F438564

General Info

Members Datasets Scaffolds Average Seq Length
415 143 415 146

Family's Representative Sequence

Representative Sequence 3300013250|Ga0171462_1063|Ga0171462_10638
Length 173
Sequence VAACAWWTQIHFAAKDDDLGLLAGRRPSERAMQLTSFSDYSLRVLMYAALQSERLITIEETASLYGISRAHLMKVANLLTKAGFLRAVRGRSGGLILARPPSAIGIGEVLRVTEPDFALVECFGSGNCCLVTPHCRLKGILREALAAFFSTIDRYTLADLLLRPEDFGIKPAA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.37
Rhizosphere 94.7
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10004536 3300003316 Bacteria 2611
2 rootH2_10008493 3300003320 Bacteria 2509
3 rootH2_10233221 3300003320 Bacteria 1912
4 rootL2_10023106 3300003322 Bacteria 6296
5 rootH1_10063204 3300003323 Bacteria 1639
6 Ga0070658_10081210 3300005327 Bacteria 2663
7 Ga0070658_10094082 3300005327 Bacteria 2472
8 Ga0070658_10987002 3300005327 Unclassified 732
9 Ga0070683_100005310 3300005329 Bacteria 10736
10 Ga0070683_100009680 3300005329 Bacteria 8250
11 Ga0070680_100007641 3300005336 Bacteria 8246
12 Ga0070680_100018575 3300005336 Bacteria 5496
13 Ga0070680_100220093 3300005336 Bacteria 1602
14 Ga0070682_100022067 3300005337 Bacteria 3765
15 Ga0070682_100148794 3300005337 Bacteria 1604
16 Ga0070660_100002904 3300005339 Bacteria 11793
17 Ga0070660_100008206 3300005339 Bacteria 7300
18 Ga0070661_100000818 3300005344 Bacteria 22360
19 Ga0070692_10058878 3300005345 Bacteria 2018
20 Ga0070659_100005895 3300005366 Bacteria 8826
21 Ga0070714_100060670 3300005435 Bacteria 3246
22 Ga0070713_100011070 3300005436 Bacteria 6551
23 Ga0070711_100019226 3300005439 Bacteria 4380
24 Ga0070663_100007140 3300005455 Bacteria 6781
25 Ga0070663_100054591 3300005455 Bacteria 2856
26 Ga0070663_100319577 3300005455 Unclassified 1248
27 Ga0070663_100357364 3300005455 Bacteria 1184
28 Ga0070663_100577880 3300005455 Bacteria 942
29 Ga0070662_100089336 3300005457 Bacteria 2311
30 Ga0070681_10007614 3300005458 Bacteria 10584
31 Ga0070681_10009648 3300005458 Bacteria 9496
32 Ga0070681_10051244 3300005458 Bacteria 4117
33 Ga0070681_10150923 3300005458 Bacteria 2250
34 Ga0070681_10367111 3300005458 Bacteria 1350
35 Ga0070681_10603986 3300005458 Bacteria 1011
36 Ga0070681_11210552 3300005458 Unclassified 677
37 Ga0070681_11300406 3300005458 Bacteria 650
38 Ga0070679_100002730 3300005530 Bacteria 16079
39 Ga0070679_100004798 3300005530 Bacteria 12472
40 Ga0070679_100007649 3300005530 Bacteria 10114
41 Ga0070679_100023585 3300005530 Bacteria 6025
42 Ga0070679_100035845 3300005530 Bacteria 4922
43 Ga0070679_100045421 3300005530 Bacteria 4377
44 Ga0070679_100068259 3300005530 Bacteria 3547
45 Ga0070679_100867755 3300005530 Bacteria 846
46 Ga0070684_100006834 3300005535 Bacteria 8852
47 Ga0070684_100006973 3300005535 Bacteria 8775
48 Ga0068853_100003572 3300005539 Bacteria 11908
49 Ga0068853_100006991 3300005539 Bacteria 9017
50 Ga0070693_100022037 3300005547 Bacteria 3381
51 Ga0070693_100228312 3300005547 Unclassified 1223
52 Ga0070693_100568165 3300005547 Bacteria 814
53 Ga0068855_100005693 3300005563 Bacteria 15224
54 Ga0068855_100620893 3300005563 Bacteria 1164
55 Ga0068855_100803003 3300005563 Bacteria 1000
56 Ga0068855_101003111 3300005563 Bacteria 877
57 Ga0070664_100263241 3300005564 Bacteria 1552
58 Ga0068857_100005098 3300005577 Bacteria 11170
59 Ga0068857_100051184 3300005577 Unclassified 3663
60 Ga0068857_100710988 3300005577 Unclassified 955
61 Ga0068854_100019438 3300005578 Bacteria 4577
62 Ga0068856_100024703 3300005614 Bacteria 5852
63 Ga0068852_100322137 3300005616 Bacteria 1501
64 Ga0068852_101820268 3300005616 Bacteria 631
65 Ga0081455_10384299 3300005937 Unclassified 979
66 Ga0070716_100046746 3300006173 Bacteria 2438
67 Ga0070712_100014157 3300006175 Bacteria 5117
68 Ga0097621_100427401 3300006237 Unclassified 1190
69 Ga0068871_100120454 3300006358 Bacteria 2216
70 Ga0068871_100522263 3300006358 Unclassified 1072
71 Ga0075431_100069774 3300006847 Bacteria 3626
72 Ga0075436_100726879 3300006914 Bacteria 736
73 Ga0105240_10023388 3300009093 Bacteria 8173
74 Ga0105240_10158635 3300009093 Bacteria 2689
75 Ga0105240_10441225 3300009093 Bacteria 1459
76 Ga0105240_10642632 3300009093 Bacteria 1164
77 Ga0105240_11309839 3300009093 Bacteria 764
78 Ga0111539_10125601 3300009094 Bacteria 3006
79 Ga0114129_10039512 3300009147 Bacteria 6653
80 Ga0105241_10063288 3300009174 Bacteria 2854
81 Ga0105241_10169166 3300009174 Bacteria 1804
82 Ga0105241_10455756 3300009174 Bacteria 1132
83 Ga0105237_10001886 3300009545 Bacteria 26751
84 Ga0105237_10122180 3300009545 Bacteria 2598
85 Ga0105237_10660946 3300009545 Bacteria 1052
86 Ga0105238_10000100 3300009551 Bacteria 97757
87 Ga0105238_10031712 3300009551 Bacteria 5379
88 Ga0105238_10164707 3300009551 Bacteria 2192
89 Ga0105239_10052168 3300010375 Bacteria 4485
90 Ga0105239_10099396 3300010375 Bacteria 3217
91 Ga0105239_10350740 3300010375 Bacteria 1666
92 Ga0105239_10577786 3300010375 Bacteria 1281
93 Ga0157373_10006118 3300013100 Bacteria 8999
94 Ga0157371_10004596 3300013102 Bacteria 11984
95 Ga0157370_10003620 3300013104 Bacteria 18080
96 Ga0157370_10023444 3300013104 Bacteria 6125
97 Ga0157370_10179351 3300013104 Bacteria 1968
98 Ga0157369_10006649 3300013105 Bacteria 13361
99 Ga0157369_10030678 3300013105 Bacteria 5928
100 Ga0157369_10032495 3300013105 Bacteria 5738
101 Ga0157369_10317188 3300013105 Unclassified 1620
102 Ga0157369_10362699 3300013105 Bacteria 1504
103 Ga0157369_10504154 3300013105 Bacteria 1252
104 Ga0157369_10679997 3300013105 Bacteria 1060
105 Ga0157369_12464067 3300013105 Bacteria 527
106 Ga0171462_1063 3300013250 Bacteria 15657
107 Ga0163162_10701560 3300013306 Unclassified 1133
108 Ga0157372_10002178 3300013307 Bacteria 21331
109 Ga0157372_10019828 3300013307 Bacteria 7246
110 Ga0157372_10807895 3300013307 Bacteria 1089
111 Ga0154015_1641289 3300020610 Unclassified 537
112 Ga0207692_10828214 3300025898 Unclassified 606
113 Ga0207647_10214899 3300025904 Bacteria 1109
