F438396

General Info

Members Datasets Scaffolds Average Seq Length
414 221 414 267

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0323152|Ga0466957_0323152_35_982
Length 315
Sequence MTVAPLGRRAVTVTQYSRVGAYDVLACADPEGPFPAAGQFYMLAAGARWGGGEDERPFLPRAFSVLRARREPGGAGRAGVGFAGEASPICDLTGGGDPADPGHPAATTLEFLLEDVGPGTRRLAELRAGDPLWLAGPFGNGFSRPRQGRRPILVGGGVGAAPLAVWQDELGSASPRNGAASDEALGGSSPASPRALVLLGFRDAAHAEGARLLRGARLATDDGSAGHHGPVTNLLLAELGCDPRAEVYACGPPAMLEAVRAICAAHAVPAQLALESGMACGYGACFGCVVPTRHGYVRLCVDGPVLDAADLELVA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 7.97
Rhizosphere 86.47
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000104 3300003373 Bacteria 11688
2 Ga0070658_10044192 3300005327 Bacteria 3600
3 Ga0070676_10033212 3300005328 Bacteria 2960
4 Ga0070690_100166939 3300005330 Bacteria 1512
5 Ga0068869_100246279 3300005334 Bacteria 1426
6 Ga0068869_100284261 3300005334 Bacteria 1331
7 Ga0070682_100487761 3300005337 Bacteria 952
8 Ga0068868_100034159 3300005338 Bacteria 3925
9 Ga0068868_100228102 3300005338 Bacteria 1562
10 Ga0068868_100467029 3300005338 Bacteria 1100
11 Ga0068868_100469814 3300005338 Bacteria 1097
12 Ga0070660_100013660 3300005339 Bacteria 5835
13 Ga0070689_100030202 3300005340 Bacteria 4111
14 Ga0070692_10130630 3300005345 Unclassified 1411
15 Ga0070668_100004131 3300005347 Bacteria 10752
16 Ga0070668_100459793 3300005347 Bacteria 1096
17 Ga0070675_100599465 3300005354 Bacteria 999
18 Ga0070675_100675083 3300005354 Bacteria 940
19 Ga0070674_100075910 3300005356 Bacteria 2388
20 Ga0070674_100155327 3300005356 Bacteria 1731
21 Ga0070674_100459282 3300005356 Bacteria 1053
22 Ga0070659_100152347 3300005366 Bacteria 1887
23 Ga0070659_100157021 3300005366 Bacteria 1858
24 Ga0070659_100239836 3300005366 Unclassified 1500
25 Ga0070709_10097469 3300005434 Bacteria 1952
26 Ga0070714_100041837 3300005435 Bacteria 3869
27 Ga0070714_100147879 3300005435 Bacteria 2114
28 Ga0070714_100277235 3300005435 Bacteria 1557
29 Ga0070713_100017122 3300005436 Bacteria 5471
30 Ga0070713_100033761 3300005436 Bacteria 4102
31 Ga0070713_100057290 3300005436 Bacteria 3244
32 Ga0070713_100278813 3300005436 Bacteria 1533
33 Ga0070710_10003145 3300005437 Bacteria 7830
34 Ga0070711_100000367 3300005439 Bacteria 23337
35 Ga0070711_100018141 3300005439 Bacteria 4489
36 Ga0070711_100062542 3300005439 Bacteria 2595
37 Ga0070711_100081016 3300005439 Bacteria 2312
38 Ga0070700_100004871 3300005441 Bacteria 7054
39 Ga0070700_100025734 3300005441 Bacteria 3468
40 Ga0070694_100350937 3300005444 Bacteria 1143
41 Ga0070678_100413166 3300005456 Bacteria 1175
42 Ga0070662_100003463 3300005457 Bacteria 9844
43 Ga0070662_100420298 3300005457 Bacteria 1106
44 Ga0068867_100053675 3300005459 Bacteria 2977
45 Ga0070679_100250371 3300005530 Bacteria 1728
46 Ga0070684_100157621 3300005535 Bacteria 2059
47 Ga0070696_100053531 3300005546 Bacteria 2810
48 Ga0070704_100167830 3300005549 Bacteria 1742
49 Ga0070664_100067647 3300005564 Bacteria 3053
50 Ga0070664_100128875 3300005564 Bacteria 2221
51 Ga0070664_100163435 3300005564 Bacteria 1971
52 Ga0070664_100574744 3300005564 Unclassified 1044
53 Ga0068854_100068588 3300005578 Bacteria 2586
54 Ga0068854_100111317 3300005578 Bacteria 2066
55 Ga0068856_100079119 3300005614 Bacteria 3260
56 Ga0070702_100022208 3300005615 Bacteria 3350
57 Ga0068852_100018425 3300005616 Bacteria 5499
58 Ga0068852_100149700 3300005616 Bacteria 2169
59 Ga0068859_100295535 3300005617 Bacteria 1713
60 Ga0068864_100118904 3300005618 Bacteria 2360
61 Ga0068864_100275856 3300005618 Bacteria 1568
62 Ga0068864_100504068 3300005618 Bacteria 1165
63 Ga0068866_10231850 3300005718 Bacteria 1120
64 Ga0068861_100004867 3300005719 Bacteria 9035
65 Ga0068861_100241848 3300005719 Bacteria 1535
66 Ga0068861_100248197 3300005719 Bacteria 1517
67 Ga0068870_10156932 3300005840 Bacteria 1346
68 Ga0068860_100492454 3300005843 Bacteria 1223
69 Ga0068862_100176250 3300005844 Bacteria 1917
70 Ga0081455_10088983 3300005937 Bacteria 2507
71 Ga0081455_10193211 3300005937 Bacteria 1531
72 Ga0081538_10000020 3300005981 Bacteria 139567
73 Ga0081538_10000200 3300005981 Bacteria 66229
74 Ga0081538_10000316 3300005981 Bacteria 55223
75 Ga0081538_10003700 3300005981 Bacteria 14350
76 Ga0081538_10004147 3300005981 Bacteria 13446
77 Ga0081538_10004968 3300005981 Bacteria 12112
78 Ga0081538_10012346 3300005981 Bacteria 6851
79 Ga0081538_10040073 3300005981 Bacteria 2994
80 Ga0081538_10054571 3300005981 Bacteria 2362
81 Ga0081538_10069468 3300005981 Bacteria 1951
82 Ga0081539_10000740 3300005985 Bacteria 65387
83 Ga0070717_10016877 3300006028 Bacteria 5668
84 Ga0070717_10027656 3300006028 Bacteria 4533
85 Ga0070717_10099370 3300006028 Bacteria 2469
86 Ga0075365_10211755 3300006038 Bacteria 1359
87 Ga0075432_10056610 3300006058 Bacteria 1390
88 Ga0070712_100001502 3300006175 Bacteria 14230
89 Ga0070712_100264254 3300006175 Bacteria 1380
90 Ga0075428_100010932 3300006844 Bacteria 10097
91 Ga0075428_100032178 3300006844 Bacteria 5793
92 Ga0075428_100108220 3300006844 Bacteria 3030
93 Ga0075430_100001805 3300006846 Bacteria 17508
94 Ga0075430_100100771 3300006846 Unclassified 2412
95 Ga0075430_100233758 3300006846 Bacteria 1524
96 Ga0075431_100094637 3300006847 Bacteria 3083
97 Ga0075431_100152081 3300006847 Bacteria 2383
98 Ga0075434_100048449 3300006871 Bacteria 4216
99 Ga0075429_100009710 3300006880 Bacteria 8341
100 Ga0068865_100024420 3300006881 Bacteria 3966
101 Ga0068865_100284403 3300006881 Bacteria 1318
102 Ga0097620_100295558 3300006931 Bacteria 1713
103 Ga0075435_100126163 3300007076 Bacteria 2139
104 Ga0111539_10037441 3300009094 Bacteria 5858
105 Ga0111539_10464088 3300009094 Bacteria 1474
106 Ga0105245_10020088 3300009098 Bacteria 5855
107 Ga0105245_10132909 3300009098 Bacteria 2336
108 Ga0105245_10211469 3300009098 Bacteria 1867
109 Ga0105245_10251512 3300009098 Bacteria 1717
110 Ga0105245_10530817 3300009098 Bacteria 1197
111 Ga0105245_10575586 3300009098 Bacteria 1150
112 Ga0114129_10000835 3300009147 Bacteria 39878
