F438841

General Info

Members Datasets Scaffolds Average Seq Length
416 256 832 61

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10145963|Ga0316579_101459633
Length 66
Sequence MADVLIKQVRSAAGSNPRQRDTLRTLRLGRIGKSVVREDNEDLHGLLRKVEHLVTVEPAAAAGKGS

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
173 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 0
Rhizoplane 7.69
Rhizosphere 81.01
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10145963 3300031691 Bacteria 1141
2 JGI24743J22301_10049777 3300001991 Bacteria 852
3 JGI24748J21848_1060488 3300002074 Bacteria 505
4 JGI24033J26618_1069642 3300002155 Bacteria 527
5 JGI25407J50210_10061682 3300003373 Bacteria 941
6 Ga0070658_10007473 3300005327 Bacteria 8820
7 Ga0070683_100602452 3300005329 Bacteria 1051
8 Ga0070683_101717856 3300005329 Bacteria 603
9 Ga0070670_100075753 3300005331 Bacteria 2891
10 Ga0070670_100202521 3300005331 Bacteria 1725
11 Ga0068869_100207004 3300005334 Bacteria 1549
12 Ga0070666_10457852 3300005335 Bacteria 922
13 Ga0070682_100000032 3300005337 Bacteria 155141
14 Ga0070682_100004160 3300005337 Bacteria 8021
15 Ga0068868_100127815 3300005338 Bacteria 2077
16 Ga0070660_100004072 3300005339 Bacteria 10086
17 Ga0070689_100086877 3300005340 Bacteria 2460
18 Ga0070689_100091070 3300005340 Bacteria 2404
19 Ga0070691_10004069 3300005341 Bacteria 6629
20 Ga0070687_100220741 3300005343 Bacteria 1161
21 Ga0070661_100076927 3300005344 Bacteria 2459
22 Ga0070692_10020721 3300005345 Bacteria 3190
23 Ga0070692_10022554 3300005345 Bacteria 3075
24 Ga0070668_100034700 3300005347 Bacteria 3845
25 Ga0070675_100015253 3300005354 Bacteria 6069
26 Ga0070674_100002494 3300005356 Bacteria 10191
27 Ga0070674_100904281 3300005356 Bacteria 769
28 Ga0070673_100123455 3300005364 Bacteria 2164
29 Ga0070688_100796624 3300005365 Bacteria 739
30 Ga0070659_100000983 3300005366 Bacteria 20974
31 Ga0070659_100020922 3300005366 Bacteria 4975
32 Ga0070667_100503843 3300005367 Bacteria 1110
33 Ga0070667_101299323 3300005367 Bacteria 681
34 Ga0070714_100048906 3300005435 Bacteria 3599
35 Ga0070713_100284149 3300005436 Bacteria 1519
36 Ga0070701_10103034 3300005438 Bacteria 1584
37 Ga0070711_100091961 3300005439 Bacteria 2188
38 Ga0070711_100222285 3300005439 Bacteria 1468
39 Ga0070705_100424217 3300005440 Bacteria 991
40 Ga0070705_101546387 3300005440 Bacteria 557
41 Ga0070700_100036039 3300005441 Bacteria 2998
42 Ga0070694_101914297 3300005444 Bacteria 506
43 Ga0070663_100005936 3300005455 Bacteria 7308
44 Ga0070678_100054484 3300005456 Bacteria 2915
45 Ga0070678_100377259 3300005456 Bacteria 1226
46 Ga0070662_100012555 3300005457 Bacteria 5619
47 Ga0068867_100478226 3300005459 Bacteria 1067
48 Ga0068867_100532094 3300005459 Bacteria 1015
49 Ga0070685_10027085 3300005466 Bacteria 3165
50 Ga0070685_10033076 3300005466 Bacteria 2901
51 Ga0070679_101992832 3300005530 Bacteria 530
52 Ga0070684_101640755 3300005535 Bacteria 606