114 Ga0207699_10020774 3300025906 Bacteria 3526
115 Ga0207705_10000769 3300025909 Bacteria 26391
116 Ga0207705_10011268 3300025909 Bacteria 6479
117 Ga0207705_10025586 3300025909 Bacteria 4211
118 Ga0207705_10051333 3300025909 Bacteria 2968
119 Ga0207654_10278372 3300025911 Bacteria 1131
120 Ga0207654_10573274 3300025911 Bacteria 803
121 Ga0207654_10672134 3300025911 Bacteria 743
122 Ga0207707_10001373 3300025912 Bacteria 22581
123 Ga0207707_10002965 3300025912 Bacteria 15116
124 Ga0207707_10050085 3300025912 Bacteria 3639
125 Ga0207707_10154886 3300025912 Bacteria 2004
126 Ga0207707_10392328 3300025912 Bacteria 1192
127 Ga0207695_10055687 3300025913 Bacteria 4119
128 Ga0207695_10113418 3300025913 Bacteria 2687
129 Ga0207671_10002486 3300025914 Bacteria 19688
130 Ga0207671_10533183 3300025914 Bacteria 936
131 Ga0207693_10051356 3300025915 Bacteria 3236
132 Ga0207660_10029441 3300025917 Bacteria 3767
133 Ga0207660_10099648 3300025917 Bacteria 2169
134 Ga0207660_10175325 3300025917 Bacteria 1662
135 Ga0207660_10204539 3300025917 Bacteria 1543
136 Ga0207657_10001694 3300025919 Bacteria 23776
137 Ga0207657_10002092 3300025919 Bacteria 21593
138 Ga0207657_10003246 3300025919 Bacteria 17412
139 Ga0207652_10006087 3300025921 Bacteria 9762
140 Ga0207652_10039322 3300025921 Bacteria 4014
141 Ga0207652_10079774 3300025921 Bacteria 2860
142 Ga0207652_10080791 3300025921 Bacteria 2843
143 Ga0207652_10082243 3300025921 Bacteria 2817
144 Ga0207652_10121784 3300025921 Bacteria 2321
145 Ga0207652_10146289 3300025921 Bacteria 2115
146 Ga0207652_10280877 3300025921 Bacteria 1502
147 Ga0207652_11012073 3300025921 Unclassified 730
148 Ga0207694_10000690 3300025924 Bacteria 30315
149 Ga0207694_10537384 3300025924 Bacteria 980
150 Ga0207700_10166936 3300025928 Unclassified 1833
151 Ga0207700_10618404 3300025928 Bacteria 965
152 Ga0207664_10511859 3300025929 Unclassified 1075
153 Ga0207690_10015071 3300025932 Bacteria 4679
154 Ga0207690_10452728 3300025932 Bacteria 1032
155 Ga0207706_10002742 3300025933 Bacteria 17119
156 Ga0207665_10031093 3300025939 Bacteria 3531
157 Ga0207661_10002575 3300025944 Bacteria 12481
158 Ga0207661_10007484 3300025944 Bacteria 7769
159 Ga0207661_10021857 3300025944 Bacteria 4803
160 Ga0207679_10051240 3300025945 Bacteria 3021
161 Ga0207667_10006656 3300025949 Bacteria 13967
162 Ga0207667_10018089 3300025949 Bacteria 7912
163 Ga0207667_10544168 3300025949 Unclassified 1175
164 Ga0207667_10614682 3300025949 Bacteria 1095
165 Ga0207667_10935922 3300025949 Bacteria 857
166 Ga0207640_10075984 3300025981 Bacteria 2278
167 Ga0207640_11092438 3300025981 Bacteria 705
168 Ga0207639_10005615 3300026041 Bacteria 8487
169 Ga0207639_10009979 3300026041 Bacteria 6564
170 Ga0207639_10268862 3300026041 Bacteria 1494
171 Ga0207678_10010106 3300026067 Bacteria 8278
172 Ga0207678_10035048 3300026067 Bacteria 4369
173 Ga0207678_10040713 3300026067 Bacteria 4028
174 Ga0207678_10168407 3300026067 Bacteria 1871
175 Ga0207678_11019322 3300026067 Bacteria 733
176 Ga0207702_10062675 3300026078 Bacteria 3176
177 Ga0207702_10444903 3300026078 Bacteria 1256
178 Ga0207674_10010524 3300026116 Bacteria 10471
179 Ga0207674_10063522 3300026116 Unclassified 3727
180 Ga0207698_10212411 3300026142 Bacteria 1742
181 Ga0207698_10496814 3300026142 Unclassified 1186
182 Ga0265340_10073301 3300031247 Bacteria 1620
183 Ga0265339_10006444 3300031249 Bacteria 7697
184 Ga0265339_10021370 3300031249 Bacteria 3767
185 Ga0265316_10233814 3300031344 Unclassified 1353
186 Ga0307414_11416558 3300032004 Bacteria 646
187 Ga0373937_0223928 3300036401 Bacteria 1771
188 Ga0395899_0043006 3300037312 Bacteria 3371
189 Ga0395899_0490099 3300037312 Bacteria 799
190 Ga0395900_0004125 3300037418 Bacteria 15467
191 Ga0395900_0028222 3300037418 Bacteria 5749
192 Ga0395900_0110213 3300037418 Bacteria 2828
193 Ga0395900_0350426 3300037418 Bacteria 1450
194 Ga0395900_0452331 3300037418 Unclassified 1240
195 Ga0395898_0003623 3300037466 Bacteria 17197
196 Ga0395898_0006105 3300037466 Bacteria 12917
197 Ga0395898_0008263 3300037466 Bacteria 11008
198 Ga0395898_0091319 3300037466 Bacteria 2930
199 Ga0395898_0188719 3300037466 Bacteria 1969
200 Ga0395905_0226609 3300037471 Bacteria 1748
201 Ga0395901_0012175 3300038443 Bacteria 8728
202 Ga0395901_0028417 3300038443 Bacteria 5751
203 Ga0395901_0104788 3300038443 Bacteria 2968
204 Ga0395901_0514997 3300038443 Unclassified 1216
205 Ga0395901_1005839 3300038443 Bacteria 809
206 Ga0436363_0553082 3300039450 Bacteria 697
207 Ga0436363_0879570 3300039450 Bacteria 2854
208 Ga0466966_0511656 3300044684 Bacteria 722
209 Ga0466971_0031718 3300044719 Bacteria 2367
210 Ga0466967_0219961 3300045976 Bacteria 1804
211 Ga0495651_0427778 3300046462 Bacteria 859
212 Ga0495664_0423706 3300046477 Bacteria 798
213 Ga0495645_0039844 3300046543 Bacteria 3426
214 Ga0495599_0467764 3300046678 Unclassified 745
215 Ga0496104_0000044 3300048907 Bacteria 153699
216 Ga0496104_0024425 3300048907 Bacteria 5558
217 Ga0496105_0000017 3300048908 Bacteria 210323
218 Ga0496106_0008053 3300048909 Bacteria 7783
219 Ga0496107_0230159 3300048910 Unclassified 1379
220 Ga0496108_0001351 3300048911 Bacteria 19296
221 Ga0496109_0002298 3300048912 Bacteria 15901
222 Ga0496110_0061447 3300048913 Unclassified 3316
223 Ga0496112_0005123 3300048915 Bacteria 11264
224 Ga0496112_0522180 3300048915 Bacteria 1122
225 Ga0496114_0004119 3300048917 Bacteria 11248
226 Ga0496114_1448235 3300048917 Unclassified 574
227 Ga0496115_0104284 3300048918 Bacteria 2327
228 Ga0496115_0180614 3300048918 Bacteria 1744
229 Ga0496119_0002095 3300048922 Bacteria 22489
230 Ga0501031_0000010 3300049568 Bacteria 146435
231 Ga0501031_0264400 3300049568 Bacteria 1117
232 Ga0501032_0000023 3300049569 Bacteria 146435
233 Ga0501032_0055961 3300049569 Bacteria 2652
234 Ga0501032_0098235 3300049569 Bacteria 1940
235 Ga0501032_0239313 3300049569 Unclassified 1179
236 Ga0501032_0368332 3300049569 Bacteria 924
