F438580

General Info

Members Datasets Scaffolds Average Seq Length
415 184 830 238

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10077849|Ga0163161_100778493
Length 276
Sequence VRHPLARRGDGVLHRVVNLVLDRAVASPTACDIASPLRQNIGLAMEFRNIVILTGAGISADSGLATFRGADGLWEGHHVEDVATPEAFRRDPALVHQFYDARRARLSEVEPNAAHHALARLDAEWPGDLLIVTQNVDDLHERAGAKRLLHMHGELTSGWCLACDQRFGWSGPMGEGASCPSCQAAGRVRPDIVWFGEMPYDMERIDAALRNADLFVSIGTSGAVYPAAGFVQSARYCGAHCVEMNLEPSQGSIFFNETRLGRAKDLVPAWVEELLA

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
182 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
183 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
184 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 3.37
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10077849 3300017792 Bacteria 2436
2 JGI24737J22298_10000293 3300001990 Bacteria 16594
3 JGI24738J21930_10000814 3300002075 Bacteria 8931
4 Ga0070658_10000001 3300005327 Bacteria 856789
5 Ga0070658_10000891 3300005327 Bacteria 25556
6 Ga0070658_10042298 3300005327 Bacteria 3679
7 Ga0070658_10091850 3300005327 Bacteria 2502
8 Ga0070658_10242316 3300005327 Bacteria 1528
9 Ga0070658_10242801 3300005327 Bacteria 1527
10 Ga0070676_10004996 3300005328 Bacteria 7025
11 Ga0070670_100168798 3300005331 Bacteria 1898
12 Ga0070677_10089095 3300005333 Bacteria 1338
13 Ga0070677_10191319 3300005333 Bacteria 981
14 Ga0068869_100000094 3300005334 Bacteria 41359
15 Ga0068869_100054716 3300005334 Bacteria 2906
16 Ga0070666_10118718 3300005335 Bacteria 1833
17 Ga0070680_100101052 3300005336 Bacteria 2394
18 Ga0070680_100758159 3300005336 Bacteria 836
19 Ga0068868_100000113 3300005338 Bacteria 50799
20 Ga0070660_100001519 3300005339 Bacteria 15915
21 Ga0070660_100001877 3300005339 Bacteria 14470
22 Ga0070660_100020164 3300005339 Bacteria 4895
23 Ga0070660_100038646 3300005339 Bacteria 3624
24 Ga0070660_100041201 3300005339 Bacteria 3519
25 Ga0070689_100219498 3300005340 Bacteria 1559
26 Ga0070687_100240747 3300005343 Bacteria 1119
27 Ga0070661_100016841 3300005344 Bacteria 5174
28 Ga0070692_10003730 3300005345 Bacteria 6253
29 Ga0070668_100002775 3300005347 Bacteria 12873
30 Ga0070669_100000155 3300005353 Bacteria 61710
31 Ga0070669_100020276 3300005353 Bacteria 4749
32 Ga0070669_100044965 3300005353 Bacteria 3217
33 Ga0070675_100022533 3300005354 Bacteria 5034
34 Ga0070671_100013050 3300005355 Bacteria 6697
35 Ga0070671_100090107 3300005355 Bacteria 2567
36 Ga0070674_100019554 3300005356 Bacteria 4304
37 Ga0070673_100001756 3300005364 Bacteria 12927
38 Ga0070673_100171098 3300005364 Bacteria 1854
39 Ga0070659_100000305 3300005366 Bacteria 38108
40 Ga0070659_100003359 3300005366 Bacteria 11387
41 Ga0070659_100004185 3300005366 Bacteria 10295
42 Ga0070659_100007380 3300005366 Bacteria 7987
43 Ga0070659_100126912 3300005366 Bacteria 2070
44 Ga0070659_100273680 3300005366 Bacteria 1403
45 Ga0070659_100360289 3300005366 Bacteria 1222
46 Ga0070667_100003284 3300005367 Bacteria 13815
47 Ga0070667_100005549 3300005367 Bacteria 10525
48 Ga0070667_100020175 3300005367 Bacteria 5533
49 Ga0070667_100486246 3300005367 Bacteria 1130
50 Ga0070694_100009908 3300005444 Bacteria 5855
51 Ga0070663_100078026 3300005455 Bacteria 2426
52 Ga0070662_100012344 3300005457 Bacteria 5664
53 Ga0070662_100017631 3300005457 Bacteria 4818
54 Ga0070662_100024764 3300005457 Bacteria 4138
55 Ga0070681_10023242 3300005458 Bacteria 6233
56 Ga0070681_10062150 3300005458 Bacteria 3708
57 Ga0070681_10435679 3300005458 Bacteria 1223
58 Ga0068867_100001817 3300005459 Bacteria 14865
59 Ga0068867_100010918 3300005459 Bacteria 6405
60 Ga0070699_100517718 3300005518 Bacteria 1084
61 Ga0070679_100088459 3300005530 Bacteria 3085
62 Ga0070679_100225898 3300005530 Bacteria 1832
63 Ga0070679_100266073 3300005530 Bacteria 1669
64 Ga0068853_100005924 3300005539 Bacteria 9651
65 Ga0068853_100022599 3300005539 Bacteria 5254
66 Ga0068853_100025469 3300005539 Bacteria 4964
67 Ga0068853_100220368 3300005539 Bacteria 1732
68 Ga0070672_100000710 3300005543 Bacteria 19719