113 Ga0114129_10213475 3300009147 Bacteria 2608
114 Ga0105243_10071116 3300009148 Bacteria 2812
115 Ga0105243_10508603 3300009148 Bacteria 1143
116 Ga0105242_10196461 3300009176 Bacteria 1789
117 Ga0105242_10251996 3300009176 Bacteria 1591
118 Ga0105237_10001691 3300009545 Bacteria 28560
119 Ga0105249_10104653 3300009553 Bacteria 2667
120 Ga0105249_10222720 3300009553 Bacteria 1857
121 Ga0105239_10128358 3300010375 Bacteria 2819
122 Ga0105246_10134541 3300011119 Bacteria 1851
123 Ga0163162_10109267 3300013306 Bacteria 2862
124 Ga0157372_10511559 3300013307 Bacteria 1400
125 Ga0157372_11140337 3300013307 Bacteria 902
126 Ga0157375_10260242 3300013308 Bacteria 1897
127 Ga0157380_10104376 3300014326 Bacteria 2367
128 Ga0157377_10015281 3300014745 Bacteria 3923
129 Ga0157377_10112497 3300014745 Bacteria 1638
130 Ga0213874_10056256 3300021377 Bacteria 1221
131 Ga0213876_10002523 3300021384 Bacteria 10717
132 Ga0213876_10092895 3300021384 Bacteria 1598
133 Ga0213876_10156852 3300021384 Bacteria 1211
134 Ga0213875_10022784 3300021388 Bacteria 2995
135 Ga0213875_10027075 3300021388 Bacteria 2727
136 Ga0213875_10040407 3300021388 Bacteria 2196
137 Ga0213875_10043707 3300021388 Bacteria 2103
138 Ga0207656_10112413 3300025321 Bacteria 1260
139 Ga0207688_10108072 3300025901 Bacteria 1612
140 Ga0207699_10021907 3300025906 Bacteria 3453
141 Ga0207699_10037054 3300025906 Bacteria 2785
142 Ga0207645_10048809 3300025907 Bacteria 2704
143 Ga0207643_10166041 3300025908 Bacteria 1330
144 Ga0207643_10221780 3300025908 Bacteria 1157
145 Ga0207705_10086747 3300025909 Bacteria 2288
146 Ga0207671_10003382 3300025914 Bacteria 15964
147 Ga0207671_10287618 3300025914 Bacteria 1297
148 Ga0207693_10003814 3300025915 Bacteria 12835
149 Ga0207693_10010589 3300025915 Bacteria 7483
150 Ga0207693_10078913 3300025915 Bacteria 2576
151 Ga0207663_10004281 3300025916 Bacteria 7084
152 Ga0207663_10142829 3300025916 Bacteria 1670
153 Ga0207662_10167612 3300025918 Bacteria 1407
154 Ga0207657_10019757 3300025919 Bacteria 6386
155 Ga0207657_10147734 3300025919 Bacteria 1916
156 Ga0207657_10153583 3300025919 Bacteria 1873
157 Ga0207657_10291643 3300025919 Bacteria 1294
158 Ga0207652_10236109 3300025921 Bacteria 1648
159 Ga0207681_10144253 3300025923 Bacteria 1777
160 Ga0207659_10702695 3300025926 Bacteria 866
161 Ga0207687_10006036 3300025927 Bacteria 8014
162 Ga0207687_10044424 3300025927 Bacteria 3066
163 Ga0207700_10063761 3300025928 Bacteria 2804
164 Ga0207700_10137863 3300025928 Bacteria 2001
165 Ga0207664_10027281 3300025929 Bacteria 4327
166 Ga0207664_10096425 3300025929 Bacteria 2434
167 Ga0207664_10290889 3300025929 Bacteria 1436
168 Ga0207690_10111002 3300025932 Bacteria 1975
169 Ga0207690_10234381 3300025932 Unclassified 1411
170 Ga0207690_10434258 3300025932 Bacteria 1053
171 Ga0207706_10001927 3300025933 Bacteria 20384
172 Ga0207706_10070993 3300025933 Bacteria 3063
173 Ga0207706_10074102 3300025933 Bacteria 2993
174 Ga0207709_10124435 3300025935 Bacteria 1747
175 Ga0207670_10275158 3300025936 Bacteria 1310
176 Ga0207669_10011399 3300025937 Bacteria 4324
177 Ga0207669_10085877 3300025937 Bacteria 2033
178 Ga0207669_10389663 3300025937 Bacteria 1088
179 Ga0207669_10440919 3300025937 Bacteria 1030
180 Ga0207704_10094824 3300025938 Bacteria 1971
181 Ga0207689_10024766 3300025942 Bacteria 5031
182 Ga0207679_10104566 3300025945 Bacteria 2222
183 Ga0207679_10329608 3300025945 Bacteria 1324
184 Ga0207679_10685262 3300025945 Bacteria 929
185 Ga0207712_10012049 3300025961 Bacteria 5522
186 Ga0207712_10125885 3300025961 Bacteria 1945
187 Ga0207668_10114891 3300025972 Bacteria 2027
188 Ga0207640_10091365 3300025981 Bacteria 2109
189 Ga0207640_10120665 3300025981 Unclassified 1877
190 Ga0207640_10442408 3300025981 Bacteria 1069
191 Ga0207677_10067269 3300026023 Bacteria 2509
192 Ga0207677_10486001 3300026023 Bacteria 1065
193 Ga0207703_10064988 3300026035 Bacteria 2997
194 Ga0207678_10284013 3300026067 Bacteria 1421
195 Ga0207708_10031489 3300026075 Bacteria 4026
196 Ga0207708_10039138 3300026075 Bacteria 3612
197 Ga0207708_10213929 3300026075 Bacteria 1542
198 Ga0207708_10282292 3300026075 Bacteria 1346
199 Ga0207702_10090892 3300026078 Bacteria 2672
200 Ga0207702_10499529 3300026078 Bacteria 1186
201 Ga0207648_10429191 3300026089 Bacteria 1201
202 Ga0207676_10084207 3300026095 Bacteria 2592
203 Ga0207676_10266451 3300026095 Bacteria 1549
204 Ga0207676_10412600 3300026095 Bacteria 1265
205 Ga0207676_10603723 3300026095 Bacteria 1054
206 Ga0207675_100005544 3300026118 Bacteria 12074
207 Ga0207675_100006758 3300026118 Bacteria 10850
208 Ga0207675_100044161 3300026118 Bacteria 4163
209 Ga0207675_100455227 3300026118 Bacteria 1269
210 Ga0207683_10231536 3300026121 Bacteria 1685
211 Ga0207698_10145417 3300026142 Bacteria 2049
212 Ga0207428_10027689 3300027907 Bacteria 4717
213 Ga0268265_10110167 3300028380 Bacteria 2246
214 Ga0268265_10200559 3300028380 Bacteria 1731
215 Ga0268264_10335569 3300028381 Bacteria 1434
216 Ga0268264_10425392 3300028381 Bacteria 1282
217 Ga0265337_1006803 3300028556 Bacteria 4353
218 Ga0265326_10000757 3300028558 Bacteria 11956
219 Ga0265336_10000005 3300028666 Bacteria 399349
220 Ga0265338_10000001 3300028800 Bacteria 1177449
221 Ga0265320_10091913 3300031240 Unclassified 1405
222 Ga0265340_10000001 3300031247 Bacteria 1647668
223 Ga0265316_10020617 3300031344 Bacteria 5606
224 Ga0307408_100074462 3300031548 Bacteria 2520
225 Ga0307405_10029591 3300031731 Bacteria 3203
226 Ga0307405_10029891 3300031731 Bacteria 3189
227 Ga0307413_10045415 3300031824 Bacteria 2604
228 Ga0307410_10167127 3300031852 Bacteria 1654
229 Ga0307407_10023496 3300031903 Bacteria 3218
230 Ga0307409_100032591 3300031995 Bacteria 3780
231 Ga0307409_100045864 3300031995 Bacteria 3304
232 Ga0307409_100297490 3300031995 Bacteria 1500
233 Ga0307416_100013484 3300032002 Bacteria 5558
234 Ga0307416_100067960 3300032002 Bacteria 2942
235 Ga0307416_100073191 3300032002 Bacteria 2856
236 Ga0307416_100081848 3300032002 Bacteria 2732