237 Ga0501032_0497741 3300049569 Bacteria 779
238 Ga0501032_0522063 3300049569 Bacteria 758
239 Ga0501032_0834400 3300049569 Bacteria 581
240 Ga0501033_0000447 3300049570 Bacteria 39400
241 Ga0501033_0000481 3300049570 Bacteria 37583
242 Ga0501033_0001512 3300049570 Bacteria 20576
243 Ga0501033_0017118 3300049570 Bacteria 5479
244 Ga0501033_0039905 3300049570 Bacteria 3506
245 Ga0501033_0115940 3300049570 Bacteria 1946
246 Ga0501033_0205012 3300049570 Bacteria 1407
247 Ga0501033_0225345 3300049570 Bacteria 1333
248 Ga0501033_0237789 3300049570 Bacteria 1292
249 Ga0501033_0376495 3300049570 Unclassified 992
250 Ga0501033_0689773 3300049570 Bacteria 695
251 Ga0501033_0729965 3300049570 Unclassified 672
252 Ga0501034_0000116 3300049571 Bacteria 146442
253 Ga0501034_0006314 3300049571 Bacteria 12760
254 Ga0501034_0024633 3300049571 Bacteria 6120
255 Ga0501034_0040302 3300049571 Bacteria 4727
256 Ga0501034_0063564 3300049571 Bacteria 3704
257 Ga0501034_0077525 3300049571 Unclassified 3329
258 Ga0501034_0115509 3300049571 Bacteria 2672
259 Ga0501034_0119296 3300049571 Bacteria 2624
260 Ga0501034_0139869 3300049571 Bacteria 2401
261 Ga0501034_0176212 3300049571 Bacteria 2104
262 Ga0501034_0185716 3300049571 Bacteria 2042
263 Ga0501034_0235983 3300049571 Bacteria 1776
264 Ga0501034_0566408 3300049571 Bacteria 1044
265 Ga0501034_0684028 3300049571 Bacteria 925
266 Ga0501034_0691318 3300049571 Bacteria 919
267 Ga0501034_1422031 3300049571 Unclassified 568
268 Ga0501036_0000015 3300049572 Bacteria 146442
269 Ga0501036_0005076 3300049572 Bacteria 10654
270 Ga0501036_0020823 3300049572 Bacteria 5508
271 Ga0501036_0067291 3300049572 Bacteria 3030
272 Ga0501036_0074803 3300049572 Bacteria 2865
273 Ga0501036_0260627 3300049572 Bacteria 1452
274 Ga0501037_0000023 3300049573 Bacteria 146542
275 Ga0501037_0001775 3300049573 Bacteria 15667
276 Ga0501037_0004454 3300049573 Bacteria 10172
277 Ga0501037_0015563 3300049573 Bacteria 5597
278 Ga0501037_0051125 3300049573 Bacteria 3022
279 Ga0501037_0068207 3300049573 Bacteria 2589
280 Ga0501037_0091383 3300049573 Bacteria 2201
281 Ga0501037_0122643 3300049573 Bacteria 1867
282 Ga0501038_0000025 3300049574 Bacteria 146542
283 Ga0501038_0020820 3300049574 Bacteria 5894
284 Ga0501038_0027749 3300049574 Bacteria 5032
285 Ga0501038_0048162 3300049574 Bacteria 3689
286 Ga0501038_0087177 3300049574 Bacteria 2621
287 Ga0501038_0115117 3300049574 Bacteria 2223
288 Ga0501038_0116214 3300049574 Bacteria 2211
289 Ga0501038_0128168 3300049574 Bacteria 2086
290 Ga0501038_0223027 3300049574 Bacteria 1503
291 Ga0501038_0332057 3300049574 Bacteria 1187
292 Ga0501038_0825948 3300049574 Bacteria 687
293 Ga0501039_0000691 3300049575 Bacteria 24283
294 Ga0501039_0012690 3300049575 Bacteria 6440
295 Ga0501039_0068173 3300049575 Bacteria 2762
296 Ga0501039_0081654 3300049575 Bacteria 2516
297 Ga0501039_0336597 3300049575 Bacteria 1186
298 Ga0501039_1276061 3300049575 Bacteria 567
299 Ga0501040_0012500 3300049576 Bacteria 5562
300 Ga0501040_0175488 3300049576 Bacteria 1518
301 Ga0501040_0229825 3300049576 Bacteria 1321
302 Ga0501042_0024639 3300049578 Bacteria 4221
303 Ga0501042_0817132 3300049578 Bacteria 678
304 Ga0501043_0000070 3300049579 Bacteria 89839
305 Ga0501043_0004448 3300049579 Bacteria 11389
306 Ga0501043_0023289 3300049579 Bacteria 4856
307 Ga0501043_0037859 3300049579 Bacteria 3794
308 Ga0501043_0041030 3300049579 Bacteria 3636
309 Ga0501043_0052017 3300049579 Bacteria 3218
310 Ga0501043_0076373 3300049579 Bacteria 2632
311 Ga0501043_0099757 3300049579 Bacteria 2282
312 Ga0501043_0119540 3300049579 Bacteria 2066
313 Ga0501043_0361642 3300049579 Unclassified 1101
314 Ga0501043_0379207 3300049579 Bacteria 1071
315 Ga0501043_0454748 3300049579 Bacteria 962
316 Ga0501046_0003410 3300049580 Bacteria 14589
317 Ga0501046_0025070 3300049580 Bacteria 4885
318 Ga0501046_0076349 3300049580 Bacteria 2596
319 Ga0501046_0084046 3300049580 Bacteria 2456
320 Ga0501046_0401437 3300049580 Bacteria 990
321 Ga0501046_0526496 3300049580 Bacteria 844
322 Ga0501047_0008018 3300049581 Bacteria 9962
323 Ga0501047_0008847 3300049581 Bacteria 9498
324 Ga0501047_0043904 3300049581 Bacteria 4317
325 Ga0501047_0062185 3300049581 Bacteria 3602
326 Ga0501047_0219996 3300049581 Bacteria 1755
327 Ga0501047_0397827 3300049581 Bacteria 1211
328 Ga0501047_1041777 3300049581 Bacteria 631
329 Ga0501047_1098231 3300049581 Bacteria 609
330 Ga0501047_1342531 3300049581 Bacteria 529
331 Ga0501048_0006369 3300049582 Bacteria 8973
332 Ga0501048_0117165 3300049582 Bacteria 1881
333 Ga0501048_0331174 3300049582 Bacteria 1085
334 Ga0501048_0338928 3300049582 Unclassified 1072
335 Ga0501048_0620492 3300049582 Unclassified 776
336 Ga0501067_0017183 3300049583 Bacteria 3998
337 Ga0501067_0304336 3300049583 Bacteria 888
338 Ga0501068_0031948 3300049584 Bacteria 3129
339 Ga0501068_0036973 3300049584 Bacteria 2922
340 Ga0501069_0000415 3300049585 Bacteria 19327
341 Ga0501069_0131555 3300049585 Bacteria 1433
342 Ga0501069_0355588 3300049585 Bacteria 864
343 Ga0501070_0019518 3300049586 Bacteria 5685
344 Ga0501070_0035565 3300049586 Bacteria 4161
345 Ga0501070_0041890 3300049586 Bacteria 3813
346 Ga0501070_0084983 3300049586 Bacteria 2620
347 Ga0501070_0162653 3300049586 Bacteria 1840
348 Ga0501070_0210999 3300049586 Bacteria 1594
349 Ga0501070_0266905 3300049586 Bacteria 1398
350 Ga0501070_0462738 3300049586 Unclassified 1022
351 Ga0501070_0665919 3300049586 Bacteria 825
352 Ga0501071_0106421 3300049587 Bacteria 2071
353 Ga0501071_0426058 3300049587 Unclassified 1014
354 Ga0501071_0717447 3300049587 Bacteria 770
355 Ga0501071_1258502 3300049587 Unclassified 572
356 Ga0501072_0063732 3300049588 Bacteria 2908
357 Ga0501072_0234152 3300049588 Bacteria 1463
358 Ga0501073_0007890 3300049589 Bacteria 7900
359 Ga0501073_0127402 3300049589 Bacteria 1764
360 Ga0501073_0702796 3300049589 Unclassified 697
361 Ga0501074_0004279 3300049590 Bacteria 10189