69 Ga0070672_100013761 3300005543 Bacteria 5721
70 Ga0070695_100152172 3300005545 Bacteria 1616
71 Ga0070693_100108366 3300005547 Bacteria 1704
72 Ga0070693_100394780 3300005547 Bacteria 957
73 Ga0070665_100000995 3300005548 Bacteria 35932
74 Ga0070665_100171238 3300005548 Bacteria 2172
75 Ga0068855_100038147 3300005563 Bacteria 5709
76 Ga0070664_100032263 3300005564 Bacteria 4380
77 Ga0070664_100169064 3300005564 Bacteria 1939
78 Ga0068857_100004853 3300005577 Bacteria 11402
79 Ga0068857_100018433 3300005577 Bacteria 6123
80 Ga0068857_100188831 3300005577 Bacteria 1876
81 Ga0068854_100000206 3300005578 Bacteria 39747
82 Ga0068854_100000236 3300005578 Bacteria 37598
83 Ga0068854_100079015 3300005578 Bacteria 2425
84 Ga0068854_100281297 3300005578 Bacteria 1340
85 Ga0068856_100017069 3300005614 Bacteria 7036
86 Ga0068856_100116421 3300005614 Bacteria 2673
87 Ga0068852_100002924 3300005616 Bacteria 11864
88 Ga0068852_100086851 3300005616 Bacteria 2789
89 Ga0068852_100142460 3300005616 Bacteria 2220
90 Ga0068859_100001691 3300005617 Bacteria 22476
91 Ga0068859_100007995 3300005617 Bacteria 10722
92 Ga0068859_100148071 3300005617 Bacteria 2423
93 Ga0068859_100152907 3300005617 Bacteria 2383
94 Ga0068864_100000428 3300005618 Bacteria 36392
95 Ga0068864_100019569 3300005618 Bacteria 5662
96 Ga0068864_100102796 3300005618 Bacteria 2536
97 Ga0068866_10082265 3300005718 Bacteria 1732
98 Ga0068866_10227022 3300005718 Bacteria 1130
99 Ga0068861_100341256 3300005719 Bacteria 1311
100 Ga0068851_10133079 3300005834 Bacteria 1346
101 Ga0068863_100000634 3300005841 Bacteria 35566
102 Ga0068858_100000874 3300005842 Bacteria 31179
103 Ga0068858_100001980 3300005842 Bacteria 20919
104 Ga0068858_100012384 3300005842 Bacteria 8041
105 Ga0068858_100103599 3300005842 Bacteria 2655
106 Ga0068860_100003691 3300005843 Bacteria 15765
107 Ga0068860_100006399 3300005843 Bacteria 11822
108 Ga0068860_100019107 3300005843 Bacteria 6654
109 Ga0068860_100051191 3300005843 Bacteria 3930
110 Ga0068860_100541909 3300005843 Bacteria 1165
111 Ga0068862_100036890 3300005844 Bacteria 4143
112 Ga0068862_100112537 3300005844 Bacteria 2391
113 Ga0097621_100003334 3300006237 Bacteria 11047
114 Ga0097621_100042600 3300006237 Bacteria 3657
115 Ga0068871_100023392 3300006358 Bacteria 4779
116 Ga0068871_100058543 3300006358 Bacteria 3137
117 Ga0097620_100001691 3300006931 Bacteria 22476
118 Ga0097620_100007995 3300006931 Bacteria 10722
119 Ga0097620_100148071 3300006931 Bacteria 2423
120 Ga0097620_100152919 3300006931 Bacteria 2383
121 Ga0105240_10021921 3300009093 Bacteria 8485
122 Ga0105240_10116117 3300009093 Bacteria 3230
123 Ga0111539_10568261 3300009094 Bacteria 1321
124 Ga0105245_10038702 3300009098 Bacteria 4243
125 Ga0105245_10096984 3300009098 Bacteria 2722
126 Ga0105247_10119637 3300009101 Bacteria 1705
127 Ga0105243_10235632 3300009148 Bacteria 1626
128 Ga0105241_10049745 3300009174 Bacteria 3193
129 Ga0105241_10151503 3300009174 Bacteria 1898
130 Ga0105241_10713948 3300009174 Bacteria 916
131 Ga0105248_10000413 3300009177 Bacteria 49136
132 Ga0105248_10001472 3300009177 Bacteria 26219
133 Ga0105248_10004409 3300009177 Bacteria 15579
134 Ga0105248_10034243 3300009177 Bacteria 5678
135 Ga0105248_11004701 3300009177 Bacteria 942
136 Ga0105238_10031422 3300009551 Bacteria 5405
137 Ga0105238_10065235 3300009551 Bacteria 3642
138 Ga0105249_10015864 3300009553 Bacteria 6676
139 Ga0105249_10728972 3300009553 Bacteria 1053
140 Ga0105239_10006320 3300010375 Bacteria 13785
141 Ga0105239_10068720 3300010375 Bacteria 3893
142 Ga0157373_10002262 3300013100 Bacteria 14594
143 Ga0157373_10107348 3300013100 Bacteria 1963
144 Ga0157373_10281149 3300013100 Bacteria 1179
145 Ga0157371_10002300 3300013102 Bacteria 18396
146 Ga0157371_10030739 3300013102 Bacteria 3872
147 Ga0157371_10243502 3300013102 Bacteria 1294
148 Ga0157369_10189836 3300013105 Bacteria 2159
149 Ga0157369_10231244 3300013105 Bacteria 1933
150 Ga0157378_10001977 3300013297 Bacteria 18333