237 Ga0307416_100188798 3300032002 Bacteria 1941
238 Ga0307416_100221893 3300032002 Bacteria 1814
239 Ga0307415_100017082 3300032126 Bacteria 4342
240 Ga0307415_100038639 3300032126 Bacteria 3148
241 Ga0307415_100133996 3300032126 Bacteria 1881
242 Ga0373941_0032208 3300035115 Bacteria 1568
243 Ga0373924_0030136 3300035410 Bacteria 2173
244 Ga0373937_0028475 3300036401 Bacteria 5055
245 Ga0395898_0042538 3300037466 Bacteria 4481
246 Ga0436364_0250824 3300037853 Bacteria 11934
247 Ga0436364_0806595 3300037853 Bacteria 20547
248 Ga0436364_1110324 3300037853 Bacteria 6404
249 Ga0436364_1329882 3300037853 Bacteria 6495
250 Ga0436364_1461289 3300037853 Unclassified 1184
251 Ga0395901_0281943 3300038443 Bacteria 1726
252 Ga0395901_0550127 3300038443 Unclassified 1170
253 Ga0436365_0179721 3300039437 Bacteria 17630
254 Ga0436365_0279903 3300039437 Bacteria 1883
255 Ga0436365_0461596 3300039437 Bacteria 1540
256 Ga0436365_0694342 3300039437 Bacteria 3805
257 Ga0436365_1168763 3300039437 Bacteria 90017
258 Ga0436365_1299316 3300039437 Bacteria 2404
259 Ga0436365_1682275 3300039437 Bacteria 5065
260 Ga0436360_0102967 3300039438 Bacteria 4368
261 Ga0436361_0229899 3300039447 Bacteria 1896
262 Ga0436363_0357892 3300039450 Bacteria 5705
263 Ga0436363_1280964 3300039450 Bacteria 1761
264 Ga0436362_0415766 3300039453 Bacteria 2665
265 Ga0436362_0417629 3300039453 Bacteria 1927
266 Ga0436362_1299361 3300039453 Bacteria 1757
267 Ga0439463_056862 3300042016 Bacteria 999
268 Ga0439459_0054592 3300042438 Bacteria 887
269 Ga0466966_0065629 3300044684 Bacteria 2282
270 Ga0466966_0090837 3300044684 Bacteria 1896
271 Ga0466963_0000353 3300044694 Bacteria 20819
272 Ga0466963_0012614 3300044694 Bacteria 5176
273 Ga0466963_0218563 3300044694 Bacteria 1334
274 Ga0466963_0285130 3300044694 Bacteria 1161
275 Ga0466963_0375977 3300044694 Bacteria 1001
276 Ga0466964_0010023 3300044706 Bacteria 3571
277 Ga0466964_0091931 3300044706 Bacteria 1322
278 Ga0466968_0017568 3300044735 Bacteria 2860
279 Ga0466970_0158803 3300044765 Bacteria 1250
280 Ga0466957_0037303 3300044842 Bacteria 2926
281 Ga0466957_0045749 3300044842 Bacteria 2655
282 Ga0466957_0124587 3300044842 Bacteria 1645
283 Ga0466957_0323152 3300044842 Bacteria 1042
284 Ga0466957_0508149 3300044842 Bacteria 836
285 Ga0466959_0066355 3300045049 Bacteria 2618
286 Ga0466959_0208589 3300045049 Bacteria 1358
287 Ga0466958_0008197 3300045836 Bacteria 5788
288 Ga0466958_0036094 3300045836 Bacteria 2957
289 Ga0466958_0041607 3300045836 Bacteria 2764
290 Ga0466958_0063302 3300045836 Bacteria 2256
291 Ga0466958_0068564 3300045836 Bacteria 2168
292 Ga0466958_0362954 3300045836 Unclassified 933
293 Ga0466967_0038855 3300045976 Bacteria 4085
294 Ga0466967_0044590 3300045976 Bacteria 3847
295 Ga0466967_0056406 3300045976 Bacteria 3463
296 Ga0466967_0057237 3300045976 Bacteria 3441
297 Ga0466967_0076074 3300045976 Bacteria 3018
298 Ga0466967_0144375 3300045976 Bacteria 2219
299 Ga0466967_0144855 3300045976 Bacteria 2215
300 Ga0466967_0226648 3300045976 Bacteria 1778
301 Ga0466967_0239977 3300045976 Bacteria 1729
302 Ga0466967_0651691 3300045976 Bacteria 1041
303 Ga0495592_0028185 3300046454 Bacteria 4254
304 Ga0495629_0069598 3300046459 Bacteria 2456
305 Ga0495641_0003185 3300046461 Bacteria 12481
306 Ga0495651_0165564 3300046462 Bacteria 1579
307 Ga0495653_0004886 3300046463 Bacteria 10878
308 Ga0495582_0152634 3300046473 Unclassified 1312
309 Ga0495596_0030336 3300046500 Bacteria 2165
310 Ga0495596_0033283 3300046500 Bacteria 2051
311 Ga0495608_0004288 3300046511 Bacteria 10213
312 Ga0495608_0138056 3300046511 Bacteria 1557
313 Ga0495616_0103095 3300046513 Unclassified 1336
314 Ga0495618_0006981 3300046514 Bacteria 6842
315 Ga0495620_0102881 3300046515 Bacteria 1137
316 Ga0495630_0076709 3300046517 Unclassified 2519
317 Ga0495630_0311280 3300046517 Unclassified 1204
318 Ga0495644_0007197 3300046523 Bacteria 4301
319 Ga0495652_0158448 3300046529 Bacteria 1760
320 Ga0495652_0174498 3300046529 Bacteria 1656
321 Ga0495652_0392069 3300046529 Unclassified 985
322 Ga0495667_0001111 3300046559 Bacteria 17502
323 Ga0495667_0047999 3300046559 Bacteria 2820
324 Ga0495656_0005566 3300046615 Bacteria 4354
325 Ga0495656_0249065 3300046615 Bacteria 897
326 Ga0495634_0026263 3300046642 Bacteria 4066
327 Ga0495635_0001554 3300046663 Bacteria 15406
328 Ga0495635_0264253 3300046663 Unclassified 1158
329 Ga0495657_0012804 3300046675 Bacteria 6218
330 Ga0495646_0014007 3300046680 Bacteria 5098
331 Ga0495658_0035386 3300046683 Unclassified 2747
332 Ga0495600_0002541 3300046809 Bacteria 10504
333 Ga0495581_0125140 3300047315 Unclassified 1497
334 Ga0495604_0000180 3300047317 Bacteria 56391
335 Ga0495604_0004495 3300047317 Bacteria 11052
336 Ga0495674_0017347 3300047319 Bacteria 6699
337 Ga0495674_0227368 3300047319 Bacteria 1541
338 Ga0495680_0005098 3300047322 Bacteria 12401
339 Ga0495675_0048441 3300047444 Bacteria 2703
340 Ga0495673_0017657 3300047469 Bacteria 3615
341 Ga0495684_0004885 3300047471 Bacteria 10458
342 Ga0495686_0000008 3300047472 Bacteria 727479
343 Ga0495686_0177871 3300047472 Unclassified 1234
344 Ga0495602_0098235 3300048088 Bacteria 2410
345 Ga0495615_0000883 3300048090 Bacteria 4233
346 Ga0496100_0011800 3300048903 Bacteria 4985
347 Ga0496101_0247035 3300048904 Bacteria 1390
348 Ga0496101_0376102 3300048904 Bacteria 1117
349 Ga0496102_0045886 3300048905 Bacteria 3968
350 Ga0496102_0136686 3300048905 Bacteria 2297
351 Ga0496104_0009869 3300048907 Bacteria 8521
352 Ga0496104_0035576 3300048907 Bacteria 4650
353 Ga0496104_0110818 3300048907 Bacteria 2631
354 Ga0496104_0420832 3300048907 Bacteria 1248
355 Ga0496105_0235979 3300048908 Bacteria 1485
356 Ga0496105_0556387 3300048908 Bacteria 895
357 Ga0496108_0149750 3300048911 Bacteria 2013
358 Ga0496108_0994300 3300048911 Unclassified 717
359 Ga0496109_0109868 3300048912 Bacteria 2563
360 Ga0496109_0328129 3300048912 Bacteria 1444
361 Ga0496109_0612678 3300048912 Unclassified 1025