362 Ga0501074_0211826 3300049590 Bacteria 1380
363 Ga0501079_0009770 3300049741 Bacteria 7274
364 Ga0501079_0162815 3300049741 Bacteria 1740
365 Ga0501079_0173977 3300049741 Bacteria 1679
366 Ga0501080_0026630 3300049742 Bacteria 5372
367 Ga0501080_0218786 3300049742 Bacteria 1743
368 Ga0501080_0622169 3300049742 Bacteria 957
369 Ga0501080_0646530 3300049742 Unclassified 936
370 Ga0501081_0077607 3300049743 Bacteria 2322
371 Ga0501083_0010377 3300049744 Bacteria 6558
372 Ga0501083_0064579 3300049744 Bacteria 2439
373 Ga0501083_0133737 3300049744 Bacteria 1626
374 Ga0501035_0001454 3300049822 Bacteria 24283
375 Ga0501035_0006584 3300049822 Bacteria 10880
376 Ga0501035_0008072 3300049822 Bacteria 9810
377 Ga0501035_0056668 3300049822 Bacteria 3495
378 Ga0501035_0077487 3300049822 Bacteria 2937
379 Ga0501035_0132333 3300049822 Bacteria 2173
380 Ga0501035_0286989 3300049822 Bacteria 1389
381 Ga0501035_0439487 3300049822 Bacteria 1081
382 Ga0501035_0654367 3300049822 Unclassified 851
383 Ga0501035_0694935 3300049822 Unclassified 821
384 Ga0501035_0777380 3300049822 Bacteria 766
385 Ga0501044_0000337 3300049823 Bacteria 59417
386 Ga0501044_0000505 3300049823 Bacteria 47475
387 Ga0501044_0002585 3300049823 Bacteria 20595
388 Ga0501044_0032706 3300049823 Bacteria 5467
389 Ga0501044_0043690 3300049823 Bacteria 4655
390 Ga0501044_0058692 3300049823 Bacteria 3945
391 Ga0501044_0064997 3300049823 Bacteria 3721
392 Ga0501044_0073928 3300049823 Bacteria 3464
393 Ga0501044_0117855 3300049823 Bacteria 2658
394 Ga0501044_0160838 3300049823 Bacteria 2222
395 Ga0501044_0202452 3300049823 Bacteria 1943
396 Ga0501044_0241345 3300049823 Bacteria 1750
397 Ga0501044_0380104 3300049823 Bacteria 1327
398 Ga0501044_0582424 3300049823 Bacteria 1013
399 Ga0501044_1079885 3300049823 Bacteria 672
400 Ga0501045_0027284 3300049824 Bacteria 4113
401 Ga0501045_0138203 3300049824 Bacteria 1812
402 Ga0501045_0493967 3300049824 Bacteria 909
403 Ga0501045_0930345 3300049824 Bacteria 638
404 nmdc:mga05p37_76561_c1 3300050507 Bacteria 4118
405 nmdc:mga08y16_326828_c1 3300050511 Unclassified 1578
406 nmdc:mga08x19_669556_c1 3300050514 Bacteria 736
407 Ga0495601_0076470 3300053077 Bacteria 2144
408 Ga0495612_0035304 3300053078 Bacteria 2027
409 Ga0495612_0088533 3300053078 Bacteria 1308
410 Ga0501084_0046950 3300054114 Bacteria 3617
411 Ga0501084_0169108 3300054114 Bacteria 1845
412 Ga0501082_0045117 3300060353 Bacteria 3801
413 Ga0501082_0067800 3300060353 Bacteria 3073
414 Ga0501082_0281491 3300060353 Bacteria 1447
415 Ga0530510_1155878 3300061734 Unclassified 593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_1342531 Ga0501047_1342531_27_413 126
2 3300049582 Ga0501048_0331174 Ga0501048_0331174_579_1013 134
3 3300049581 Ga0501047_0397827 Ga0501047_0397827_505_936 136
4 3300049822 Ga0501035_0439487 Ga0501035_0439487_211_642 136
5 3300049823 Ga0501044_0582424 Ga0501044_0582424_214_645 136
6 3300026142 Ga0207698_10212411 Ga0207698_102124113 138
7 3300005455 Ga0070663_100007140 Ga0070663_1000071403 139
8 3300048907 Ga0496104_0000044 Ga0496104_0000044_29657_30097 139
9 3300048908 Ga0496105_0000017 Ga0496105_0000017_108508_108948 139
10 3300048917 Ga0496114_0004119 Ga0496114_0004119_3829_4257 139
11 3300048918 Ga0496115_0104284 Ga0496115_0104284_239_679 139
12 3300048918 Ga0496115_0180614 Ga0496115_0180614_806_1234 139
13 3300048922 Ga0496119_0002095 Ga0496119_0002095_16201_16629 139
14 3300003316 rootH1_10004536 rootH1_100045364 140
15 3300003320 rootH2_10008493 rootH2_100084932 140
16 3300003320 rootH2_10233221 rootH2_102332215 140
17 3300003322 rootL2_10023106 rootL2_100231066 140
18 3300003323 rootH1_10063204 rootH1_100632042 140
19 3300005327 Ga0070658_10081210 Ga0070658_100812103 140
20 3300005327 Ga0070658_10094082 Ga0070658_100940822 140
21 3300005327 Ga0070658_10987002 Ga0070658_109870021 140
22 3300005329 Ga0070683_100005310 Ga0070683_10000531013 140
23 3300005329 Ga0070683_100009680 Ga0070683_1000096804 140
24 3300005336 Ga0070680_100007641 Ga0070680_10000764113 140
25 3300005336 Ga0070680_100018575 Ga0070680_1000185752 140
26 3300005336 Ga0070680_100220093 Ga0070680_1002200933 140
27 3300005337 Ga0070682_100022067 Ga0070682_1000220672 140
28 3300005337 Ga0070682_100148794 Ga0070682_1001487942 140
29 3300005339 Ga0070660_100002904 Ga0070660_1000029046 140
30 3300005339 Ga0070660_100008206 Ga0070660_1000082065 140
31 3300005344 Ga0070661_100000818 Ga0070661_10000081813 140
32 3300005345 Ga0070692_10058878 Ga0070692_100588782 140
33 3300005366 Ga0070659_100005895 Ga0070659_1000058952 140
34 3300005435 Ga0070714_100060670 Ga0070714_1000606705 140
35 3300005436 Ga0070713_100011070 Ga0070713_1000110706 140
36 3300005439 Ga0070711_100019226 Ga0070711_1000192266 140
37 3300005455 Ga0070663_100054591 Ga0070663_1000545914 140
38 3300005455 Ga0070663_100319577 Ga0070663_1003195772 140
39 3300005455 Ga0070663_100357364 Ga0070663_1003573642 140
40 3300005455 Ga0070663_100577880 Ga0070663_1005778802 140
41 3300005457 Ga0070662_100089336 Ga0070662_1000893361 140
42 3300005458 Ga0070681_10007614 Ga0070681_100076147 140
43 3300005458 Ga0070681_10009648 Ga0070681_100096482 140
44 3300005458 Ga0070681_10051244 Ga0070681_100512449 140
45 3300005458 Ga0070681_10150923 Ga0070681_101509231 140
46 3300005458 Ga0070681_10367111 Ga0070681_103671112 140
47 3300005458 Ga0070681_10603986 Ga0070681_106039862 140
48 3300005458 Ga0070681_11210552 Ga0070681_112105521 140
49 3300005458 Ga0070681_11300406 Ga0070681_113004062 140
50 3300005530 Ga0070679_100002730 Ga0070679_10000273022 140
51 3300005530 Ga0070679_100004798 Ga0070679_1000047984 140
52 3300005530 Ga0070679_100007649 Ga0070679_1000076493 140
53 3300005530 Ga0070679_100023585 Ga0070679_1000235857 140
54 3300005530 Ga0070679_100035845 Ga0070679_1000358453 140
55 3300005530 Ga0070679_100045421 Ga0070679_1000454214 140
56 3300005530 Ga0070679_100068259 Ga0070679_1000682593 140
57 3300005530 Ga0070679_100867755 Ga0070679_1008677551 140