151 Ga0163162_10023769 3300013306 Bacteria 6049
152 Ga0163162_10024015 3300013306 Bacteria 6016
153 Ga0163162_10672053 3300013306 Bacteria 1159
154 Ga0157375_10310731 3300013308 Bacteria 1740
155 Ga0157375_10343690 3300013308 Bacteria 1657
156 Ga0157375_10745616 3300013308 Bacteria 1131
157 Ga0163163_10082441 3300014325 Bacteria 3219
158 Ga0157380_10002756 3300014326 Bacteria 11931
159 Ga0157380_10273140 3300014326 Bacteria 1542
160 Ga0157380_10494552 3300014326 Bacteria 1186
161 Ga0157379_10006729 3300014968 Bacteria 9931
162 Ga0163161_10192997 3300017792 Bacteria 1567
163 Ga0213872_10086519 3300021361 Bacteria 1404
164 Ga0209148_1000074 3300025254 Bacteria 314356
165 Ga0207697_10000109 3300025315 Bacteria 38398
166 Ga0207656_10090302 3300025321 Bacteria 1390
167 Ga0207682_10146201 3300025893 Bacteria 1063
168 Ga0207688_10000437 3300025901 Bacteria 19709
169 Ga0207647_10000446 3300025904 Bacteria 33539
170 Ga0207647_10008195 3300025904 Bacteria 7507
171 Ga0207647_10009611 3300025904 Bacteria 6867
172 Ga0207647_10017636 3300025904 Bacteria 4851
173 Ga0207645_10022319 3300025907 Bacteria 4120
174 Ga0207705_10000002 3300025909 Bacteria 2046852
175 Ga0207705_10001285 3300025909 Bacteria 20149
176 Ga0207705_10007155 3300025909 Bacteria 8226
177 Ga0207705_10194527 3300025909 Bacteria 1535
178 Ga0207707_10241931 3300025912 Bacteria 1569
179 Ga0207707_10358770 3300025912 Bacteria 1255
180 Ga0207695_10086491 3300025913 Bacteria 3161
181 Ga0207695_10442823 3300025913 Bacteria 1182
182 Ga0207660_10005689 3300025917 Bacteria 8089
183 Ga0207657_10000082 3300025919 Bacteria 89667
184 Ga0207657_10000143 3300025919 Bacteria 72146
185 Ga0207657_10002328 3300025919 Bacteria 20592
186 Ga0207657_10002553 3300025919 Bacteria 19693
187 Ga0207657_10006836 3300025919 Bacteria 11768
188 Ga0207649_10045802 3300025920 Bacteria 2683
189 Ga0207649_10077898 3300025920 Bacteria 2137
190 Ga0207649_10280471 3300025920 Bacteria 1211
191 Ga0207652_10001433 3300025921 Bacteria 21127
192 Ga0207652_10018615 3300025921 Bacteria 5698
193 Ga0207652_10186783 3300025921 Bacteria 1864
194 Ga0207681_10001626 3300025923 Bacteria 14490
195 Ga0207681_10061428 3300025923 Bacteria 2583
196 Ga0207681_10168032 3300025923 Bacteria 1660
197 Ga0207694_10005716 3300025924 Bacteria 9531
198 Ga0207694_10107887 3300025924 Bacteria 2212
199 Ga0207650_10036868 3300025925 Bacteria 3559
200 Ga0207659_10017980 3300025926 Bacteria 4626
201 Ga0207687_10020101 3300025927 Bacteria 4429
202 Ga0207687_10375316 3300025927 Bacteria 1164
203 Ga0207644_10016794 3300025931 Bacteria 4929
204 Ga0207644_10088267 3300025931 Bacteria 2306
205 Ga0207644_10142711 3300025931 Bacteria 1846
206 Ga0207644_10417107 3300025931 Bacteria 1099
207 Ga0207690_10004216 3300025932 Bacteria 8496
208 Ga0207690_10007000 3300025932 Bacteria 6686
209 Ga0207690_10009895 3300025932 Bacteria 5663
210 Ga0207690_10016590 3300025932 Bacteria 4485
211 Ga0207690_10086720 3300025932 Bacteria 2201
212 Ga0207690_10260500 3300025932 Bacteria 1343
213 Ga0207706_10000300 3300025933 Bacteria 53727
214 Ga0207706_10003071 3300025933 Bacteria 16064
215 Ga0207706_10016261 3300025933 Bacteria 6720
216 Ga0207706_10043528 3300025933 Bacteria 3978
217 Ga0207706_10081224 3300025933 Bacteria 2849
218 Ga0207706_10187578 3300025933 Bacteria 1815
219 Ga0207706_10220227 3300025933 Bacteria 1662
220 Ga0207670_10015979 3300025936 Bacteria 4498
221 Ga0207691_10000294 3300025940 Bacteria 49457
222 Ga0207691_10094196 3300025940 Bacteria 2680
223 Ga0207711_10000218 3300025941 Bacteria 61467
224 Ga0207711_10003143 3300025941 Bacteria 14401
225 Ga0207711_10415184 3300025941 Bacteria 1251
226 Ga0207689_10000064 3300025942 Bacteria 84222
227 Ga0207689_10064262 3300025942 Bacteria 3020
228 Ga0207679_10186785 3300025945 Bacteria 1719
229 Ga0207667_10020043 3300025949 Bacteria 7447
230 Ga0207667_10538884 3300025949 Bacteria 1181
231 Ga0207651_10000355 3300025960 Bacteria 19400
232 Ga0207712_10002447 3300025961 Bacteria 11986
233 Ga0207668_10040684 3300025972 Bacteria 3138