53 Ga0068853_100044541 3300005539 Bacteria 3798
54 Ga0068853_100181868 3300005539 Bacteria 1907
55 Ga0070672_100000104 3300005543 Bacteria 42077
56 Ga0070672_101041468 3300005543 Bacteria 726
57 Ga0070686_100022071 3300005544 Bacteria 3789
58 Ga0070686_100172067 3300005544 Bacteria 1532
59 Ga0070686_101138794 3300005544 Bacteria 646
60 Ga0070695_100850584 3300005545 Bacteria 734
61 Ga0070693_100581531 3300005547 Bacteria 806
62 Ga0070665_100370697 3300005548 Bacteria 1438
63 Ga0070704_100904207 3300005549 Bacteria 794
64 Ga0070704_101015257 3300005549 Bacteria 751
65 Ga0070704_101438352 3300005549 Bacteria 633
66 Ga0068855_101355048 3300005563 Bacteria 735
67 Ga0070664_100020446 3300005564 Bacteria 5450
68 Ga0070664_101473019 3300005564 Bacteria 644
69 Ga0068854_100000939 3300005578 Bacteria 17543
70 Ga0068854_100005645 3300005578 Bacteria 7903
71 Ga0068856_100526842 3300005614 Bacteria 1203
72 Ga0068856_100995515 3300005614 Bacteria 857
73 Ga0070702_100905614 3300005615 Bacteria 691
74 Ga0070702_101461069 3300005615 Bacteria 561
75 Ga0068852_100000024 3300005616 Bacteria 120479
76 Ga0068852_100008410 3300005616 Bacteria 7606
77 Ga0068859_100462946 3300005617 Bacteria 1364
78 Ga0068864_100273073 3300005618 Bacteria 1576
79 Ga0068866_10012947 3300005718 Bacteria 3646
80 Ga0068861_102489983 3300005719 Bacteria 521
81 Ga0068851_10007702 3300005834 Bacteria 4952
82 Ga0068851_10017683 3300005834 Bacteria 3428
83 Ga0068851_10863862 3300005834 Bacteria 565
84 Ga0068870_10051897 3300005840 Bacteria 2172
85 Ga0068858_100317766 3300005842 Bacteria 1488
86 Ga0068860_100598347 3300005843 Bacteria 1108
87 Ga0068862_100085173 3300005844 Bacteria 2747
88 Ga0081455_10025075 3300005937 Bacteria 5511
89 Ga0081455_10128075 3300005937 Bacteria 1989
90 Ga0081455_10364500 3300005937 Bacteria 1015
91 Ga0081455_10721225 3300005937 Bacteria 633
92 Ga0081538_10000208 3300005981 Bacteria 65347
93 Ga0081538_10000396 3300005981 Bacteria 49639
94 Ga0081538_10061642 3300005981 Bacteria 2146
95 Ga0081538_10075218 3300005981 Bacteria 1834
96 Ga0081538_10094957 3300005981 Bacteria 1525
97 Ga0081540_1000553 3300005983 Bacteria 36267
98 Ga0075365_10007392 3300006038 Bacteria 6146
99 Ga0075365_10310900 3300006038 Bacteria 1109
100 Ga0075365_11064421 3300006038 Bacteria 570
101 Ga0075365_11291889 3300006038 Bacteria 513
102 Ga0075368_10337157 3300006042 Bacteria 655
103 Ga0075363_100013047 3300006048 Bacteria 4017
104 Ga0075363_100018702 3300006048 Bacteria 3455
105 Ga0075363_100035304 3300006048 Bacteria 2616
106 Ga0075363_100149071 3300006048 Bacteria 1320
107 Ga0075363_100366822 3300006048 Bacteria 843
108 Ga0075363_100825457 3300006048 Bacteria 565
109 Ga0075364_10096181 3300006051 Bacteria 1969
110 Ga0075364_10443811 3300006051 Bacteria 886
111 Ga0075364_10632867 3300006051 Bacteria 731
112 Ga0075364_11224849 3300006051 Bacteria 509
113 Ga0075364_11257012 3300006051 Bacteria 501