58 3300005535 Ga0070684_100006834 Ga0070684_1000068345 140
59 3300005535 Ga0070684_100006973 Ga0070684_10000697310 140
60 3300005539 Ga0068853_100003572 Ga0068853_1000035725 140
61 3300005539 Ga0068853_100006991 Ga0068853_1000069912 140
62 3300005547 Ga0070693_100022037 Ga0070693_1000220372 140
63 3300005547 Ga0070693_100228312 Ga0070693_1002283121 140
64 3300005547 Ga0070693_100568165 Ga0070693_1005681651 140
65 3300005563 Ga0068855_100005693 Ga0068855_10000569312 140
66 3300005563 Ga0068855_100620893 Ga0068855_1006208932 140
67 3300005563 Ga0068855_100803003 Ga0068855_1008030032 140
68 3300005563 Ga0068855_101003111 Ga0068855_1010031112 140
69 3300005564 Ga0070664_100263241 Ga0070664_1002632412 140
70 3300005577 Ga0068857_100005098 Ga0068857_1000050987 140
71 3300005577 Ga0068857_100051184 Ga0068857_1000511845 140
72 3300005577 Ga0068857_100710988 Ga0068857_1007109882 140
73 3300005578 Ga0068854_100019438 Ga0068854_1000194382 140
74 3300005614 Ga0068856_100024703 Ga0068856_1000247032 140
75 3300005616 Ga0068852_100322137 Ga0068852_1003221371 140
76 3300005616 Ga0068852_101820268 Ga0068852_1018202681 140
77 3300005937 Ga0081455_10384299 Ga0081455_103842992 140
78 3300006173 Ga0070716_100046746 Ga0070716_1000467464 140
79 3300006175 Ga0070712_100014157 Ga0070712_1000141575 140
80 3300006237 Ga0097621_100427401 Ga0097621_1004274012 140
81 3300006358 Ga0068871_100120454 Ga0068871_1001204542 140
82 3300006358 Ga0068871_100522263 Ga0068871_1005222632 140
83 3300006847 Ga0075431_100069774 Ga0075431_1000697746 140
84 3300006914 Ga0075436_100726879 Ga0075436_1007268791 140
85 3300009093 Ga0105240_10023388 Ga0105240_1002338811 140
86 3300009093 Ga0105240_10158635 Ga0105240_101586353 140
87 3300009093 Ga0105240_10441225 Ga0105240_104412253 140
88 3300009093 Ga0105240_10642632 Ga0105240_106426322 140
89 3300009093 Ga0105240_11309839 Ga0105240_113098391 140
90 3300009094 Ga0111539_10125601 Ga0111539_101256012 140
91 3300009147 Ga0114129_10039512 Ga0114129_100395124 140
92 3300009174 Ga0105241_10063288 Ga0105241_100632882 140
93 3300009174 Ga0105241_10169166 Ga0105241_101691664 140
94 3300009174 Ga0105241_10455756 Ga0105241_104557563 140
95 3300009545 Ga0105237_10001886 Ga0105237_1000188610 140
96 3300009545 Ga0105237_10122180 Ga0105237_101221805 140
97 3300009545 Ga0105237_10660946 Ga0105237_106609463 140
98 3300009551 Ga0105238_10000100 Ga0105238_1000010022 140
99 3300009551 Ga0105238_10031712 Ga0105238_100317123 140
100 3300009551 Ga0105238_10164707 Ga0105238_101647072 140
101 3300010375 Ga0105239_10052168 Ga0105239_100521685 140
102 3300010375 Ga0105239_10099396 Ga0105239_100993963 140
103 3300010375 Ga0105239_10350740 Ga0105239_103507403 140
104 3300010375 Ga0105239_10577786 Ga0105239_105777861 140
105 3300013100 Ga0157373_10006118 Ga0157373_100061183 140
106 3300013102 Ga0157371_10004596 Ga0157371_100045966 140
107 3300013104 Ga0157370_10003620 Ga0157370_1000362013 140
108 3300013104 Ga0157370_10023444 Ga0157370_100234441 140
109 3300013104 Ga0157370_10179351 Ga0157370_101793514 140
110 3300013105 Ga0157369_10006649 Ga0157369_100066496 140
111 3300013105 Ga0157369_10030678 Ga0157369_100306786 140
112 3300013105 Ga0157369_10032495 Ga0157369_100324957 140
113 3300013105 Ga0157369_10317188 Ga0157369_103171882 140
114 3300013105 Ga0157369_10362699 Ga0157369_103626992 140
115 3300013105 Ga0157369_10504154 Ga0157369_105041542 140
116 3300013105 Ga0157369_10679997 Ga0157369_106799973 140
117 3300013105 Ga0157369_12464067 Ga0157369_124640671 140
118 3300013250 Ga0171462_1063 Ga0171462_10638 140
119 3300013306 Ga0163162_10701560 Ga0163162_107015602 140
120 3300013307 Ga0157372_10002178 Ga0157372_1000217812 140
121 3300013307 Ga0157372_10019828 Ga0157372_100198287 140
122 3300013307 Ga0157372_10807895 Ga0157372_108078952 140
123 3300020610 Ga0154015_1641289 Ga0154015_16412891 140
124 3300025898 Ga0207692_10828214 Ga0207692_108282141 140
125 3300025904 Ga0207647_10214899 Ga0207647_102148992 140
126 3300025906 Ga0207699_10020774 Ga0207699_100207745 140
127 3300025909 Ga0207705_10000769 Ga0207705_100007693 140
128 3300025909 Ga0207705_10011268 Ga0207705_100112683 140
129 3300025909 Ga0207705_10025586 Ga0207705_100255862 140
130 3300025909 Ga0207705_10051333 Ga0207705_100513333 140
131 3300025911 Ga0207654_10278372 Ga0207654_102783723 140
132 3300025911 Ga0207654_10573274 Ga0207654_105732742 140
133 3300025911 Ga0207654_10672134 Ga0207654_106721341 140
134 3300025912 Ga0207707_10001373 Ga0207707_1000137324 140
135 3300025912 Ga0207707_10002965 Ga0207707_1000296510 140
136 3300025912 Ga0207707_10050085 Ga0207707_100500852 140
137 3300025912 Ga0207707_10154886 Ga0207707_101548863 140
138 3300025912 Ga0207707_10392328 Ga0207707_103923282 140
139 3300025913 Ga0207695_10055687 Ga0207695_100556877 140
140 3300025913 Ga0207695_10113418 Ga0207695_101134183 140
141 3300025914 Ga0207671_10002486 Ga0207671_100024863 140
142 3300025914 Ga0207671_10533183 Ga0207671_105331833 140
143 3300025915 Ga0207693_10051356 Ga0207693_100513563 140
144 3300025917 Ga0207660_10029441 Ga0207660_100294414 140
145 3300025917 Ga0207660_10099648 Ga0207660_100996482 140
146 3300025917 Ga0207660_10175325 Ga0207660_101753252 140
147 3300025917 Ga0207660_10204539 Ga0207660_102045392 140
148 3300025919 Ga0207657_10001694 Ga0207657_1000169410 140
149 3300025919 Ga0207657_10002092 Ga0207657_1000209211 140
150 3300025919 Ga0207657_10003246 Ga0207657_1000324622 140
151 3300025921 Ga0207652_10006087 Ga0207652_1000608710 140
152 3300025921 Ga0207652_10039322 Ga0207652_100393221 140
153 3300025921 Ga0207652_10079774 Ga0207652_100797743 140
154 3300025921 Ga0207652_10080791 Ga0207652_100807912 140
155 3300025921 Ga0207652_10082243 Ga0207652_100822433 140
156 3300025921 Ga0207652_10121784 Ga0207652_101217843 140
157 3300025921 Ga0207652_10146289 Ga0207652_101462893 140
158 3300025921 Ga0207652_10280877 Ga0207652_102808771 140