234 Ga0207668_10453983 3300025972 Bacteria 1094
235 Ga0207668_10657151 3300025972 Bacteria 918
236 Ga0207640_10000067 3300025981 Bacteria 85026
237 Ga0207640_10001142 3300025981 Bacteria 14572
238 Ga0207640_10023138 3300025981 Bacteria 3731
239 Ga0207640_10132746 3300025981 Bacteria 1802
240 Ga0207658_10004040 3300025986 Bacteria 10259
241 Ga0207658_10183280 3300025986 Bacteria 1734
242 Ga0207677_10006963 3300026023 Bacteria 6218
243 Ga0207703_10008809 3300026035 Bacteria 7955
244 Ga0207639_10004582 3300026041 Bacteria 9303
245 Ga0207639_10065848 3300026041 Bacteria 2814
246 Ga0207639_10113515 3300026041 Bacteria 2213
247 Ga0207678_10031885 3300026067 Bacteria 4594
248 Ga0207678_10032650 3300026067 Bacteria 4537
249 Ga0207678_10133243 3300026067 Bacteria 2120
250 Ga0207678_10227004 3300026067 Bacteria 1599
251 Ga0207702_10011713 3300026078 Bacteria 7306
252 Ga0207702_10015844 3300026078 Bacteria 6241
253 Ga0207641_10000573 3300026088 Bacteria 40695
254 Ga0207641_10016059 3300026088 Bacteria 6132
255 Ga0207641_10034128 3300026088 Bacteria 4230
256 Ga0207648_10001537 3300026089 Bacteria 25401
257 Ga0207648_10008749 3300026089 Bacteria 9757
258 Ga0207676_10004949 3300026095 Bacteria 9443
259 Ga0207676_10006684 3300026095 Bacteria 8158
260 Ga0207674_10002909 3300026116 Bacteria 21260
261 Ga0207674_10008433 3300026116 Bacteria 11906
262 Ga0207674_10169228 3300026116 Bacteria 2139
263 Ga0207675_100262336 3300026118 Bacteria 1675
264 Ga0207683_10013889 3300026121 Bacteria 6867
265 Ga0207698_10010153 3300026142 Bacteria 6033
266 Ga0207698_10036238 3300026142 Bacteria 3618
267 Ga0207698_10090233 3300026142 Bacteria 2506
268 Ga0207698_10139382 3300026142 Bacteria 2087
269 Ga0268266_10000318 3300028379 Bacteria 76400
270 Ga0268265_10026131 3300028380 Bacteria 4151
271 Ga0268265_10096033 3300028380 Bacteria 2381
272 Ga0268264_10001863 3300028381 Bacteria 19178
273 Ga0268264_10002999 3300028381 Bacteria 14637
274 Ga0268264_10018939 3300028381 Bacteria 5628
275 Ga0268264_10058563 3300028381 Bacteria 3226
276 Ga0268264_10461026 3300028381 Bacteria 1233
277 Ga0316183_1061051 3300030742 Bacteria 2173
278 Ga0265327_10023757 3300031251 Bacteria 3620
279 Ga0307408_100047500 3300031548 Bacteria 3075
280 Ga0307408_100148701 3300031548 Bacteria 1847
281 Ga0307408_100214561 3300031548 Bacteria 1566
282 Ga0307408_100216804 3300031548 Bacteria 1559
283 Ga0307408_100368993 3300031548 Bacteria 1223
284 Ga0307408_100507824 3300031548 Bacteria 1056
285 Ga0265314_10018124 3300031711 Bacteria 5501
286 Ga0307405_10054247 3300031731 Bacteria 2501
287 Ga0307405_10097097 3300031731 Bacteria 1966
288 Ga0307405_10187833 3300031731 Bacteria 1489
289 Ga0307405_10558429 3300031731 Bacteria 928
290 Ga0307413_10001145 3300031824 Bacteria 9730
291 Ga0307413_10001359 3300031824 Bacteria 9168
292 Ga0307413_10010607 3300031824 Bacteria 4482
293 Ga0307413_10047109 3300031824 Bacteria 2568
294 Ga0307413_10248855 3300031824 Bacteria 1317
295 Ga0307410_10009384 3300031852 Bacteria 5485
296 Ga0307410_10059913 3300031852 Bacteria 2600
297 Ga0307410_10065164 3300031852 Bacteria 2505
298 Ga0307410_10101130 3300031852 Bacteria 2066
299 Ga0307410_10387152 3300031852 Bacteria 1126
300 Ga0307410_10786151 3300031852 Bacteria 808
301 Ga0307406_10038716 3300031901 Bacteria 2953
302 Ga0307406_10057012 3300031901 Bacteria 2504
303 Ga0307407_10042853 3300031903 Bacteria 2541
304 Ga0307407_10087000 3300031903 Bacteria 1905
305 Ga0307407_10131287 3300031903 Bacteria 1603
306 Ga0307412_10069189 3300031911 Bacteria 2402
307 Ga0307412_10109231 3300031911 Bacteria 1971
308 Ga0307412_10360100 3300031911 Bacteria 1171
309 Ga0307409_100003478 3300031995 Bacteria 8561
310 Ga0307409_100016750 3300031995 Bacteria 4862
311 Ga0307409_100020353 3300031995 Bacteria 4519
312 Ga0307409_100036139 3300031995 Bacteria 3627
313 Ga0307409_100039057 3300031995 Bacteria 3518
314 Ga0307409_100051326 3300031995 Bacteria 3155
315 Ga0307409_100051586 3300031995 Bacteria 3149
