522 141
222 3300013104 Ga0157370_10130691 Ga0157370_101306912 141
223 3300013105 Ga0157369_10982099 Ga0157369_109820991 141
224 3300013307 Ga0157372_11716353 Ga0157372_117163531 141
225 3300014497 Ga0182008_10002573 Ga0182008_1000257314 141
226 3300014497 Ga0182008_10514227 Ga0182008_105142272 141
227 3300014968 Ga0157379_11440832 Ga0157379_114408322 141
228 3300015261 Ga0182006_1003139 Ga0182006_10031396 141
229 3300015262 Ga0182007_10001099 Ga0182007_1000109912 141
230 3300015262 Ga0182007_10023243 Ga0182007_100232433 141
231 3300015262 Ga0182007_10053185 Ga0182007_100531852 141
232 3300015265 Ga0182005_1000238 Ga0182005_10002384 141
233 3300015265 Ga0182005_1106527 Ga0182005_11065273 141
234 3300015265 Ga0182005_1245943 Ga0182005_12459432 141
235 3300017792 Ga0163161_10732302 Ga0163161_107323022 141
236 3300025292 Ga0209676_1000385 Ga0209676_100038518 141
237 3300025298 Ga0209050_1001437 Ga0209050_100143717 141
238 3300025303 Ga0209051_1000137 Ga0209051_100013733 141
239 3300025304 Ga0209257_1000205 Ga0209257_100020536 141
240 3300025321 Ga0207656_10150178 Ga0207656_101501782 141
241 3300025728 Ga0207655_1000085 Ga0207655_100008553 141
242 3300025728 Ga0207655_1004192 Ga0207655_10041924 141
243 3300025904 Ga0207647_10226276 Ga0207647_102262762 141
244 3300025907 Ga0207645_10563160 Ga0207645_105631602 141
245 3300025909 Ga0207705_10579930 Ga0207705_105799302 141
246 3300025913 Ga0207695_10171289 Ga0207695_101712892 141
247 3300025924 Ga0207694_10088104 Ga0207694_100881044 141
248 3300025927 Ga0207687_10052220 Ga0207687_100522204 141
249 3300025931 Ga0207644_10034714 Ga0207644_100347144 141
250 3300025932 Ga0207690_10427425 Ga0207690_104274252 141
251 3300025933 Ga0207706_10021246 Ga0207706_100212464 141
252 3300025933 Ga0207706_10220087 Ga0207706_102200872 141
253 3300025934 Ga0207686_10335028 Ga0207686_103350282 141
254 3300025935 Ga0207709_10000011 Ga0207709_10000011344 141
255 3300025935 Ga0207709_10000497 Ga0207709_100004974 141
256 3300025935 Ga0207709_10069462 Ga0207709_100694623 141
257 3300025940 Ga0207691_10585792 Ga0207691_105857922 141
258 3300025942 Ga0207689_10365042 Ga0207689_103650422 141
259 3300025945 Ga0207679_10032090 Ga0207679_100320903 141
260 3300025949 Ga0207667_10000036 Ga0207667_10000036198 141
261 3300025949 Ga0207667_11054669 Ga0207667_110546692 141
262 3300025960 Ga0207651_10152211 Ga0207651_101522112 141
263 3300025981 Ga0207640_10060214 Ga0207640_100602143 141
264 3300025986 Ga0207658_10527770 Ga0207658_105277702 141
265 3300026041 Ga0207639_10025680 Ga0207639_100256803 141
266 3300026067 Ga0207678_10074895 Ga0207678_100748953 141
267 3300026067 Ga0207678_10845658 Ga0207678_108456582 141
268 3300026116 Ga0207674_10017075 Ga0207674_100170755 141
269 3300026116 Ga0207674_10054584 Ga0207674_100545844 141
270 3300026116 Ga0207674_10054909 Ga0207674_100549092 141
271 3300026142 Ga0207698_10300681 Ga0207698_103006813 141
272 3300027907 Ga0207428_10022929 Ga0207428_100229296 141
273 3300027907 Ga0207428_10114556 Ga0207428_101145564 141