159 3300025921 Ga0207652_11012073 Ga0207652_110120731 140
160 3300025924 Ga0207694_10000690 Ga0207694_1000069024 140
161 3300025924 Ga0207694_10537384 Ga0207694_105373841 140
162 3300025928 Ga0207700_10166936 Ga0207700_101669363 140
163 3300025928 Ga0207700_10618404 Ga0207700_106184041 140
164 3300025929 Ga0207664_10511859 Ga0207664_105118591 140
165 3300025932 Ga0207690_10015071 Ga0207690_100150718 140
166 3300025932 Ga0207690_10452728 Ga0207690_104527281 140
167 3300025933 Ga0207706_10002742 Ga0207706_100027427 140
168 3300025939 Ga0207665_10031093 Ga0207665_100310934 140
169 3300025944 Ga0207661_10002575 Ga0207661_1000257515 140
170 3300025944 Ga0207661_10007484 Ga0207661_100074844 140
171 3300025944 Ga0207661_10021857 Ga0207661_100218573 140
172 3300025945 Ga0207679_10051240 Ga0207679_100512402 140
173 3300025949 Ga0207667_10006656 Ga0207667_1000665611 140
174 3300025949 Ga0207667_10018089 Ga0207667_100180894 140
175 3300025949 Ga0207667_10544168 Ga0207667_105441682 140
176 3300025949 Ga0207667_10614682 Ga0207667_106146823 140
177 3300025949 Ga0207667_10935922 Ga0207667_109359222 140
178 3300025981 Ga0207640_10075984 Ga0207640_100759842 140
179 3300025981 Ga0207640_11092438 Ga0207640_110924381 140
180 3300026041 Ga0207639_10005615 Ga0207639_100056155 140
181 3300026041 Ga0207639_10009979 Ga0207639_100099796 140
182 3300026041 Ga0207639_10268862 Ga0207639_102688623 140
183 3300026067 Ga0207678_10010106 Ga0207678_100101067 140
184 3300026067 Ga0207678_10035048 Ga0207678_100350484 140
185 3300026067 Ga0207678_10040713 Ga0207678_100407133 140
186 3300026067 Ga0207678_10168407 Ga0207678_101684073 140
187 3300026067 Ga0207678_11019322 Ga0207678_110193221 140
188 3300026078 Ga0207702_10062675 Ga0207702_100626754 140
189 3300026078 Ga0207702_10444903 Ga0207702_104449033 140
190 3300026116 Ga0207674_10010524 Ga0207674_1001052413 140
191 3300026116 Ga0207674_10063522 Ga0207674_100635225 140
192 3300026142 Ga0207698_10496814 Ga0207698_104968142 140
193 3300031247 Ga0265340_10073301 Ga0265340_100733014 140
194 3300031249 Ga0265339_10006444 Ga0265339_100064449 140
195 3300031249 Ga0265339_10021370 Ga0265339_100213704 140
196 3300031344 Ga0265316_10233814 Ga0265316_102338141 140
197 3300032004 Ga0307414_11416558 Ga0307414_114165581 140
198 3300036401 Ga0373937_0223928 Ga0373937_0223928_781_1209 140
199 3300037312 Ga0395899_0043006 Ga0395899_0043006_2392_2820 140
200 3300037312 Ga0395899_0490099 Ga0395899_0490099_309_737 140
201 3300037418 Ga0395900_0004125 Ga0395900_0004125_6879_7307 140
202 3300037418 Ga0395900_0028222 Ga0395900_0028222_3026_3454 140
203 3300037418 Ga0395900_0110213 Ga0395900_0110213_1046_1474 140
204 3300037418 Ga0395900_0350426 Ga0395900_0350426_20_448 140
205 3300037418 Ga0395900_0452331 Ga0395900_0452331_180_689 140
206 3300037466 Ga0395898_0003623 Ga0395898_0003623_12227_12655 140
207 3300037466 Ga0395898_0006105 Ga0395898_0006105_7624_8052 140
208 3300037466 Ga0395898_0008263 Ga0395898_0008263_9139_9648 140
209 3300037466 Ga0395898_0091319 Ga0395898_0091319_856_1284 140
210 3300037466 Ga0395898_0188719 Ga0395898_0188719_1290_1718 140
211 3300037471 Ga0395905_0226609 Ga0395905_0226609_416_844 140
212 3300038443 Ga0395901_0012175 Ga0395901_0012175_7964_8416 140
213 3300038443 Ga0395901_0028417 Ga0395901_0028417_2800_3228 140
214 3300038443 Ga0395901_0104788 Ga0395901_0104788_1909_2337 140
215 3300038443 Ga0395901_0514997 Ga0395901_0514997_278_706 140
216 3300038443 Ga0395901_1005839 Ga0395901_1005839_265_693 140
217 3300039450 Ga0436363_0553082 Ga0436363_0553082_164_592 140
218 3300039450 Ga0436363_0879570 Ga0436363_0879570_971_1399 140
219 3300044684 Ga0466966_0511656 Ga0466966_0511656_222_650 140
220 3300044719 Ga0466971_0031718 Ga0466971_0031718_1637_2065 140
221 3300045976 Ga0466967_0219961 Ga0466967_0219961_1178_1606 140
222 3300046462 Ga0495651_0427778 Ga0495651_0427778_194_622 140
223 3300046477 Ga0495664_0423706 Ga0495664_0423706_200_628 140
224 3300046543 Ga0495645_0039844 Ga0495645_0039844_1539_1967 140
225 3300046678 Ga0495599_0467764 Ga0495599_0467764_145_573 140
226 3300048907 Ga0496104_0024425 Ga0496104_0024425_4607_5035 140
227 3300048909 Ga0496106_0008053 Ga0496106_0008053_1012_1440 140
228 3300048910 Ga0496107_0230159 Ga0496107_0230159_535_963 140
229 3300048911 Ga0496108_0001351 Ga0496108_0001351_12171_12599 140
230 3300048912 Ga0496109_0002298 Ga0496109_0002298_8070_8498 140
231 3300048913 Ga0496110_0061447 Ga0496110_0061447_2720_3148 140
232 3300048915 Ga0496112_0005123 Ga0496112_0005123_742_1170 140
233 3300048915 Ga0496112_0522180 Ga0496112_0522180_245_673 140
234 3300048917 Ga0496114_1448235 Ga0496114_1448235_63_491 140
235 3300049568 Ga0501031_0000010 Ga0501031_0000010_137450_137878 140
236 3300049568 Ga0501031_0264400 Ga0501031_0264400_372_800 140
237 3300049569 Ga0501032_0000023 Ga0501032_0000023_8558_8986 140
238 3300049569 Ga0501032_0055961 Ga0501032_0055961_506_988 140
239 3300049569 Ga0501032_0098235 Ga0501032_0098235_1307_1759 140
240 3300049569 Ga0501032_0239313 Ga0501032_0239313_126_551 140
241 3300049569 Ga0501032_0368332 Ga0501032_0368332_43_471 140
242 3300049569 Ga0501032_0497741 Ga0501032_0497741_183_611 140
243 3300049569 Ga0501032_0522063 Ga0501032_0522063_306_734 140
244 3300049569 Ga0501032_0834400 Ga0501032_0834400_48_476 140
245 3300049570 Ga0501033_0000447 Ga0501033_0000447_512_940 140
246 3300049570 Ga0501033_0000481 Ga0501033_0000481_28504_28932 140
247 3300049570 Ga0501033_0001512 Ga0501033_0001512_11591_12019 140
248 3300049570 Ga0501033_0017118 Ga0501033_0017118_4035_4517 140
249 3300049570 Ga0501033_0039905 Ga0501033_0039905_2940_3368 140
250 3300049570 Ga0501033_0115940 Ga0501033_0115940_729_1157 140
251 3300049570 Ga0501033_0205012 Ga0501033_0205012_51_479 140
252 3300049570 Ga0501033_0225345 Ga0501033_0225345_74_502 140
253 3300049570 Ga0501033_0237789 Ga0501033_0237789_550_978 140
254 3300049570 Ga0501033_0376495 Ga0501033_0376495_351_782 140