316 Ga0307409_100311707 3300031995 Bacteria 1469
317 Ga0307409_100617600 3300031995 Bacteria 1073
318 Ga0307409_100704721 3300031995 Bacteria 1009
319 Ga0307416_100025848 3300032002 Bacteria 4314
320 Ga0307416_100237593 3300032002 Bacteria 1762
321 Ga0307416_101239744 3300032002 Bacteria 851
322 Ga0307414_10001327 3300032004 Bacteria 12783
323 Ga0307414_10007990 3300032004 Bacteria 5978
324 Ga0307414_10014045 3300032004 Bacteria 4786
325 Ga0307414_10027263 3300032004 Bacteria 3690
326 Ga0307414_10041379 3300032004 Bacteria 3121
327 Ga0307414_10048367 3300032004 Bacteria 2933
328 Ga0307414_10065036 3300032004 Bacteria 2600
329 Ga0307414_10100102 3300032004 Bacteria 2179
330 Ga0307414_10303816 3300032004 Bacteria 1351
331 Ga0307411_10001262 3300032005 Bacteria 10114
332 Ga0307411_10055267 3300032005 Bacteria 2611
333 Ga0307411_10172896 3300032005 Bacteria 1631
334 Ga0307411_10243488 3300032005 Bacteria 1409
335 Ga0307411_10504791 3300032005 Bacteria 1023
336 Ga0307415_100045133 3300032126 Bacteria 2952
337 Ga0307415_100053610 3300032126 Bacteria 2749
338 Ga0307415_100271334 3300032126 Bacteria 1390
339 Ga0307415_100323770 3300032126 Bacteria 1286
340 Ga0307415_100552835 3300032126 Bacteria 1016
341 Ga0395899_0001090 3300037312 Bacteria 24379
342 Ga0395899_0004210 3300037312 Bacteria 11284
343 Ga0395899_0036210 3300037312 Bacteria 3702
344 Ga0395899_0219254 3300037312 Bacteria 1318
345 Ga0395900_0046909 3300037418 Bacteria 4448
346 Ga0395900_0053036 3300037418 Bacteria 4174
347 Ga0395900_0097216 3300037418 Bacteria 3025
348 Ga0395900_0105672 3300037418 Bacteria 2892
349 Ga0395900_0122210 3300037418 Bacteria 2671
350 Ga0395900_0278227 3300037418 Bacteria 1666
351 Ga0395898_0051023 3300037466 Bacteria 4046
352 Ga0395898_0095341 3300037466 Bacteria 2858
353 Ga0395898_0405988 3300037466 Bacteria 1299
354 Ga0395898_0470903 3300037466 Bacteria 1195
355 Ga0395905_0011536 3300037471 Bacteria 8539
356 Ga0395905_0026975 3300037471 Bacteria 5417
357 Ga0395905_0055345 3300037471 Bacteria 3713
358 Ga0395905_0072001 3300037471 Bacteria 3240
359 Ga0395905_0081645 3300037471 Bacteria 3029
360 Ga0395905_0684796 3300037471 Bacteria 927
361 Ga0395901_0011458 3300038443 Bacteria 8984
362 Ga0395901_0054842 3300038443 Bacteria 4143
363 Ga0395901_0150745 3300038443 Bacteria 2443
364 Ga0395901_0365771 3300038443 Bacteria 1486
365 Ga0395901_0588303 3300038443 Bacteria 1123
366 Ga0439448_0004166 3300042005 Bacteria 4070
367 Ga0439455_0028707 3300042012 Bacteria 1371
368 Ga0439458_0000177 3300042157 Bacteria 14388
369 Ga0466966_0080827 3300044684 Bacteria 2024
370 Ga0466961_0229238 3300044693 Bacteria 1143
371 Ga0466971_0082799 3300044719 Bacteria 1465
372 Ga0466970_0335243 3300044765 Bacteria 857
373 Ga0466957_0010691 3300044842 Bacteria 5276
374 Ga0466960_0033135 3300044901 Bacteria 2399
375 Ga0466958_0110307 3300045836 Bacteria 1717
376 Ga0466967_0342704 3300045976 Bacteria 1445
377 Ga0495584_0072832 3300046491 Bacteria 1726
378 Ga0495596_0051185 3300046500 Bacteria 1618
379 Ga0495632_0000105 3300046519 Bacteria 85761
380 Ga0495663_0000009 3300046525 Bacteria 256308
381 Ga0495663_0000381 3300046525 Bacteria 16415
382 Ga0495663_0003568 3300046525 Bacteria 4474
383 Ga0495663_0025859 3300046525 Bacteria 1715
384 Ga0495621_0001871 3300046539 Bacteria 5527
385 Ga0495621_0012902 3300046539 Bacteria 2614
386 Ga0495633_0000546 3300046558 Bacteria 37303
387 Ga0495625_0000006 3300046660 Bacteria 578292
388 Ga0495659_0085818 3300046664 Bacteria 1202
389 Ga0495670_0006356 3300046691 Bacteria 5803
390 Ga0495677_0021191 3300047445 Bacteria 2356
391 Ga0496100_0014341 3300048903 Bacteria 4600
392 Ga0496102_0039069 3300048905 Bacteria 4286
393 Ga0496102_0189171 3300048905 Bacteria 1940
394 Ga0496103_0016684 3300048906 Bacteria 4386
395 Ga0496104_0555192 3300048907 Bacteria 1059
396 Ga0496106_0210182 3300048909 Bacteria 1550
397 Ga0496107_0026987 3300048910 Bacteria 4076
398 Ga0496107_0034070 3300048910 Bacteria 3645
399 Ga0496109_0078718 3300048912 Bacteria 3035