114 Ga0070715_10172356 3300006163 Bacteria 1079
115 Ga0075362_10127190 3300006177 Bacteria 1209
116 Ga0075367_10206250 3300006178 Bacteria 1228
117 Ga0068871_101296254 3300006358 Unclassified 685
118 Ga0075428_102527428 3300006844 Bacteria 526
119 Ga0075433_10334200 3300006852 Bacteria 1339
120 Ga0075434_100024374 3300006871 Bacteria 5914
121 Ga0068865_100000024 3300006881 Bacteria 94969
122 Ga0068865_100011914 3300006881 Bacteria 5457
123 Ga0068865_101863288 3300006881 Unclassified 544
124 Ga0075436_100878436 3300006914 Unclassified 670
125 Ga0097620_100462987 3300006931 Bacteria 1364
126 Ga0075435_100616189 3300007076 Bacteria 941
127 Ga0105240_12378100 3300009093 Bacteria 548
128 Ga0111539_10399726 3300009094 Bacteria 1600
129 Ga0105245_10003202 3300009098 Bacteria 14647
130 Ga0105245_10019614 3300009098 Bacteria 5924
131 Ga0105245_11958631 3300009098 Bacteria 639
132 Ga0105247_10085343 3300009101 Bacteria 1996
133 Ga0114129_10095204 3300009147 Bacteria 4124
134 Ga0105243_10009298 3300009148 Bacteria 7497
135 Ga0105243_10546301 3300009148 Bacteria 1106
136 Ga0105241_10098691 3300009174 Bacteria 2318
137 Ga0105242_13018385 3300009176 Bacteria 521
138 Ga0105248_10001735 3300009177 Bacteria 24226
139 Ga0105248_10512033 3300009177 Bacteria 1353
140 Ga0105237_10059780 3300009545 Bacteria 3813
141 Ga0105237_12728280 3300009545 Unclassified 505
142 Ga0105238_10563122 3300009551 Bacteria 1145
143 Ga0105249_10044378 3300009553 Bacteria 4042
144 Ga0105249_10867275 3300009553 Bacteria 969
145 Ga0105249_11383662 3300009553 Unclassified 775
146 Ga0105239_10304962 3300010375 Bacteria 1794
147 Ga0105239_10866508 3300010375 Bacteria 1036
148 Ga0105239_11052857 3300010375 Bacteria 936
149 Ga0105239_11411552 3300010375 Bacteria 804
150 Ga0105246_10045269 3300011119 Bacteria 2995
151 Ga0105246_10700585 3300011119 Bacteria 888
152 Ga0157342_1023544 3300012507 Bacteria 732
153 Ga0157371_10017630 3300013102 Bacteria 5298
154 Ga0157370_10090235 3300013104 Bacteria 2878
155 Ga0157370_10258752 3300013104 Bacteria 1609
156 Ga0157374_10735385 3300013296 Bacteria 1001
157 Ga0157378_10026190 3300013297 Bacteria 5140
158 Ga0157378_10027572 3300013297 Bacteria 5010
159 Ga0163162_10161376 3300013306 Bacteria 2363
160 Ga0157372_10000809 3300013307 Bacteria 33940
161 Ga0157372_10295530 3300013307 Bacteria 1884
162 Ga0157375_10062797 3300013308 Bacteria 3692
163 Ga0163163_10744832 3300014325 Bacteria 1043
164 Ga0157380_10000326 3300014326 Bacteria 28781
165 Ga0157380_10010840 3300014326 Bacteria 6571
166 Ga0157380_10471564 3300014326 Bacteria 1211
167 Ga0157377_10676725 3300014745 Bacteria 746
168 Ga0157376_10287066 3300014969 Bacteria 1552
169 Ga0157376_11828628 3300014969 Bacteria 644
170 Ga0206356_10420244 3300020070 Bacteria 1370
171 Ga0154015_1415152 3300020610 Unclassified 698
172 Ga0224712_10061337 3300022467 Bacteria 1499
173 Ga0207656_10001048 3300025321 Bacteria 9048
174 Ga0207656_10001578 3300025321 Bacteria 7582