274 3300027907 Ga0207428_11098744 Ga0207428_110987441 141
275 3300028379 Ga0268266_11143045 Ga0268266_111430452 141
276 3300031731 Ga0307405_10022714 Ga0307405_100227143 141
277 3300031731 Ga0307405_10052981 Ga0307405_100529813 141
278 3300032005 Ga0307411_10202772 Ga0307411_102027723 141
279 3300035114 Ga0373939_0000004 Ga0373939_0000004_51201_51635 141
280 3300035241 Ga0373961_0020374 Ga0373961_0020374_984_1418 141
281 3300035691 Ga0373931_0001005 Ga0373931_0001005_4438_4872 141
282 3300036401 Ga0373937_0096346 Ga0373937_0096346_683_1123 141
283 3300037312 Ga0395899_0021488 Ga0395899_0021488_3582_4016 141
284 3300037418 Ga0395900_0005097 Ga0395900_0005097_6951_7385 141
285 3300037466 Ga0395898_0127607 Ga0395898_0127607_861_1295 141
286 3300037471 Ga0395905_0010128 Ga0395905_0010128_7220_7654 141
287 3300038443 Ga0395901_0021971 Ga0395901_0021971_5529_5963 141
288 3300042013 Ga0439456_070197 Ga0439456_070197_139_573 141
289 3300042016 Ga0439463_013024 Ga0439463_013024_281_715 141
290 3300042137 Ga0450902_005926 Ga0450902_005926_242_676 141
291 3300046452 Ga0495617_001543 Ga0495617_001543_2338_2772 141
292 3300046453 Ga0495627_000846 Ga0495627_000846_13921_14355 141
293 3300046458 Ga0495591_004841 Ga0495591_004841_629_1063 141
294 3300046458 Ga0495591_037182 Ga0495591_037182_245_679 141
295 3300046460 Ga0495638_0000625 Ga0495638_0000625_34905_35339 141
296 3300046460 Ga0495638_0109905 Ga0495638_0109905_1051_1485 141
297 3300046474 Ga0495605_0005769 Ga0495605_0005769_3355_3789 141
298 3300046491 Ga0495584_0011422 Ga0495584_0011422_3229_3663 141
299 3300046491 Ga0495584_0076662 Ga0495584_0076662_1030_1464 141
300 3300046492 Ga0495585_0003146 Ga0495585_0003146_10365_10799 141
301 3300046500 Ga0495596_0148895 Ga0495596_0148895_378_812 141
302 3300046501 Ga0495607_0058727 Ga0495607_0058727_847_1281 141
303 3300046512 Ga0495610_0043069 Ga0495610_0043069_1566_2000 141
304 3300046512 Ga0495610_0211284 Ga0495610_0211284_28_462 141
305 3300046513 Ga0495616_0087740 Ga0495616_0087740_851_1285 141
306 3300046513 Ga0495616_0094057 Ga0495616_0094057_503_937 141
307 3300046515 Ga0495620_0027671 Ga0495620_0027671_188_622 141
308 3300046516 Ga0495628_0317146 Ga0495628_0317146_195_629 141
309 3300046519 Ga0495632_0002828 Ga0495632_0002828_6474_6908 141
310 3300046519 Ga0495632_0005097 Ga0495632_0005097_821_1255 141
311 3300046519 Ga0495632_0031628 Ga0495632_0031628_874_1308 141
312 3300046520 Ga0495637_0049582 Ga0495637_0049582_533_967 141
313 3300046522 Ga0495643_0047818 Ga0495643_0047818_328_762 141
314 3300046523 Ga0495644_0000006 Ga0495644_0000006_56048_56482 141
315 3300046524 Ga0495648_0001976 Ga0495648_0001976_11960_12394 141
316 3300046530 Ga0495654_0062174 Ga0495654_0062174_1331_1765 141
317 3300046542 Ga0495597_0004653 Ga0495597_0004653_363_797 141
318 3300046542 Ga0495597_0014081 Ga0495597_0014081_252_686 141
319 3300046542 Ga0495597_0105129 Ga0495597_0105129_279_713 141
320 3300046543 Ga0495645_0034321 Ga0495645_0034321_743_1177 141
321 3300046615 Ga0495656_0006972 Ga0495656_0006972_3303_3737 141