362 Ga0496110_0125623 3300048913 Bacteria 2314
363 Ga0496110_0311747 3300048913 Bacteria 1433
364 Ga0496111_0050886 3300048914 Bacteria 2990
365 Ga0496112_0006150 3300048915 Bacteria 10494
366 Ga0496112_0079043 3300048915 Bacteria 3253
367 Ga0496112_0103362 3300048915 Bacteria 2819
368 Ga0496112_0300513 3300048915 Bacteria 1550
369 Ga0496112_0330656 3300048915 Bacteria 1468
370 Ga0496113_0065934 3300048916 Bacteria 2741
371 Ga0496113_0085902 3300048916 Bacteria 2417
372 Ga0496113_0086955 3300048916 Bacteria 2402
373 Ga0496113_0156620 3300048916 Bacteria 1799
374 Ga0496115_0000222 3300048918 Bacteria 52327
375 Ga0496115_0000245 3300048918 Bacteria 49174
376 Ga0496115_0051163 3300048918 Bacteria 3312
377 Ga0496115_0129459 3300048918 Bacteria 2080
378 Ga0496115_0355799 3300048918 Bacteria 1194
379 Ga0501031_0033727 3300049568 Bacteria 3341
380 Ga0501036_0239006 3300049572 Bacteria 1524
381 Ga0501039_0395798 3300049575 Bacteria 1085
382 Ga0501048_0026571 3300049582 Bacteria 4215
383 Ga0501072_0025344 3300049588 Bacteria 4620
384 Ga0501072_0212692 3300049588 Bacteria 1541
385 Ga0501074_0098289 3300049590 Bacteria 2095
386 Ga0501076_0011471 3300049592 Bacteria 6602
387 Ga0501076_0040630 3300049592 Bacteria 3656
388 Ga0501079_0027839 3300049741 Bacteria 4335
389 Ga0501081_0130849 3300049743 Bacteria 1793
390 Ga0501081_0255422 3300049743 Bacteria 1280
391 Ga0501044_0772465 3300049823 Bacteria 842
392 Ga0501045_0031660 3300049824 Bacteria 3830
393 Ga0501045_0189835 3300049824 Bacteria 1531
394 nmdc:mga05p37_20933_c1 3300050507 Bacteria 7917
395 nmdc:mga05p37_3242_c1 3300050507 Bacteria 18957
396 nmdc:mga09592_95454_c1 3300050508 Bacteria 2544
397 nmdc:mga0qj67_30263_c1 3300050509 Bacteria 4212
398 nmdc:mga0qj67_59158_c1 3300050509 Bacteria 3039
399 nmdc:mga06r32_208609_c1 3300050510 Bacteria 1941
400 nmdc:mga08y16_288500_c1 3300050511 Bacteria 1692
401 nmdc:mga08y16_55457_c1 3300050511 Bacteria 4141
402 nmdc:mga0n895_8288_c1 3300050512 Bacteria 8990
403 nmdc:mga08x19_527173_c1 3300050514 Bacteria 835
404 nmdc:mga0a205_271689_c1 3300050515 Bacteria 1572
405 Ga0495601_0038607 3300053077 Bacteria 2987
406 Ga0495612_0098910 3300053078 Bacteria 1241
407 Ga0495655_0088973 3300053083 Bacteria 897
408 Ga0495595_0003323 3300053084 Bacteria 6380
409 Ga0495619_0002957 3300053085 Bacteria 11034
410 Ga0501084_0346651 3300054114 Bacteria 1255
411 Ga0501084_0387093 3300054114 Bacteria 1181
412 Ga0466962_0113426 3300061719 Bacteria 1306
413 Ga0466962_0181470 3300061719 Bacteria 1026
414 Ga0530510_0002728 3300061734 Bacteria 12154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0068564 Ga0466958_0068564_1472_2128 216
2 3300050514 nmdc:mga08x19_527173_c1 nmdc:mga08x19_527173_c1_107_769 219
3 3300044684 Ga0466966_0090837 Ga0466966_0090837_1154_1834 220
4 3300046529 Ga0495652_0392069 Ga0495652_0392069_288_959 221
5 3300048911 Ga0496108_0994300 Ga0496108_0994300_31_705 221
6 3300037853 Ga0436364_1461289 Ga0436364_1461289_428_1102 222
7 3300045836 Ga0466958_0036094 Ga0466958_0036094_2254_2928 222
8 3300046615 Ga0495656_0005566 Ga0495656_0005566_3649_4344 226
9 3300005937 Ga0081455_10088983 Ga0081455_100889832 230
10 3300025921 Ga0207652_10236109 Ga0207652_102361092 230
11 3300026089 Ga0207648_10429191 Ga0207648_104291912 231
12 3300048915 Ga0496112_0079043 Ga0496112_0079043_1421_2143 231
13 3300005985 Ga0081539_10000740 Ga0081539_1000074058 233
14 3300039453 Ga0436362_0415766 Ga0436362_0415766_79_951 234
15 3300049741 Ga0501079_0027839 Ga0501079_0027839_1025_1768 234
16 3300021384 Ga0213876_10002523 Ga0213876_1000252310 236
17 3300039437 Ga0436365_0179721 Ga0436365_0179721_8094_8930 236
18 3300039453 Ga0436362_1299361 Ga0436362_1299361_589_1425 236
19 3300028381 Ga0268264_10425392 Ga0268264_104253922 237
20 3300005338 Ga0068868_100228102 Ga0068868_1002281022 238
21 3300009098 Ga0105245_10251512 Ga0105245_102515122 238
22 3300009176 Ga0105242_10196461 Ga0105242_101964612 238
23 3300026023 Ga0207677_10486001 Ga0207677_104860011 238
24 3300046615 Ga0495656_0249065 Ga0495656_0249065_158_886 238
25 3300048904 Ga0496101_0376102 Ga0496101_0376102_123_875 238
26 3300048911 Ga0496108_0149750 Ga0496108_0149750_461_1213 238
27 3300048912 Ga0496109_0109868 Ga0496109_0109868_1730_2482 238
28 3300048913 Ga0496110_0311747 Ga0496110_0311747_119_877 238
29 3300048914 Ga0496111_0050886 Ga0496111_0050886_1194_1946 238
30 3300048915 Ga0496112_0300513 Ga0496112_0300513_82_834 238
31 3300048916 Ga0496113_0065934 Ga0496113_0065934_581_1333 238
32 3300005354 Ga0070675_100675083 Ga0070675_1006750831 239
33 3300005535 Ga0070684_100157621 Ga0070684_1001576211 239
34 3300025926 Ga0207659_10702695 Ga0207659_107026951 239
35 3300026095 Ga0207676_10084207 Ga0207676_100842072 239
36 3300037466 Ga0395898_0042538 Ga0395898_0042538_3150_3902 239
37 3300038443 Ga0395901_0281943 Ga0395901_0281943_516_1268 239
38 3300048907 Ga0496104_0009869 Ga0496104_0009869_5272_6030 239
39 3300045836 Ga0466958_0041607 Ga0466958_0041607_383_1165 240
40 3300005330 Ga0070690_100166939 Ga0070690_1001669392 241
41 3300009098 Ga0105245_10132909 Ga0105245_101329092 241
42 3300005457 Ga0070662_100420298 Ga0070662_1004202981 242
43 3300025908 Ga0207643_10221780 Ga0207643_102217802 242
44 3300025933 Ga0207706_10070993 Ga0207706_100709932 242
45 3300027907 Ga0207428_10027689 Ga0207428_100276892 242
46 3300031548 Ga0307408_100074462 Ga0307408_1000744622 242
47 3300031731 Ga0307405_10029891 Ga0307405_100298912 242
48 3300032002 Ga0307416_100081848 Ga0307416_1000818482 242
49 3300032126 Ga0307415_100017082 Ga0307415_1000170822 242
50 3300044694 Ga0466963_0218563 Ga0466963_0218563_189_956 242
51 3300044706 Ga0466964_0010023 Ga0466964_0010023_1428_2195 242
52 3300045976 Ga0466967_0038855 Ga0466967_0038855_887_1654 242
53 3300048912 Ga0496109_0612678 Ga0496109_0612678_128_904 242
54 3300049582 Ga0501048_0026571 Ga0501048_0026571_372_1196 242
55 3300005337 Ga0070682_100487761 Ga0070682_1004877611 243
56 3300005338 Ga0068868_100467029 Ga0068868_1004670292 243