400 Ga0496111_0244087 3300048914 Bacteria 1333
401 Ga0496112_0056962 3300048915 Bacteria 3847
402 Ga0496114_0034446 3300048917 Bacteria 4178
403 Ga0496114_0076935 3300048917 Bacteria 2812
404 Ga0496115_0004538 3300048918 Bacteria 10045
405 Ga0496121_0002997 3300048924 Bacteria 24524
406 Ga0501069_0298963 3300049585 Bacteria 944
407 Ga0501249_000065 3300049679 Bacteria 38092
408 Ga0501249_008193 3300049679 Bacteria 2167
409 Ga0501268_008041 3300049765 Bacteria 1587
410 nmdc:mga07m45_82297_c1 3300050496 Bacteria 1838
411 nmdc:mga08y16_404379_c1 3300050511 Bacteria 1397
412 Ga0500562_048994 3300053108 Bacteria 1128
413 2896430753 2896429255 Bacteria 2557483
414 2984557253 2984555340 Bacteria 4247089
415 2993359431 2993356040 Bacteria 4247105
416 Ga0163161_10077849
417 JGI24737J22298_10000293
418 JGI24738J21930_10000814
419 Ga0070658_10000001
420 Ga0070658_10000891
421 Ga0070658_10042298
422 Ga0070658_10091850
423 Ga0070658_10242316
424 Ga0070658_10242801
425 Ga0070676_10004996
426 Ga0070670_100168798
427 Ga0070677_10089095
428 Ga0070677_10191319
429 Ga0068869_100000094
430 Ga0068869_100054716
431 Ga0070666_10118718
432 Ga0070680_100101052
433 Ga0070680_100758159
434 Ga0068868_100000113
435 Ga0070660_100001519
436 Ga0070660_100001877
437 Ga0070660_100020164
438 Ga0070660_100038646
439 Ga0070660_100041201
440 Ga0070689_100219498
441 Ga0070687_100240747
442 Ga0070661_100016841
443 Ga0070692_10003730
444 Ga0070668_100002775
445 Ga0070669_100000155
446 Ga0070669_100020276
447 Ga0070669_100044965
448 Ga0070675_100022533
449 Ga0070671_100013050
450 Ga0070671_100090107
451 Ga0070674_100019554
452 Ga0070673_100001756
453 Ga0070673_100171098
454 Ga0070659_100000305
455 Ga0070659_100003359
456 Ga0070659_100004185
457 Ga0070659_100007380
458 Ga0070659_100126912
459 Ga0070659_100273680
460 Ga0070659_100360289
461 Ga0070667_100003284
462 Ga0070667_100005549
463 Ga0070667_100020175
464 Ga0070667_100486246
465 Ga0070694_100009908
466 Ga0070663_100078026
467 Ga0070662_100012344
468 Ga0070662_100017631
469 Ga0070662_100024764
470 Ga0070681_10023242
471 Ga0070681_10062150
472 Ga0070681_10435679
473 Ga0068867_100001817
474 Ga0068867_100010918
475 Ga0070699_100517718
476 Ga0070679_100088459
477 Ga0070679_100225898
478 Ga0070679_100266073
479 Ga0068853_100005924
480 Ga0068853_100022599
481 Ga0068853_100025469
482 Ga0068853_100220368
483 Ga0070672_100000710
484 Ga0070672_100013761
485 Ga0070695_100152172
486 Ga0070693_100108366
487 Ga0070693_100394780
488 Ga0070665_100000995
489 Ga0070665_100171238
490 Ga0068855_100038147
491 Ga0070664_100032263
492 Ga0070664_100169064
493 Ga0068857_100004853
494 Ga0068857_100018433
495 Ga0068857_100188831
496 Ga0068854_100000206
497 Ga0068854_100000236
498 Ga0068854_100079015
499 Ga0068854_100281297
500 Ga0068856_100017069
501 Ga0068856_100116421
502 Ga0068852_100002924
503 Ga0068852_100086851
504 Ga0068852_100142460
505 Ga0068859_100001691
506 Ga0068859_100007995
507 Ga0068859_100148071
508 Ga0068859_100152907
509 Ga0068864_100000428
510 Ga0068864_100019569
511 Ga0068864_100102796
512 Ga0068866_10082265
513 Ga0068866_10227022
514 Ga0068861_100341256
515 Ga0068851_10133079
516 Ga0068863_100000634
517 Ga0068858_100000874
518 Ga0068858_100001980
519 Ga0068858_100012384
520 Ga0068858_100103599
521 Ga0068860_100003691
522 Ga0068860_100006399
523 Ga0068860_100019107
524 Ga0068860_100051191
525 Ga0068860_100541909
526 Ga0068862_100036890
527 Ga0068862_100112537
528 Ga0097621_100003334
529 Ga0097621_100042600
530 Ga0068871_100023392
531 Ga0068871_100058543
532 Ga0097620_100001691
533 Ga0097620_100007995
534 Ga0097620_100148071
535 Ga0097620_100152919
536 Ga0105240_10021921
537 Ga0105240_10116117
538 Ga0111539_10568261
539 Ga0105245_10038702
540 Ga0105245_10096984
541 Ga0105247_10119637
542 Ga0105243_10235632
543 Ga0105241_10049745
544 Ga0105241_10151503
545 Ga0105241_10713948
546 Ga0105248_10000413
547 Ga0105248_10001472
548 Ga0105248_10004409
549 Ga0105248_10034243
550 Ga0105248_11004701
551 Ga0105238_10031422
552 Ga0105238_10065235