322 3300046648 Ga0495611_0001656 Ga0495611_0001656_8422_8856 141
323 3300046660 Ga0495625_0003452 Ga0495625_0003452_3501_3935 141
324 3300046675 Ga0495657_0226803 Ga0495657_0226803_542_982 141
325 3300046691 Ga0495670_0003601 Ga0495670_0003601_2209_2643 141
326 3300046692 Ga0495671_0011305 Ga0495671_0011305_1686_2120 141
327 3300046692 Ga0495671_0012893 Ga0495671_0012893_1093_1527 141
328 3300046694 Ga0495649_0000304 Ga0495649_0000304_11212_11646 141
329 3300046794 Ga0495589_0024320 Ga0495589_0024320_834_1268 141
330 3300046809 Ga0495600_0103141 Ga0495600_0103141_726_1160 141
331 3300046810 Ga0495660_0004621 Ga0495660_0004621_1058_1492 141
332 3300046810 Ga0495660_0015760 Ga0495660_0015760_1326_1760 141
333 3300047320 Ga0495672_0000271 Ga0495672_0000271_57183_57617 141
334 3300047320 Ga0495672_0001770 Ga0495672_0001770_16463_16897 141
335 3300047320 Ga0495672_0013188 Ga0495672_0013188_5220_5654 141
336 3300047322 Ga0495680_0002119 Ga0495680_0002119_14435_14869 141
337 3300047323 Ga0495683_0001454 Ga0495683_0001454_3607_4041 141
338 3300047323 Ga0495683_0001681 Ga0495683_0001681_5880_6314 141
339 3300047443 Ga0495687_000502 Ga0495687_000502_3775_4227 141
340 3300047469 Ga0495673_0000551 Ga0495673_0000551_14463_14897 141
341 3300047469 Ga0495673_0098975 Ga0495673_0098975_380_814 141
342 3300047470 Ga0495681_0000791 Ga0495681_0000791_8925_9359 141
343 3300047470 Ga0495681_0009948 Ga0495681_0009948_2875_3309 141
344 3300048091 Ga0495626_0031697 Ga0495626_0031697_429_863 141
345 3300048091 Ga0495626_0395891 Ga0495626_0395891_64_516 141
346 3300048905 Ga0496102_0581590 Ga0496102_0581590_137_574 141
347 3300048907 Ga0496104_0416507 Ga0496104_0416507_332_772 141
348 3300048911 Ga0496108_0086243 Ga0496108_0086243_1534_1974 141
349 3300048914 Ga0496111_0948021 Ga0496111_0948021_116_550 141
350 3300048915 Ga0496112_0857297 Ga0496112_0857297_57_494 141
351 3300048919 Ga0496116_0054622 Ga0496116_0054622_490_927 141
352 3300048920 Ga0496117_0019010 Ga0496117_0019010_2700_3137 141
353 3300048920 Ga0496117_0083390 Ga0496117_0083390_207_641 141
354 3300048920 Ga0496117_0178744 Ga0496117_0178744_611_1045 141
355 3300048921 Ga0496118_0176225 Ga0496118_0176225_596_1033 141
356 3300048921 Ga0496118_0200773 Ga0496118_0200773_613_1047 141
357 3300048921 Ga0496118_0460050 Ga0496118_0460050_57_491 141
358 3300048922 Ga0496119_0007458 Ga0496119_0007458_7067_7501 141
359 3300048923 Ga0496120_0001607 Ga0496120_0001607_8732_9166 141
360 3300048924 Ga0496121_0170219 Ga0496121_0170219_546_983 141
361 3300048926 Ga0496123_0000072 Ga0496123_0000072_120588_121028 141
362 3300048927 Ga0496124_0000021 Ga0496124_0000021_133880_134314 141
363 3300048927 Ga0496124_0001825 Ga0496124_0001825_13655_14089 141
364 3300048927 Ga0496124_0074270 Ga0496124_0074270_949_1386 141
365 3300048928 Ga0496125_0113925 Ga0496125_0113925_490_927 141
366 3300049459 Ga0495678_011230 Ga0495678_011230_2156_2590 141
367 3300049571 Ga0501034_0237011 Ga0501034_0237011_990_1427 141