255 3300049570 Ga0501033_0689773 Ga0501033_0689773_136_618 140
256 3300049570 Ga0501033_0729965 Ga0501033_0729965_129_554 140
257 3300049571 Ga0501034_0000116 Ga0501034_0000116_137457_137885 140
258 3300049571 Ga0501034_0006314 Ga0501034_0006314_11018_11446 140
259 3300049571 Ga0501034_0024633 Ga0501034_0024633_5554_6006 140
260 3300049571 Ga0501034_0040302 Ga0501034_0040302_69_530 140
261 3300049571 Ga0501034_0063564 Ga0501034_0063564_2388_2870 140
262 3300049571 Ga0501034_0077525 Ga0501034_0077525_915_1343 140
263 3300049571 Ga0501034_0115509 Ga0501034_0115509_142_570 140
264 3300049571 Ga0501034_0119296 Ga0501034_0119296_757_1188 140
265 3300049571 Ga0501034_0139869 Ga0501034_0139869_668_1093 140
266 3300049571 Ga0501034_0176212 Ga0501034_0176212_1296_1724 140
267 3300049571 Ga0501034_0185716 Ga0501034_0185716_1026_1454 140
268 3300049571 Ga0501034_0235983 Ga0501034_0235983_906_1334 140
269 3300049571 Ga0501034_0566408 Ga0501034_0566408_264_692 140
270 3300049571 Ga0501034_0684028 Ga0501034_0684028_164_592 140
271 3300049571 Ga0501034_0691318 Ga0501034_0691318_144_572 140
272 3300049571 Ga0501034_1422031 Ga0501034_1422031_115_543 140
273 3300049572 Ga0501036_0000015 Ga0501036_0000015_137457_137885 140
274 3300049572 Ga0501036_0005076 Ga0501036_0005076_8543_8971 140
275 3300049572 Ga0501036_0020823 Ga0501036_0020823_2477_2959 140
276 3300049572 Ga0501036_0067291 Ga0501036_0067291_1569_1997 140
277 3300049572 Ga0501036_0074803 Ga0501036_0074803_576_1028 140
278 3300049572 Ga0501036_0260627 Ga0501036_0260627_776_1204 140
279 3300049573 Ga0501037_0000023 Ga0501037_0000023_137557_137985 140
280 3300049573 Ga0501037_0001775 Ga0501037_0001775_12890_13318 140
281 3300049573 Ga0501037_0004454 Ga0501037_0004454_8111_8539 140
282 3300049573 Ga0501037_0015563 Ga0501037_0015563_417_899 140
283 3300049573 Ga0501037_0051125 Ga0501037_0051125_2474_2902 140
284 3300049573 Ga0501037_0068207 Ga0501037_0068207_869_1297 140
285 3300049573 Ga0501037_0091383 Ga0501037_0091383_1543_1971 140
286 3300049573 Ga0501037_0122643 Ga0501037_0122643_639_1067 140
287 3300049574 Ga0501038_0000025 Ga0501038_0000025_137557_137985 140
288 3300049574 Ga0501038_0020820 Ga0501038_0020820_2402_2830 140
289 3300049574 Ga0501038_0027749 Ga0501038_0027749_4533_4961 140
290 3300049574 Ga0501038_0048162 Ga0501038_0048162_789_1271 140
291 3300049574 Ga0501038_0087177 Ga0501038_0087177_2174_2602 140
292 3300049574 Ga0501038_0115117 Ga0501038_0115117_281_733 140
293 3300049574 Ga0501038_0116214 Ga0501038_0116214_990_1418 140
294 3300049574 Ga0501038_0128168 Ga0501038_0128168_1036_1464 140
295 3300049574 Ga0501038_0223027 Ga0501038_0223027_1024_1452 140
296 3300049574 Ga0501038_0332057 Ga0501038_0332057_33_461 140
297 3300049574 Ga0501038_0825948 Ga0501038_0825948_204_632 140
298 3300049575 Ga0501039_0000691 Ga0501039_0000691_15298_15726 140
299 3300049575 Ga0501039_0012690 Ga0501039_0012690_1790_2272 140
300 3300049575 Ga0501039_0068173 Ga0501039_0068173_1228_1656 140
301 3300049575 Ga0501039_0081654 Ga0501039_0081654_1558_1986 140
302 3300049575 Ga0501039_0336597 Ga0501039_0336597_738_1166 140
303 3300049575 Ga0501039_1276061 Ga0501039_1276061_86_514 140
304 3300049576 Ga0501040_0012500 Ga0501040_0012500_695_1123 140
305 3300049576 Ga0501040_0175488 Ga0501040_0175488_113_541 140
306 3300049576 Ga0501040_0229825 Ga0501040_0229825_121_549 140
307 3300049578 Ga0501042_0024639 Ga0501042_0024639_997_1425 140
308 3300049578 Ga0501042_0817132 Ga0501042_0817132_118_570 140
309 3300049579 Ga0501043_0000070 Ga0501043_0000070_80893_81321 140
310 3300049579 Ga0501043_0004448 Ga0501043_0004448_8676_9104 140
311 3300049579 Ga0501043_0023289 Ga0501043_0023289_2357_2839 140
312 3300049579 Ga0501043_0037859 Ga0501043_0037859_2543_2971 140
313 3300049579 Ga0501043_0041030 Ga0501043_0041030_2028_2456 140
314 3300049579 Ga0501043_0052017 Ga0501043_0052017_1850_2302 140
315 3300049579 Ga0501043_0076373 Ga0501043_0076373_935_1363 140
316 3300049579 Ga0501043_0099757 Ga0501043_0099757_920_1348 140
317 3300049579 Ga0501043_0119540 Ga0501043_0119540_461_889 140
318 3300049579 Ga0501043_0361642 Ga0501043_0361642_82_507 140
319 3300049579 Ga0501043_0379207 Ga0501043_0379207_594_1025 140
320 3300049579 Ga0501043_0454748 Ga0501043_0454748_484_912 140
321 3300049580 Ga0501046_0003410 Ga0501046_0003410_13790_14272 140
322 3300049580 Ga0501046_0025070 Ga0501046_0025070_2622_3050 140
323 3300049580 Ga0501046_0076349 Ga0501046_0076349_136_564 140
324 3300049580 Ga0501046_0084046 Ga0501046_0084046_374_826 140
325 3300049580 Ga0501046_0401437 Ga0501046_0401437_454_882 140
326 3300049580 Ga0501046_0526496 Ga0501046_0526496_287_715 140
327 3300049581 Ga0501047_0008018 Ga0501047_0008018_1839_2267 140
328 3300049581 Ga0501047_0008847 Ga0501047_0008847_2890_3318 140
329 3300049581 Ga0501047_0043904 Ga0501047_0043904_2161_2613 140
330 3300049581 Ga0501047_0062185 Ga0501047_0062185_149_574 140
331 3300049581 Ga0501047_0219996 Ga0501047_0219996_1231_1662 140
332 3300049581 Ga0501047_1041777 Ga0501047_1041777_26_454 140
333 3300049581 Ga0501047_1098231 Ga0501047_1098231_27_455 140
334 3300049582 Ga0501048_0006369 Ga0501048_0006369_5999_6481 140
335 3300049582 Ga0501048_0117165 Ga0501048_0117165_122_550 140
336 3300049582 Ga0501048_0338928 Ga0501048_0338928_540_1028 140
337 3300049582 Ga0501048_0620492 Ga0501048_0620492_320_748 140
338 3300049583 Ga0501067_0017183 Ga0501067_0017183_1793_2275 140
339 3300049583 Ga0501067_0304336 Ga0501067_0304336_424_852 140
340 3300049584 Ga0501068_0031948 Ga0501068_0031948_1850_2278 140
341 3300049584 Ga0501068_0036973 Ga0501068_0036973_411_893 140
342 3300049585 Ga0501069_0000415 Ga0501069_0000415_8711_9142 140
343 3300049585 Ga0501069_0131555 Ga0501069_0131555_923_1351 140
344 3300049585 Ga0501069_0355588 Ga0501069_0355588_380_808 140
345 3300049586 Ga0501070_0019518 Ga0501070_0019518_670_1098 140
346 3300049586 Ga0501070_0035565 Ga0501070_0035565_2280_2762 140