553 Ga0105249_10015864
554 Ga0105249_10728972
555 Ga0105239_10006320
556 Ga0105239_10068720
557 Ga0157373_10002262
558 Ga0157373_10107348
559 Ga0157373_10281149
560 Ga0157371_10002300
561 Ga0157371_10030739
562 Ga0157371_10243502
563 Ga0157369_10189836
564 Ga0157369_10231244
565 Ga0157378_10001977
566 Ga0163162_10023769
567 Ga0163162_10024015
568 Ga0163162_10672053
569 Ga0157375_10310731
570 Ga0157375_10343690
571 Ga0157375_10745616
572 Ga0163163_10082441
573 Ga0157380_10002756
574 Ga0157380_10273140
575 Ga0157380_10494552
576 Ga0157379_10006729
577 Ga0163161_10192997
578 Ga0213872_10086519
579 Ga0209148_1000074
580 Ga0207697_10000109
581 Ga0207656_10090302
582 Ga0207682_10146201
583 Ga0207688_10000437
584 Ga0207647_10000446
585 Ga0207647_10008195
586 Ga0207647_10009611
587 Ga0207647_10017636
588 Ga0207645_10022319
589 Ga0207705_10000002
590 Ga0207705_10001285
591 Ga0207705_10007155
592 Ga0207705_10194527
593 Ga0207707_10241931
594 Ga0207707_10358770
595 Ga0207695_10086491
596 Ga0207695_10442823
597 Ga0207660_10005689
598 Ga0207657_10000082
599 Ga0207657_10000143
600 Ga0207657_10002328
601 Ga0207657_10002553
602 Ga0207657_10006836
603 Ga0207649_10045802
604 Ga0207649_10077898
605 Ga0207649_10280471
606 Ga0207652_10001433
607 Ga0207652_10018615
608 Ga0207652_10186783
609 Ga0207681_10001626
610 Ga0207681_10061428
611 Ga0207681_10168032
612 Ga0207694_10005716
613 Ga0207694_10107887
614 Ga0207650_10036868
615 Ga0207659_10017980
616 Ga0207687_10020101
617 Ga0207687_10375316
618 Ga0207644_10016794
619 Ga0207644_10088267
620 Ga0207644_10142711
621 Ga0207644_10417107
622 Ga0207690_10004216
623 Ga0207690_10007000
624 Ga0207690_10009895
625 Ga0207690_10016590
626 Ga0207690_10086720
627 Ga0207690_10260500
628 Ga0207706_10000300
629 Ga0207706_10003071
630 Ga0207706_10016261
631 Ga0207706_10043528
632 Ga0207706_10081224
633 Ga0207706_10187578
634 Ga0207706_10220227
635 Ga0207670_10015979
636 Ga0207691_10000294
637 Ga0207691_10094196
638 Ga0207711_10000218
639 Ga0207711_10003143
640 Ga0207711_10415184
641 Ga0207689_10000064
642 Ga0207689_10064262
643 Ga0207679_10186785
644 Ga0207667_10020043
645 Ga0207667_10538884
646 Ga0207651_10000355
647 Ga0207712_10002447
648 Ga0207668_10040684
649 Ga0207668_10453983
650 Ga0207668_10657151
651 Ga0207640_10000067
652 Ga0207640_10001142
653 Ga0207640_10023138
654 Ga0207640_10132746
655 Ga0207658_10004040
656 Ga0207658_10183280
657 Ga0207677_10006963
658 Ga0207703_10008809
659 Ga0207639_10004582
660 Ga0207639_10065848
661 Ga0207639_10113515
662 Ga0207678_10031885
663 Ga0207678_10032650
664 Ga0207678_10133243
665 Ga0207678_10227004
666 Ga0207702_10011713
667 Ga0207702_10015844
668 Ga0207641_10000573
669 Ga0207641_10016059
670 Ga0207641_10034128
671 Ga0207648_10001537
672 Ga0207648_10008749
673 Ga0207676_10004949
674 Ga0207676_10006684
675 Ga0207674_10002909
676 Ga0207674_10008433
677 Ga0207674_10169228
678 Ga0207675_100262336
679 Ga0207683_10013889
680 Ga0207698_10010153
681 Ga0207698_10036238
682 Ga0207698_10090233
683 Ga0207698_10139382
684 Ga0268266_10000318
685 Ga0268265_10026131
686 Ga0268265_10096033
687 Ga0268264_10001863
688 Ga0268264_10002999
689 Ga0268264_10018939
690 Ga0268264_10058563
691 Ga0268264_10461026
692 Ga0316183_1061051
693 Ga0265327_10023757
694 Ga0307408_100047500
695 Ga0307408_100148701
696 Ga0307408_100214561
697 Ga0307408_100216804
698 Ga0307408_100368993
699 Ga0307408_100507824
700 Ga0265314_10018124
701 Ga0307405_10054247
702 Ga0307405_10097097
703 Ga0307405_10187833
704 Ga0307405_10558429
705 Ga0307413_10001145
706 Ga0307413_10001359
707 Ga0307413_10010607
708 Ga0307413_10047109
709 Ga0307413_10248855
710 Ga0307410_10009384
711 Ga0307410_10059913
712 Ga0307410_10065164
713 Ga0307410_10101130
714 Ga0307410_10387152
715 Ga0307410_10786151
716 Ga0307406_10038716
717 Ga0307406_10057012
718 Ga0307407_10042853
719 Ga0307407_10087000
720 Ga0307407_10131287
721 Ga0307412_10069189
722 Ga0307412_10109231
723 Ga0307412_10360100
724 Ga0307409_100003478
725 Ga0307409_100016750