57 3300005564 Ga0070664_100574744 Ga0070664_1005747442 243
58 3300025937 Ga0207669_10440919 Ga0207669_104409192 243
59 3300025945 Ga0207679_10329608 Ga0207679_103296082 243
60 3300026121 Ga0207683_10231536 Ga0207683_102315362 243
61 3300031731 Ga0307405_10029591 Ga0307405_100295912 243
62 3300031824 Ga0307413_10045415 Ga0307413_100454152 243
63 3300031852 Ga0307410_10167127 Ga0307410_101671272 243
64 3300031903 Ga0307407_10023496 Ga0307407_100234962 243
65 3300031995 Ga0307409_100032591 Ga0307409_1000325912 243
66 3300032002 Ga0307416_100013484 Ga0307416_1000134842 243
67 3300032126 Ga0307415_100038639 Ga0307415_1000386392 243
68 3300005327 Ga0070658_10044192 Ga0070658_100441922 244
69 3300005339 Ga0070660_100013660 Ga0070660_1000136606 244
70 3300005981 Ga0081538_10012346 Ga0081538_100123463 244
71 3300009098 Ga0105245_10530817 Ga0105245_105308172 244
72 3300009553 Ga0105249_10222720 Ga0105249_102227202 244
73 3300025909 Ga0207705_10086747 Ga0207705_100867472 244
74 3300025919 Ga0207657_10019757 Ga0207657_100197578 244
75 3300025919 Ga0207657_10147734 Ga0207657_101477342 244
76 3300025961 Ga0207712_10125885 Ga0207712_101258852 244
77 3300026067 Ga0207678_10284013 Ga0207678_102840132 244
78 3300049568 Ga0501031_0033727 Ga0501031_0033727_463_1338 244
79 3300049592 Ga0501076_0040630 Ga0501076_0040630_2357_3232 244
80 3300049824 Ga0501045_0189835 Ga0501045_0189835_39_1016 244
81 3300005456 Ga0070678_100413166 Ga0070678_1004131662 245
82 3300005564 Ga0070664_100128875 Ga0070664_1001288751 245
83 3300005564 Ga0070664_100163435 Ga0070664_1001634352 245
84 3300005578 Ga0068854_100111317 Ga0068854_1001113172 245
85 3300005618 Ga0068864_100504068 Ga0068864_1005040682 245
86 3300025981 Ga0207640_10091365 Ga0207640_100913652 245
87 3300026095 Ga0207676_10603723 Ga0207676_106037232 245
88 3300042438 Ga0439459_0054592 Ga0439459_0054592_80_829 245
89 3300044842 Ga0466957_0124587 Ga0466957_0124587_58_849 245
90 3300045976 Ga0466967_0144375 Ga0466967_0144375_978_1754 245
91 3300047472 Ga0495686_0177871 Ga0495686_0177871_153_908 245
92 3300053083 Ga0495655_0088973 Ga0495655_0088973_10_795 245
93 3300061719 Ga0466962_0181470 Ga0466962_0181470_58_849 245
94 3300005334 Ga0068869_100284261 Ga0068869_1002842612 246
95 3300005441 Ga0070700_100004871 Ga0070700_1000048714 246
96 3300005616 Ga0068852_100149700 Ga0068852_1001497002 246
97 3300005618 Ga0068864_100275856 Ga0068864_1002758562 246
98 3300005719 Ga0068861_100248197 Ga0068861_1002481972 246
99 3300006881 Ga0068865_100024420 Ga0068865_1000244202 246
100 3300014745 Ga0157377_10112497 Ga0157377_101124972 246
101 3300021384 Ga0213876_10092895 Ga0213876_100928952 246
102 3300025938 Ga0207704_10094824 Ga0207704_100948242 246
103 3300026035 Ga0207703_10064988 Ga0207703_100649883 246
104 3300026075 Ga0207708_10031489 Ga0207708_100314892 246
105 3300026095 Ga0207676_10412600 Ga0207676_104126002 246
106 3300026118 Ga0207675_100044161 Ga0207675_1000441613 246
107 3300028381 Ga0268264_10335569 Ga0268264_103355692 246
108 3300031995 Ga0307409_100045864 Ga0307409_1000458642 246
109 3300032002 Ga0307416_100073191 Ga0307416_1000731912 246
110 3300032002 Ga0307416_100221893 Ga0307416_1002218932 246
111 3300039437 Ga0436365_0279903 Ga0436365_0279903_509_1303 246
112 3300039453 Ga0436362_0417629 Ga0436362_0417629_49_843 246
113 3300045976 Ga0466967_0239977 Ga0466967_0239977_225_1004 246
114 3300048904 Ga0496101_0247035 Ga0496101_0247035_57_884 246
115 3300048905 Ga0496102_0045886 Ga0496102_0045886_166_951 246
116 3300049572 Ga0501036_0239006 Ga0501036_0239006_233_1045 246
117 3300049575 Ga0501039_0395798 Ga0501039_0395798_244_1056 246
118 3300049588 Ga0501072_0212692 Ga0501072_0212692_242_1054 246
119 3300049743 Ga0501081_0130849 Ga0501081_0130849_535_1347 246
120 3300049823 Ga0501044_0772465 Ga0501044_0772465_11_823 246
121 3300005338 Ga0068868_100469814 Ga0068868_1004698141 247
122 3300005436 Ga0070713_100057290 Ga0070713_1000572901 247
123 3300005530 Ga0070679_100250371 Ga0070679_1002503712 247
124 3300005981 Ga0081538_10054571 Ga0081538_100545712 247
125 3300006844 Ga0075428_100108220 Ga0075428_1001082202 247
126 3300006846 Ga0075430_100233758 Ga0075430_1002337582 247
127 3300009094 Ga0111539_10037441 Ga0111539_100374412 247
128 3300025919 Ga0207657_10291643 Ga0207657_102916432 247
129 3300026075 Ga0207708_10213929 Ga0207708_102139291 247
130 3300026078 Ga0207702_10499529 Ga0207702_104995291 247
131 3300035115 Ga0373941_0032208 Ga0373941_0032208_421_1245 247
132 3300045976 Ga0466967_0044590 Ga0466967_0044590_317_1099 247
133 3300048915 Ga0496112_0330656 Ga0496112_0330656_636_1421 247
134 3300049743 Ga0501081_0255422 Ga0501081_0255422_118_921 247
135 3300050507 nmdc:mga05p37_20933_c1 nmdc:mga05p37_20933_c1_5627_6391 247
136 3300050509 nmdc:mga0qj67_30263_c1 nmdc:mga0qj67_30263_c1_721_1485 247
137 3300050511 nmdc:mga08y16_55457_c1 nmdc:mga08y16_55457_c1_3037_3861 247
138 3300054114 Ga0501084_0346651 Ga0501084_0346651_406_1209 247
139 3300005439 Ga0070711_100062542 Ga0070711_1000625422 248
140 3300005549 Ga0070704_100167830 Ga0070704_1001678302 248
141 3300006175 Ga0070712_100264254 Ga0070712_1002642541 248
142 3300006844 Ga0075428_100010932 Ga0075428_1000109329 248
143 3300006846 Ga0075430_100001805 Ga0075430_10000180510 248
144 3300006871 Ga0075434_100048449 Ga0075434_1000484496 248
145 3300006880 Ga0075429_100009710 Ga0075429_1000097102 248
146 3300007076 Ga0075435_100126163 Ga0075435_1001261632 248
147 3300009147 Ga0114129_10000835 Ga0114129_100008359 248
148 3300025915 Ga0207693_10078913 Ga0207693_100789131 248
149 3300026118 Ga0207675_100455227 Ga0207675_1004552272 248
150 3300048915 Ga0496112_0103362 Ga0496112_0103362_1215_1997 248
151 3300048916 Ga0496113_0085902 Ga0496113_0085902_242_1024 248
152 3300050507 nmdc:mga05p37_3242_c1 nmdc:mga05p37_3242_c1_6732_7514 248
153 3300050508 nmdc:mga09592_95454_c1 nmdc:mga09592_95454_c1_1324_2154 248
154 3300050509 nmdc:mga0qj67_59158_c1 nmdc:mga0qj67_59158_c1_45_875 248
155 3300050512 nmdc:mga0n895_8288_c1 nmdc:mga0n895_8288_c1_7045_7827 248