175 Ga0207642_10026043 3300025899 Bacteria 2375
176 Ga0207710_10044071 3300025900 Bacteria 1986
177 Ga0207688_10006351 3300025901 Bacteria 6434
178 Ga0207685_10584550 3300025905 Bacteria 597
179 Ga0207643_10049268 3300025908 Bacteria 2387
180 Ga0207705_10014343 3300025909 Bacteria 5703
181 Ga0207705_10017125 3300025909 Bacteria 5192
182 Ga0207654_10018225 3300025911 Bacteria 3680
183 Ga0207663_10279062 3300025916 Bacteria 1240
184 Ga0207663_10358779 3300025916 Bacteria 1105
185 Ga0207662_10275467 3300025918 Bacteria 1112
186 Ga0207662_11148431 3300025918 Unclassified 552
187 Ga0207657_10006521 3300025919 Bacteria 12089
188 Ga0207649_10195171 3300025920 Bacteria 1426
189 Ga0207694_10086821 3300025924 Bacteria 2464
190 Ga0207659_10084754 3300025926 Bacteria 2352
191 Ga0207687_10002690 3300025927 Bacteria 12023
192 Ga0207687_10104465 3300025927 Bacteria 2091
193 Ga0207687_10104611 3300025927 Bacteria 2090
194 Ga0207687_11242500 3300025927 Bacteria 640
195 Ga0207700_10192684 3300025928 Bacteria 1714
196 Ga0207664_10095738 3300025929 Bacteria 2443
197 Ga0207690_10012718 3300025932 Bacteria 5044
198 Ga0207690_10057954 3300025932 Bacteria 2618
199 Ga0207706_10010003 3300025933 Bacteria 8692
200 Ga0207709_10244769 3300025935 Bacteria 1306
201 Ga0207709_10250576 3300025935 Bacteria 1293
202 Ga0207670_10065719 3300025936 Bacteria 2490
203 Ga0207670_10253740 3300025936 Bacteria 1360
204 Ga0207669_10004557 3300025937 Bacteria 6112
205 Ga0207669_10815999 3300025937 Bacteria 774
206 Ga0207704_10000308 3300025938 Bacteria 22892
207 Ga0207704_10032037 3300025938 Bacteria 2969
208 Ga0207704_10253947 3300025938 Bacteria 1322
209 Ga0207704_11338986 3300025938 Bacteria 613
210 Ga0207691_10000430 3300025940 Bacteria 41789
211 Ga0207691_10007355 3300025940 Bacteria 10616
212 Ga0207711_10000011 3300025941 Bacteria 518817
213 Ga0207711_10827468 3300025941 Bacteria 862
214 Ga0207689_10034455 3300025942 Bacteria 4206
215 Ga0207661_10164364 3300025944 Bacteria 1927
216 Ga0207679_10109596 3300025945 Bacteria 2176
217 Ga0207679_11301954 3300025945 Bacteria 667
218 Ga0207651_10009198 3300025960 Bacteria 5389
219 Ga0207712_10174013 3300025961 Bacteria 1685
220 Ga0207712_11836349 3300025961 Unclassified 543
221 Ga0207668_10076502 3300025972 Bacteria 2410
222 Ga0207640_10000821 3300025981 Bacteria 17670
223 Ga0207640_10195794 3300025981 Bacteria 1527
224 Ga0207658_10482059 3300025986 Bacteria 1102
225 Ga0207677_10089682 3300026023 Bacteria 2233
226 Ga0207677_10890630 3300026023 Bacteria 802
227 Ga0207703_10255088 3300026035 Bacteria 1583
228 Ga0207639_10024085 3300026041 Bacteria 4401
229 Ga0207639_10030133 3300026041 Bacteria 3977
230 Ga0207678_10013734 3300026067 Bacteria 7113
231 Ga0207708_10020783 3300026075 Bacteria 4952
232 Ga0207702_10055370 3300026078 Bacteria 3363
233 Ga0207702_10645948 3300026078 Bacteria 1040
234 Ga0207648_10013324 3300026089 Bacteria 7656