347 3300049586 Ga0501070_0041890 Ga0501070_0041890_1089_1517 140
348 3300049586 Ga0501070_0084983 Ga0501070_0084983_1400_1852 140
349 3300049586 Ga0501070_0162653 Ga0501070_0162653_377_805 140
350 3300049586 Ga0501070_0210999 Ga0501070_0210999_841_1269 140
351 3300049586 Ga0501070_0266905 Ga0501070_0266905_551_979 140
352 3300049586 Ga0501070_0462738 Ga0501070_0462738_336_845 140
353 3300049586 Ga0501070_0665919 Ga0501070_0665919_79_507 140
354 3300049587 Ga0501071_0106421 Ga0501071_0106421_125_628 140
355 3300049587 Ga0501071_0426058 Ga0501071_0426058_121_552 140
356 3300049587 Ga0501071_0717447 Ga0501071_0717447_323_751 140
357 3300049587 Ga0501071_1258502 Ga0501071_1258502_50_475 140
358 3300049588 Ga0501072_0063732 Ga0501072_0063732_975_1403 140
359 3300049588 Ga0501072_0234152 Ga0501072_0234152_901_1383 140
360 3300049589 Ga0501073_0007890 Ga0501073_0007890_6501_6929 140
361 3300049589 Ga0501073_0127402 Ga0501073_0127402_65_496 140
362 3300049589 Ga0501073_0702796 Ga0501073_0702796_216_647 140
363 3300049590 Ga0501074_0004279 Ga0501074_0004279_7288_7770 140
364 3300049590 Ga0501074_0211826 Ga0501074_0211826_836_1264 140
365 3300049741 Ga0501079_0009770 Ga0501079_0009770_6363_6791 140
366 3300049741 Ga0501079_0162815 Ga0501079_0162815_1143_1625 140
367 3300049741 Ga0501079_0173977 Ga0501079_0173977_478_906 140
368 3300049742 Ga0501080_0026630 Ga0501080_0026630_2419_2901 140
369 3300049742 Ga0501080_0218786 Ga0501080_0218786_897_1325 140
370 3300049742 Ga0501080_0622169 Ga0501080_0622169_431_859 140
371 3300049742 Ga0501080_0646530 Ga0501080_0646530_73_501 140
372 3300049743 Ga0501081_0077607 Ga0501081_0077607_560_988 140
373 3300049744 Ga0501083_0010377 Ga0501083_0010377_4085_4513 140
374 3300049744 Ga0501083_0064579 Ga0501083_0064579_439_921 140
375 3300049744 Ga0501083_0133737 Ga0501083_0133737_95_547 140
376 3300049822 Ga0501035_0001454 Ga0501035_0001454_8560_8988 140
377 3300049822 Ga0501035_0006584 Ga0501035_0006584_5711_6139 140
378 3300049822 Ga0501035_0008072 Ga0501035_0008072_365_793 140
379 3300049822 Ga0501035_0056668 Ga0501035_0056668_394_876 140
380 3300049822 Ga0501035_0077487 Ga0501035_0077487_278_706 140
381 3300049822 Ga0501035_0132333 Ga0501035_0132333_1426_1854 140
382 3300049822 Ga0501035_0286989 Ga0501035_0286989_574_1002 140
383 3300049822 Ga0501035_0654367 Ga0501035_0654367_117_542 140
384 3300049822 Ga0501035_0694935 Ga0501035_0694935_274_783 140
385 3300049822 Ga0501035_0777380 Ga0501035_0777380_255_683 140
386 3300049823 Ga0501044_0000337 Ga0501044_0000337_12728_13159 140
387 3300049823 Ga0501044_0000505 Ga0501044_0000505_27882_28310 140
388 3300049823 Ga0501044_0002585 Ga0501044_0002585_11610_12038 140
389 3300049823 Ga0501044_0032706 Ga0501044_0032706_1123_1548 140
390 3300049823 Ga0501044_0043690 Ga0501044_0043690_2711_3139 140
391 3300049823 Ga0501044_0058692 Ga0501044_0058692_3262_3690 140
392 3300049823 Ga0501044_0064997 Ga0501044_0064997_565_993 140
393 3300049823 Ga0501044_0073928 Ga0501044_0073928_2892_3320 140
394 3300049823 Ga0501044_0117855 Ga0501044_0117855_1665_2147 140
395 3300049823 Ga0501044_0160838 Ga0501044_0160838_11_439 140
396 3300049823 Ga0501044_0202452 Ga0501044_0202452_1138_1614 140
397 3300049823 Ga0501044_0241345 Ga0501044_0241345_428_856 140
398 3300049823 Ga0501044_0380104 Ga0501044_0380104_281_733 140
399 3300049823 Ga0501044_1079885 Ga0501044_1079885_105_587 140
400 3300049824 Ga0501045_0027284 Ga0501045_0027284_1984_2412 140
401 3300049824 Ga0501045_0138203 Ga0501045_0138203_34_462 140
402 3300049824 Ga0501045_0493967 Ga0501045_0493967_240_668 140
403 3300049824 Ga0501045_0930345 Ga0501045_0930345_181_609 140
404 3300050507 nmdc:mga05p37_76561_c1 nmdc:mga05p37_76561_c1_1461_1904 140
405 3300050511 nmdc:mga08y16_326828_c1 nmdc:mga08y16_326828_c1_450_893 140
406 3300050514 nmdc:mga08x19_669556_c1 nmdc:mga08x19_669556_c1_93_521 140
407 3300053077 Ga0495601_0076470 Ga0495601_0076470_398_826 140
408 3300053078 Ga0495612_0035304 Ga0495612_0035304_182_610 140
409 3300053078 Ga0495612_0088533 Ga0495612_0088533_588_1016 140
410 3300054114 Ga0501084_0046950 Ga0501084_0046950_2392_2874 140
411 3300054114 Ga0501084_0169108 Ga0501084_0169108_675_1103 140
412 3300060353 Ga0501082_0045117 Ga0501082_0045117_413_841 140
413 3300060353 Ga0501082_0067800 Ga0501082_0067800_660_1142 140
414 3300060353 Ga0501082_0281491 Ga0501082_0281491_733_1161 140
415 3300061734 Ga0530510_1155878 Ga0530510_1155878_37_519 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

34

163

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.9422 9 66
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9394 10 66
3irq-assembly1.cif.gz_A crystal structure of a z-z junction 0.9389 8 66
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.9349 4 66
3f22-assembly1.cif.gz_B crystal structure of zalpha in complex with d(cgtacg) 0.933 8 66
ID Description Score Start End Superfamily
3irqD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 9 66 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9394 10 66 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.934 4 66 1.10.10.10
5zuoC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9319 10 66 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9302 26 66 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W5MW58-F1-model_v4 Rrf2 family nitric oxide-sensitive transcriptional repressor 0.9188 1 131 GO:0003677
GO:0003700
GO:0005829
GO:0051537
AF-A0A5C7QU51-F1-model_v4 Rrf2 family transcriptional regulator 0.917 1 131 GO:0003677
GO:0003700
GO:0005829
GO:0051537
AF-A0A1G3GN22-F1-model_v4 BadM/Rrf2 family transcriptional regulator 0.9165 1 135 GO:0003677
GO:0003700
GO:0005829
GO:0051537
AF-A0A2E4QQD7-F1-model_v4 Rrf2 family transcriptional regulator 0.9153 1 130 GO:0003677
GO:0003700
GO:0005829
GO:0051537
AF-A0A0K6H7T2-F1-model_v4 deleted 0.9147 1 137

Feature Viewer

pLDDT pTM Quality
86.57 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map