156 3300050515 nmdc:mga0a205_271689_c1 nmdc:mga0a205_271689_c1_746_1528 248
157 3300005356 Ga0070674_100075910 Ga0070674_1000759102 249
158 3300005434 Ga0070709_10097469 Ga0070709_100974692 249
159 3300005436 Ga0070713_100017122 Ga0070713_1000171222 249
160 3300005437 Ga0070710_10003145 Ga0070710_100031452 249
161 3300005439 Ga0070711_100018141 Ga0070711_1000181412 249
162 3300005459 Ga0068867_100053675 Ga0068867_1000536752 249
163 3300005843 Ga0068860_100492454 Ga0068860_1004924542 249
164 3300006028 Ga0070717_10027656 Ga0070717_100276562 249
165 3300006175 Ga0070712_100001502 Ga0070712_1000015024 249
166 3300009148 Ga0105243_10071116 Ga0105243_100711164 249
167 3300025906 Ga0207699_10037054 Ga0207699_100370542 249
168 3300025915 Ga0207693_10010589 Ga0207693_100105895 249
169 3300025929 Ga0207664_10096425 Ga0207664_100964252 249
170 3300025935 Ga0207709_10124435 Ga0207709_101244352 249
171 3300025937 Ga0207669_10011399 Ga0207669_100113996 249
172 3300035410 Ga0373924_0030136 Ga0373924_0030136_1286_2089 249
173 3300036401 Ga0373937_0028475 Ga0373937_0028475_2797_3600 249
174 3300039437 Ga0436365_1299316 Ga0436365_1299316_970_1755 249
175 3300044842 Ga0466957_0037303 Ga0466957_0037303_1877_2707 249
176 3300046454 Ga0495592_0028185 Ga0495592_0028185_1005_1808 249
177 3300046459 Ga0495629_0069598 Ga0495629_0069598_1003_1806 249
178 3300046462 Ga0495651_0165564 Ga0495651_0165564_193_996 249
179 3300046463 Ga0495653_0004886 Ga0495653_0004886_317_1120 249
180 3300046473 Ga0495582_0152634 Ga0495582_0152634_176_979 249
181 3300046511 Ga0495608_0004288 Ga0495608_0004288_2492_3295 249
182 3300046514 Ga0495618_0006981 Ga0495618_0006981_930_1733 249
183 3300046517 Ga0495630_0311280 Ga0495630_0311280_300_1103 249
184 3300046529 Ga0495652_0158448 Ga0495652_0158448_33_836 249
185 3300046559 Ga0495667_0001111 Ga0495667_0001111_14567_15370 249
186 3300046642 Ga0495634_0026263 Ga0495634_0026263_835_1638 249
187 3300046663 Ga0495635_0001554 Ga0495635_0001554_12182_12985 249
188 3300046675 Ga0495657_0012804 Ga0495657_0012804_4869_5672 249
189 3300046680 Ga0495646_0014007 Ga0495646_0014007_645_1448 249
190 3300046809 Ga0495600_0002541 Ga0495600_0002541_5445_6248 249
191 3300047315 Ga0495581_0125140 Ga0495581_0125140_253_1056 249
192 3300047317 Ga0495604_0004495 Ga0495604_0004495_3657_4460 249
193 3300047319 Ga0495674_0227368 Ga0495674_0227368_67_870 249
194 3300047322 Ga0495680_0005098 Ga0495680_0005098_2491_3294 249
195 3300047444 Ga0495675_0048441 Ga0495675_0048441_657_1460 249
196 3300047471 Ga0495684_0004885 Ga0495684_0004885_547_1350 249
197 3300048088 Ga0495602_0098235 Ga0495602_0098235_711_1514 249
198 3300048907 Ga0496104_0035576 Ga0496104_0035576_1726_2529 249
199 3300048915 Ga0496112_0006150 Ga0496112_0006150_8779_9582 249
200 3300048916 Ga0496113_0156620 Ga0496113_0156620_90_893 249
201 3300048918 Ga0496115_0355799 Ga0496115_0355799_335_1138 249
202 3300053077 Ga0495601_0038607 Ga0495601_0038607_776_1579 249
203 3300053078 Ga0495612_0098910 Ga0495612_0098910_26_829 249
204 3300053084 Ga0495595_0003323 Ga0495595_0003323_807_1610 249
205 3300053085 Ga0495619_0002957 Ga0495619_0002957_2347_3150 249
206 3300005334 Ga0068869_100246279 Ga0068869_1002462792 250
207 3300005338 Ga0068868_100034159 Ga0068868_1000341592 250
208 3300005340 Ga0070689_100030202 Ga0070689_1000302024 250
209 3300005347 Ga0070668_100459793 Ga0070668_1004597932 250
210 3300005354 Ga0070675_100599465 Ga0070675_1005994651 250
211 3300005356 Ga0070674_100155327 Ga0070674_1001553272 250
212 3300005356 Ga0070674_100459282 Ga0070674_1004592822 250
213 3300005366 Ga0070659_100152347 Ga0070659_1001523472 250
214 3300005366 Ga0070659_100157021 Ga0070659_1001570212 250
215 3300005444 Ga0070694_100350937 Ga0070694_1003509372 250
216 3300005578 Ga0068854_100068588 Ga0068854_1000685882 250
217 3300005615 Ga0070702_100022208 Ga0070702_1000222082 250
218 3300005616 Ga0068852_100018425 Ga0068852_1000184257 250
219 3300005617 Ga0068859_100295535 Ga0068859_1002955352 250
220 3300005618 Ga0068864_100118904 Ga0068864_1001189042 250
221 3300005718 Ga0068866_10231850 Ga0068866_102318501 250
222 3300005719 Ga0068861_100241848 Ga0068861_1002418482 250
223 3300005840 Ga0068870_10156932 Ga0068870_101569322 250
224 3300005844 Ga0068862_100176250 Ga0068862_1001762502 250
225 3300006881 Ga0068865_100284403 Ga0068865_1002844032 250
226 3300006931 Ga0097620_100295558 Ga0097620_1002955582 250
227 3300009098 Ga0105245_10211469 Ga0105245_102114692 250
228 3300009098 Ga0105245_10575586 Ga0105245_105755861 250
229 3300009176 Ga0105242_10251996 Ga0105242_102519962 250
230 3300010375 Ga0105239_10128358 Ga0105239_101283582 250
231 3300013306 Ga0163162_10109267 Ga0163162_101092674 250
232 3300013307 Ga0157372_10511559 Ga0157372_105115592 250
233 3300013308 Ga0157375_10260242 Ga0157375_102602422 250
234 3300014326 Ga0157380_10104376 Ga0157380_101043762 250
235 3300014745 Ga0157377_10015281 Ga0157377_100152812 250
236 3300025321 Ga0207656_10112413 Ga0207656_101124132 250
237 3300025901 Ga0207688_10108072 Ga0207688_101080722 250
238 3300025908 Ga0207643_10166041 Ga0207643_101660411 250
239 3300025914 Ga0207671_10287618 Ga0207671_102876182 250
240 3300025918 Ga0207662_10167612 Ga0207662_101676122 250
241 3300025919 Ga0207657_10153583 Ga0207657_101535832 250
242 3300025923 Ga0207681_10144253 Ga0207681_101442532 250
243 3300025927 Ga0207687_10044424 Ga0207687_100444244 250
244 3300025932 Ga0207690_10111002 Ga0207690_101110022 250
245 3300025932 Ga0207690_10434258 Ga0207690_104342582 250
246 3300025933 Ga0207706_10074102 Ga0207706_100741022 250
247 3300025936 Ga0207670_10275158 Ga0207670_102751581 250
248 3300025937 Ga0207669_10085877 Ga0207669_100858772 250
249 3300025937 Ga0207669_10389663 Ga0207669_103896632 250
250 3300025942 Ga0207689_10024766 Ga0207689_100247667 250
251 3300025945 Ga0207679_10685262 Ga0207679_106852621 250
252 3300025972 Ga0207668_10114891 Ga0207668_101148912 250
253 3300025981 Ga0207640_10442408 Ga0207640_104424082 250