235 Ga0207676_10203711 3300026095 Bacteria 1750
236 Ga0207683_10123809 3300026121 Bacteria 2322
237 Ga0207683_10564436 3300026121 Bacteria 1053
238 Ga0207683_10764217 3300026121 Unclassified 897
239 Ga0207698_10000014 3300026142 Bacteria 240703
240 Ga0207698_10033531 3300026142 Bacteria 3732
241 Ga0209813_10248838 3300027866 Bacteria 675
242 Ga0209974_10444699 3300027876 Bacteria 514
243 Ga0268266_10923732 3300028379 Bacteria 844
244 Ga0268265_10064910 3300028380 Bacteria 2815
245 Ga0268264_10495479 3300028381 Bacteria 1191
246 Ga0307408_100268035 3300031548 Bacteria 1416
247 Ga0316578_10071340 3300031728 Bacteria 2057
248 Ga0307413_11576919 3300031824 Bacteria 582
249 Ga0307410_10022163 3300031852 Bacteria 3920
250 Ga0307406_10191787 3300031901 Bacteria 1496
251 Ga0307412_10256374 3300031911 Bacteria 1361
252 Ga0307409_100025652 3300031995 Bacteria 4139
253 Ga0307409_101276460 3300031995 Bacteria 759
254 Ga0307416_101200078 3300032002 Bacteria 864
255 Ga0307416_102347015 3300032002 Unclassified 633
256 Ga0307411_10242177 3300032005 Bacteria 1413
257 Ga0307411_10795204 3300032005 Bacteria 832
258 Ga0307415_100278238 3300032126 Bacteria 1375
259 Ga0307415_100344836 3300032126 Bacteria 1251
260 Ga0307415_101494810 3300032126 Unclassified 646
261 Ga0316584_0522912 3300036712 Bacteria 831
262 Ga0316584_0865306 3300036712 Bacteria 610
263 Ga0395900_1787437 3300037418 Unclassified 525
264 Ga0395898_0335481 3300037466 Bacteria 1442
265 Ga0395905_1150971 3300037471 Bacteria 679
266 Ga0395901_1056627 3300038443 Bacteria 785
267 Ga0451845_0155321 3300041501 Bacteria 566
268 Ga0451855_1461436 3300041511 Unclassified 553
269 Ga0439460_0082564 3300042461 Unclassified 1011
270 Ga0450918_070633 3300042531 Unclassified 655
271 Ga0466957_0004792 3300044842 Bacteria 7572
272 Ga0466958_0014240 3300045836 Bacteria 4541
273 Ga0466967_0000003 3300045976 Bacteria 169144
274 Ga0495603_0371022 3300046455 Bacteria 821
275 Ga0495591_097056 3300046458 Bacteria 734
276 Ga0495629_0000543 3300046459 Bacteria 31107
277 Ga0495641_0014568 3300046461 Bacteria 4248
278 Ga0495662_0004441 3300046476 Bacteria 7042
279 Ga0495584_0668197 3300046491 Unclassified 530
280 Ga0495607_0242905 3300046501 Bacteria 870
281 Ga0495607_0385833 3300046501 Bacteria 640
282 Ga0495606_0000283 3300046507 Bacteria 88309
283 Ga0495608_0000010 3300046511 Bacteria 258660
284 Ga0495616_0340042 3300046513 Bacteria 627
285 Ga0495628_0139730 3300046516 Bacteria 1849
286 Ga0495630_0000148 3300046517 Bacteria 54619
287 Ga0495654_0277628 3300046530 Bacteria 690
288 Ga0495598_0413338 3300046537 Unclassified 529
289 Ga0495609_0393510 3300046538 Bacteria 555
290 Ga0495633_0492716 3300046558 Bacteria 553
291 Ga0495657_0000005 3300046675 Bacteria 254860
292 Ga0495647_0000114 3300046681 Bacteria 20349
293 Ga0495613_0000087 3300046689 Bacteria 88644
294 Ga0495624_0000429 3300046690 Bacteria 33305
295 Ga0495670_0083149 3300046691 Bacteria 1633