726 Ga0307409_100020353
727 Ga0307409_100036139
728 Ga0307409_100039057
729 Ga0307409_100051326
730 Ga0307409_100051586
731 Ga0307409_100311707
732 Ga0307409_100617600
733 Ga0307409_100704721
734 Ga0307416_100025848
735 Ga0307416_100237593
736 Ga0307416_101239744
737 Ga0307414_10001327
738 Ga0307414_10007990
739 Ga0307414_10014045
740 Ga0307414_10027263
741 Ga0307414_10041379
742 Ga0307414_10048367
743 Ga0307414_10065036
744 Ga0307414_10100102
745 Ga0307414_10303816
746 Ga0307411_10001262
747 Ga0307411_10055267
748 Ga0307411_10172896
749 Ga0307411_10243488
750 Ga0307411_10504791
751 Ga0307415_100045133
752 Ga0307415_100053610
753 Ga0307415_100271334
754 Ga0307415_100323770
755 Ga0307415_100552835
756 Ga0395899_0001090
757 Ga0395899_0004210
758 Ga0395899_0036210
759 Ga0395899_0219254
760 Ga0395900_0046909
761 Ga0395900_0053036
762 Ga0395900_0097216
763 Ga0395900_0105672
764 Ga0395900_0122210
765 Ga0395900_0278227
766 Ga0395898_0051023
767 Ga0395898_0095341
768 Ga0395898_0405988
769 Ga0395898_0470903
770 Ga0395905_0011536
771 Ga0395905_0026975
772 Ga0395905_0055345
773 Ga0395905_0072001
774 Ga0395905_0081645
775 Ga0395905_0684796
776 Ga0395901_0011458
777 Ga0395901_0054842
778 Ga0395901_0150745
779 Ga0395901_0365771
780 Ga0395901_0588303
781 Ga0439448_0004166
782 Ga0439455_0028707
783 Ga0439458_0000177
784 Ga0466966_0080827
785 Ga0466961_0229238
786 Ga0466971_0082799
787 Ga0466970_0335243
788 Ga0466957_0010691
789 Ga0466960_0033135
790 Ga0466958_0110307
791 Ga0466967_0342704
792 Ga0495584_0072832
793 Ga0495596_0051185
794 Ga0495632_0000105
795 Ga0495663_0000009
796 Ga0495663_0000381
797 Ga0495663_0003568
798 Ga0495663_0025859
799 Ga0495621_0001871
800 Ga0495621_0012902
801 Ga0495633_0000546
802 Ga0495625_0000006
803 Ga0495659_0085818
804 Ga0495670_0006356
805 Ga0495677_0021191
806 Ga0496100_0014341
807 Ga0496102_0039069
808 Ga0496102_0189171
809 Ga0496103_0016684
810 Ga0496104_0555192
811 Ga0496106_0210182
812 Ga0496107_0026987
813 Ga0496107_0034070
814 Ga0496109_0078718
815 Ga0496111_0244087
816 Ga0496112_0056962
817 Ga0496114_0034446
818 Ga0496114_0076935
819 Ga0496115_0004538
820 Ga0496121_0002997
821 Ga0501069_0298963
822 Ga0501249_000065
823 Ga0501249_008193
824 Ga0501268_008041
825 nmdc:mga07m45_82297_c1
826 nmdc:mga08y16_404379_c1
827 Ga0500562_048994
828 2896430753
829 2984557253
830 2993359431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

55

226

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rxl-assembly1.cif.gz_A crystal structure of cobb wt in complex with h4k16-crotonyl peptide 0.9561 4 234
1s5p-assembly1.cif.gz_A structure and substrate binding properties of cobb, a sir2 homolog protein deacetylase from eschericia coli. 0.948 4 234
6rxr-assembly1.cif.gz_A crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.9432 4 234
6rxr-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.9417 4 234
6rxm-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16-acetyl peptide 0.9405 4 233
ID Description Score Start End Superfamily
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9689 67 231 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9629 4 234 3.40.50.1220
af_P75960_40_271_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9522 4 231 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9424 4 234 3.40.50.1220
af_Q68FX9_35_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9415 2 227 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A848SJA8-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.987 1 162 GO:0017136
GO:0046872
GO:0070403
AF-A0A258Z3L3-F1-model_v4 deleted 0.9772 1 232
AF-A0A258H6Y7-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9753 1 231 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A858RRV6-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9753 5 230 GO:0005737
GO:0008270
GO:0017136
GO:0036054
GO:0036055
GO:0070403
AF-T0GFY6-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9751 2 231 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Map