254 3300026023 Ga0207677_10067269 Ga0207677_100672693 250
255 3300026095 Ga0207676_10266451 Ga0207676_102664512 250
256 3300026118 Ga0207675_100005544 Ga0207675_10000554413 250
257 3300026142 Ga0207698_10145417 Ga0207698_101454172 250
258 3300028380 Ga0268265_10110167 Ga0268265_101101672 250
259 3300028380 Ga0268265_10200559 Ga0268265_102005592 250
260 3300045976 Ga0466967_0057237 Ga0466967_0057237_623_1441 250
261 3300045976 Ga0466967_0144855 Ga0466967_0144855_1048_1962 250
262 3300046511 Ga0495608_0138056 Ga0495608_0138056_568_1374 250
263 3300046559 Ga0495667_0047999 Ga0495667_0047999_1374_2180 250
264 3300047319 Ga0495674_0017347 Ga0495674_0017347_4888_5694 250
265 3300048907 Ga0496104_0110818 Ga0496104_0110818_1555_2361 250
266 3300048908 Ga0496105_0235979 Ga0496105_0235979_24_830 250
267 3300048908 Ga0496105_0556387 Ga0496105_0556387_10_837 250
268 3300048912 Ga0496109_0328129 Ga0496109_0328129_264_1091 250
269 3300048913 Ga0496110_0125623 Ga0496110_0125623_252_1079 250
270 3300048916 Ga0496113_0086955 Ga0496113_0086955_853_1680 250
271 3300048918 Ga0496115_0051163 Ga0496115_0051163_521_1327 250
272 3300048918 Ga0496115_0129459 Ga0496115_0129459_980_1786 250
273 3300050511 nmdc:mga08y16_288500_c1 nmdc:mga08y16_288500_c1_525_1352 250
274 3300005439 Ga0070711_100081016 Ga0070711_1000810162 251
275 3300005981 Ga0081538_10004147 Ga0081538_1000414712 251
276 3300006038 Ga0075365_10211755 Ga0075365_102117552 251
277 3300011119 Ga0105246_10134541 Ga0105246_101345412 251
278 3300021377 Ga0213874_10056256 Ga0213874_100562562 251
279 3300021388 Ga0213875_10022784 Ga0213875_100227842 251
280 3300021388 Ga0213875_10040407 Ga0213875_100404072 251
281 3300025906 Ga0207699_10021907 Ga0207699_100219072 251
282 3300025915 Ga0207693_10003814 Ga0207693_1000381413 251
283 3300025916 Ga0207663_10142829 Ga0207663_101428293 251
284 3300037853 Ga0436364_0250824 Ga0436364_0250824_10262_11023 251
285 3300039437 Ga0436365_0694342 Ga0436365_0694342_1623_2420 251
286 3300039437 Ga0436365_1168763 Ga0436365_1168763_59205_59966 251
287 3300039437 Ga0436365_1682275 Ga0436365_1682275_2916_3722 251
288 3300039450 Ga0436363_0357892 Ga0436363_0357892_4493_5254 251
289 3300044684 Ga0466966_0065629 Ga0466966_0065629_1253_2080 251
290 3300044694 Ga0466963_0000353 Ga0466963_0000353_6952_7746 251
291 3300044694 Ga0466963_0012614 Ga0466963_0012614_4135_4953 251
292 3300044694 Ga0466963_0375977 Ga0466963_0375977_71_865 251
293 3300044765 Ga0466970_0158803 Ga0466970_0158803_411_1229 251
294 3300044842 Ga0466957_0508149 Ga0466957_0508149_16_810 251
295 3300045049 Ga0466959_0066355 Ga0466959_0066355_813_1607 251
296 3300045049 Ga0466959_0208589 Ga0466959_0208589_468_1265 251
297 3300045836 Ga0466958_0063302 Ga0466958_0063302_139_957 251
298 3300045976 Ga0466967_0056406 Ga0466967_0056406_741_1535 251
299 3300045976 Ga0466967_0226648 Ga0466967_0226648_247_1041 251
300 3300048907 Ga0496104_0420832 Ga0496104_0420832_275_1045 251
301 3300049590 Ga0501074_0098289 Ga0501074_0098289_261_1055 251
302 3300050510 nmdc:mga06r32_208609_c1 nmdc:mga06r32_208609_c1_916_1674 251
303 3300061719 Ga0466962_0113426 Ga0466962_0113426_241_1059 251
304 3300005366 Ga0070659_100239836 Ga0070659_1002398362 252
305 3300005435 Ga0070714_100041837 Ga0070714_1000418373 252
306 3300005435 Ga0070714_100147879 Ga0070714_1001478792 252
307 3300005436 Ga0070713_100033761 Ga0070713_1000337612 252
308 3300005436 Ga0070713_100278813 Ga0070713_1002788132 252
309 3300005564 Ga0070664_100067647 Ga0070664_1000676472 252
310 3300005614 Ga0068856_100079119 Ga0068856_1000791192 252
311 3300006028 Ga0070717_10016877 Ga0070717_100168772 252
312 3300006028 Ga0070717_10099370 Ga0070717_100993703 252
313 3300006847 Ga0075431_100152081 Ga0075431_1001520811 252
314 3300009148 Ga0105243_10508603 Ga0105243_105086032 252
315 3300009545 Ga0105237_10001691 Ga0105237_100016919 252
316 3300013307 Ga0157372_11140337 Ga0157372_111403371 252
317 3300021384 Ga0213876_10156852 Ga0213876_101568522 252
318 3300021388 Ga0213875_10027075 Ga0213875_100270752 252
319 3300021388 Ga0213875_10043707 Ga0213875_100437072 252
320 3300025914 Ga0207671_10003382 Ga0207671_100033829 252
321 3300025928 Ga0207700_10063761 Ga0207700_100637612 252
322 3300025928 Ga0207700_10137863 Ga0207700_101378632 252
323 3300025929 Ga0207664_10027281 Ga0207664_100272812 252
324 3300025932 Ga0207690_10234381 Ga0207690_102343812 252
325 3300025945 Ga0207679_10104566 Ga0207679_101045662 252
326 3300026078 Ga0207702_10090892 Ga0207702_100908922 252
327 3300028556 Ga0265337_1006803 Ga0265337_10068033 252
328 3300028558 Ga0265326_10000757 Ga0265326_100007579 252
329 3300028666 Ga0265336_10000005 Ga0265336_10000005166 252
330 3300028800 Ga0265338_10000001 Ga0265338_10000001982 252
331 3300031240 Ga0265320_10091913 Ga0265320_100919132 252
332 3300031247 Ga0265340_10000001 Ga0265340_10000001980 252
333 3300031344 Ga0265316_10020617 Ga0265316_100206174 252
334 3300037853 Ga0436364_0806595 Ga0436364_0806595_16862_17680 252
335 3300037853 Ga0436364_1110324 Ga0436364_1110324_894_1730 252
336 3300037853 Ga0436364_1329882 Ga0436364_1329882_4784_5608 252
337 3300044694 Ga0466963_0285130 Ga0466963_0285130_59_889 252
338 3300044706 Ga0466964_0091931 Ga0466964_0091931_430_1278 252
339 3300044735 Ga0466968_0017568 Ga0466968_0017568_903_1721 252
340 3300044842 Ga0466957_0045749 Ga0466957_0045749_128_958 252
341 3300045836 Ga0466958_0008197 Ga0466958_0008197_4776_5630 252
342 3300045976 Ga0466967_0076074 Ga0466967_0076074_254_1102 252
343 3300046515 Ga0495620_0102881 Ga0495620_0102881_219_1019 252
344 3300046529 Ga0495652_0174498 Ga0495652_0174498_108_929 252
345 3300048903 Ga0496100_0011800 Ga0496100_0011800_3479_4306 252
346 3300048905 Ga0496102_0136686 Ga0496102_0136686_81_908 252
347 3300048918 Ga0496115_0000222 Ga0496115_0000222_29118_29945 252
348 3300048918 Ga0496115_0000245 Ga0496115_0000245_24338_25165 252
349 3300005328 Ga0070676_10033212 Ga0070676_100332122 253
350 3300005345 Ga0070692_10130630 Ga0070692_101306302 253