368 3300050489 nmdc:mga03683_93307_c1 nmdc:mga03683_93307_c1_780_1214 141
369 3300050490 nmdc:mga03n38_51259_c1 nmdc:mga03n38_51259_c1_915_1349 141
370 3300050491 nmdc:mga00v17_137345_c1 nmdc:mga00v17_137345_c1_697_1131 141
371 3300050491 nmdc:mga00v17_265534_c1 nmdc:mga00v17_265534_c1_289_723 141
372 3300050492 nmdc:mga0yw44_233990_c1 nmdc:mga0yw44_233990_c1_75_509 141
373 3300050493 nmdc:mga0k408_1070_c2 nmdc:mga0k408_1070_c2_4749_5183 141
374 3300050493 nmdc:mga0k408_16909_c1 nmdc:mga0k408_16909_c1_847_1281 141
375 3300050494 nmdc:mga06z11_788879_c1 nmdc:mga06z11_788879_c1_36_470 141
376 3300050494 nmdc:mga06z11_93271_c1 nmdc:mga06z11_93271_c1_459_893 141
377 3300050496 nmdc:mga07m45_18990_c1 nmdc:mga07m45_18990_c1_1999_2436 141
378 3300050496 nmdc:mga07m45_3356_c1 nmdc:mga07m45_3356_c1_5089_5523 141
379 3300050496 nmdc:mga07m45_3515_c1 nmdc:mga07m45_3515_c1_3940_4374 141
380 3300050512 nmdc:mga0n895_776525_c1 nmdc:mga0n895_776525_c1_77_511 141
381 3300050513 nmdc:mga0rr50_1496041_c1 nmdc:mga0rr50_1496041_c1_100_534 141
382 3300050514 nmdc:mga08x19_142400_c1 nmdc:mga08x19_142400_c1_468_902 141
383 3300053088 Ga0500644_0022727 Ga0500644_0022727_498_932 141
384 iso_pu_bacteria 2808606377 2808931608 141
385 iso_pu_bacteria 2808606381 2808953618 141
386 3300003781 Ga0055536_1000891 Ga0055536_100089111 142
387 3300003792 Ga0055540_1001142 Ga0055540_10011429 142
388 3300025292 Ga0209676_1000873 Ga0209676_100087311 142
389 3300025303 Ga0209051_1000773 Ga0209051_100077314 142
390 3300050491 nmdc:mga00v17_187507_c2 nmdc:mga00v17_187507_c2_301_741 142
391 3300041411 Ga0439466_0015066 Ga0439466_0015066_1080_1520 143
392 3300002705 JGI25156J39149_1030708 JGI25156J39149_10307081 144
393 3300002705 JGI25156J39149_1030732 JGI25156J39149_10307321 144
394 3300002741 JGI25157J39369_1009102 JGI25157J39369_10091022 144
395 3300003763 Ga0055529_1005168 Ga0055529_10051683 144
396 3300005455 Ga0070663_100018195 Ga0070663_1000181955 144
397 3300005563 Ga0068855_100146708 Ga0068855_1001467082 144
398 3300006195 Ga0075366_10383290 Ga0075366_103832902 144
399 3300009093 Ga0105240_11360048 Ga0105240_113600482 144
400 3300009545 Ga0105237_10002758 Ga0105237_1000275816 144
401 3300020082 Ga0206353_10762290 Ga0206353_107622904 144
402 3300025246 Ga0209646_1001128 Ga0209646_10011282 144
403 3300025250 Ga0209026_1000153 Ga0209026_100015335 144
404 3300025250 Ga0209026_1024665 Ga0209026_10246652 144
405 3300025256 Ga0209759_1003490 Ga0209759_10034906 144
406 3300025256 Ga0209759_1006687 Ga0209759_10066875 144
407 3300025272 Ga0209455_1000151 Ga0209455_100015125 144
408 3300025913 Ga0207695_10023730 Ga0207695_100237307 144
409 3300025914 Ga0207671_10020242 Ga0207671_100202424 144
410 3300025949 Ga0207667_10024812 Ga0207667_100248126 144
411 3300025981 Ga0207640_10278185 Ga0207640_102781852 144
412 3300026067 Ga0207678_10059376 Ga0207678_100593763 144
413 3300050493 nmdc:mga0k408_372959_c1 nmdc:mga0k408_372959_c1_172_669 144

Feature Viewer

pLDDT pTM Quality
59.39 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map