351 3300005347 Ga0070668_100004131 Ga0070668_1000041312 253
352 3300005435 Ga0070714_100277235 Ga0070714_1002772352 253
353 3300005441 Ga0070700_100025734 Ga0070700_1000257342 253
354 3300005457 Ga0070662_100003463 Ga0070662_10000346312 253
355 3300005546 Ga0070696_100053531 Ga0070696_1000535312 253
356 3300005719 Ga0068861_100004867 Ga0068861_1000048672 253
357 3300006844 Ga0075428_100032178 Ga0075428_1000321782 253
358 3300009094 Ga0111539_10464088 Ga0111539_104640882 253
359 3300009098 Ga0105245_10020088 Ga0105245_100200882 253
360 3300009147 Ga0114129_10213475 Ga0114129_102134752 253
361 3300009553 Ga0105249_10104653 Ga0105249_101046532 253
362 3300025907 Ga0207645_10048809 Ga0207645_100488092 253
363 3300025927 Ga0207687_10006036 Ga0207687_100060368 253
364 3300025929 Ga0207664_10290889 Ga0207664_102908892 253
365 3300025933 Ga0207706_10001927 Ga0207706_1000192712 253
366 3300025961 Ga0207712_10012049 Ga0207712_100120496 253
367 3300025981 Ga0207640_10120665 Ga0207640_101206652 253
368 3300026075 Ga0207708_10039138 Ga0207708_100391382 253
369 3300026075 Ga0207708_10282292 Ga0207708_102822922 253
370 3300026118 Ga0207675_100006758 Ga0207675_1000067582 253
371 3300031995 Ga0307409_100297490 Ga0307409_1002974902 253
372 3300039450 Ga0436363_1280964 Ga0436363_1280964_128_940 253
373 3300045976 Ga0466967_0651691 Ga0466967_0651691_200_1018 253
374 3300046500 Ga0495596_0030336 Ga0495596_0030336_856_1677 253
375 3300046500 Ga0495596_0033283 Ga0495596_0033283_249_1070 253
376 3300046513 Ga0495616_0103095 Ga0495616_0103095_215_1036 253
377 3300005981 Ga0081538_10000316 Ga0081538_1000031630 254
378 3300005981 Ga0081538_10040073 Ga0081538_100400732 254
379 3300032126 Ga0307415_100133996 Ga0307415_1001339962 254
380 3300039437 Ga0436365_0461596 Ga0436365_0461596_666_1469 254
381 3300039438 Ga0436360_0102967 Ga0436360_0102967_3521_4309 254
382 3300039447 Ga0436361_0229899 Ga0436361_0229899_446_1231 254
383 3300045836 Ga0466958_0362954 Ga0466958_0362954_38_844 254
384 3300046461 Ga0495641_0003185 Ga0495641_0003185_6126_6914 255
385 3300046517 Ga0495630_0076709 Ga0495630_0076709_1390_2178 255
386 3300046523 Ga0495644_0007197 Ga0495644_0007197_1071_1859 255
387 3300046663 Ga0495635_0264253 Ga0495635_0264253_259_1047 255
388 3300046683 Ga0495658_0035386 Ga0495658_0035386_1615_2403 255
389 3300047317 Ga0495604_0000180 Ga0495604_0000180_42591_43535 255
390 3300047469 Ga0495673_0017657 Ga0495673_0017657_1803_2591 255
391 3300047472 Ga0495686_0000008 Ga0495686_0000008_124752_125534 255
392 3300048090 Ga0495615_0000883 Ga0495615_0000883_1867_2682 255
393 3300005937 Ga0081455_10193211 Ga0081455_101932112 256
394 3300005981 Ga0081538_10004968 Ga0081538_100049687 256
395 3300005981 Ga0081538_10069468 Ga0081538_100694682 256
396 3300042016 Ga0439463_056862 Ga0439463_056862_164_988 256
397 3300044842 Ga0466957_0323152 Ga0466957_0323152_35_982 256
398 3300049588 Ga0501072_0025344 Ga0501072_0025344_677_1501 256
399 3300049592 Ga0501076_0011471 Ga0501076_0011471_1539_2363 256
400 3300049824 Ga0501045_0031660 Ga0501045_0031660_825_1649 256
401 3300054114 Ga0501084_0387093 Ga0501084_0387093_215_1039 256
402 3300061734 Ga0530510_0002728 Ga0530510_0002728_11081_11905 256
403 3300005981 Ga0081538_10003700 Ga0081538_1000370016 257
404 3300005439 Ga0070711_100000367 Ga0070711_10000036710 258
405 3300025916 Ga0207663_10004281 Ga0207663_100042819 258
406 3300006058 Ga0075432_10056610 Ga0075432_100566102 260
407 3300006846 Ga0075430_100100771 Ga0075430_1001007713 260
408 3300006847 Ga0075431_100094637 Ga0075431_1000946373 260
409 3300032002 Ga0307416_100067960 Ga0307416_1000679602 260
410 3300032002 Ga0307416_100188798 Ga0307416_1001887982 260
411 3300038443 Ga0395901_0550127 Ga0395901_0550127_62_949 260
412 3300005981 Ga0081538_10000200 Ga0081538_1000020068 264
413 3300003373 JGI25407J50210_10000104 JGI25407J50210_100001046 266
414 3300005981 Ga0081538_10000020 Ga0081538_1000002077 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10418

DHODB_Fe-S_bind

Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B

275

312

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wqm-assembly1.cif.gz_A structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant 0.829 1 207
5jca-assembly1.cif.gz_S nadp(h) bound nadh-dependent ferredoxin:nadp oxidoreductase (nfni) from pyrococcus furiosus 0.8205 1 257
7c3a-assembly3.cif.gz_C ferredoxin reductase in carbazole 1,9a-dioxygenase 0.8118 2 213
7c3b-assembly2.cif.gz_B ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) 0.8075 1 213
4yry-assembly1.cif.gz_A insights into flavin-based electron bifurcation via the nadh-dependent reduced ferredoxin-nadp oxidoreductase structure 0.8065 1 258
ID Description Score Start End Superfamily
af_Q58841_92_194_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8464 103 210 3.40.50.80
af_Q58841_92_194_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8233 103 210 3.40.50.80
1ep1B01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8052 2 93 2.40.30.10
2yb4A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7329 182 217 3.20.20.140
1ep1B01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.7307 2 93 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A538KPQ0-F1-model_v4 Dihydroorotate dehydrogenase electron transfer subunit 0.944 2 260 GO:0006221
GO:0016491
GO:0046872
GO:0050660
GO:0051537
AF-A0A7W0MUG6-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9407 1 103 GO:0016491
AF-A0A7K0RA18-F1-model_v4 Dihydroorotate dehydrogenase electron transfer subunit 0.9294 1 236 GO:0006221
GO:0016491
GO:0046872
GO:0050660
GO:0051537
AF-A0A538KUP8-F1-model_v4 Dihydroorotate dehydrogenase electron transfer subunit 0.9248 1 260 GO:0006221
GO:0016491
GO:0046872
GO:0050660
GO:0051537
AF-A0A6I2Y839-F1-model_v4 FAD-binding FR-type domain-containing protein 0.914 1 258 GO:0006221
GO:0016491
GO:0046872
GO:0050660
GO:0051537

Feature Viewer

pLDDT pTM Quality
88.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map