296 Ga0495670_0204597 3300046691 Bacteria 1046
297 Ga0495600_0019425 3300046809 Bacteria 4339
298 Ga0495604_0078464 3300047317 Bacteria 2478
299 Ga0495672_0064599 3300047320 Bacteria 2095
300 Ga0495676_0507331 3300047321 Bacteria 791
301 Ga0495675_0000398 3300047444 Bacteria 30075
302 Ga0495602_0000038 3300048088 Bacteria 130758
303 Ga0496101_0476195 3300048904 Bacteria 986
304 Ga0496101_1555374 3300048904 Bacteria 514
305 Ga0496102_0116265 3300048905 Bacteria 2496
306 Ga0496102_0385145 3300048905 Bacteria 1319
307 Ga0496102_0834968 3300048905 Unclassified 844
308 Ga0496103_0106099 3300048906 Bacteria 1782
309 Ga0496104_0037414 3300048907 Bacteria 4539
310 Ga0496104_0787422 3300048907 Bacteria 857
311 Ga0496105_0336757 3300048908 Bacteria 1207
312 Ga0496106_0007743 3300048909 Bacteria 7950
313 Ga0496106_0502246 3300048909 Bacteria 974
314 Ga0496107_0122066 3300048910 Bacteria 1919
315 Ga0496107_0135884 3300048910 Bacteria 1816
316 Ga0496108_0111271 3300048911 Bacteria 2342
317 Ga0496108_0176708 3300048911 Bacteria 1848
318 Ga0496109_0001077 3300048912 Bacteria 22663
319 Ga0496109_0119801 3300048912 Bacteria 2451
320 Ga0496109_1314572 3300048912 Unclassified 659
321 Ga0496110_0000325 3300048913 Bacteria 31707
322 Ga0496110_0018233 3300048913 Bacteria 5882
323 Ga0496110_0022729 3300048913 Bacteria 5328
324 Ga0496110_0041415 3300048913 Bacteria 4019
325 Ga0496110_1171983 3300048913 Bacteria 677
326 Ga0496111_0000171 3300048914 Bacteria 29367
327 Ga0496111_0062842 3300048914 Bacteria 2692
328 Ga0496111_0106252 3300048914 Bacteria 2066
329 Ga0496111_0271350 3300048914 Bacteria 1258
330 Ga0496112_0034473 3300048915 Bacteria 4926
331 Ga0496112_0339284 3300048915 Bacteria 1446
332 Ga0496112_1042174 3300048915 Bacteria 737
333 Ga0496113_0000002 3300048916 Bacteria 220193
334 Ga0496113_0016658 3300048916 Bacteria 5081
335 Ga0496124_0627090 3300048927 Bacteria 694
336 Ga0501032_0649581 3300049569 Bacteria 670
337 Ga0501036_0138257 3300049572 Bacteria 2056
338 Ga0501036_0288534 3300049572 Bacteria 1373
339 Ga0501039_0227515 3300049575 Bacteria 1466
340 Ga0501040_0103523 3300049576 Bacteria 1987
341 Ga0501040_1106271 3300049576 Bacteria 575
342 Ga0501041_0882312 3300049577 Unclassified 574
343 Ga0501042_0465744 3300049578 Bacteria 917
344 Ga0501042_0712246 3300049578 Bacteria 730
345 Ga0501042_1217199 3300049578 Unclassified 549
346 Ga0501043_0245301 3300049579 Unclassified 1381
347 Ga0501046_0196179 3300049580 Bacteria 1504
348 Ga0501048_0169109 3300049582 Bacteria 1548
349 Ga0501067_0671342 3300049583 Bacteria 582
350 Ga0501068_0572329 3300049584 Bacteria 735
351 Ga0501068_0859893 3300049584 Bacteria 596
352 Ga0501069_0623124 3300049585 Bacteria 648
353 Ga0501071_0087536 3300049587 Bacteria 2285
354 Ga0501071_0102488 3300049587 Bacteria 2111
355 Ga0501071_0690824 3300049587 Bacteria 786
356 Ga0501071_1095709 3300049587 Bacteria 615
357 Ga0501072_0126046 3300049588 Bacteria 2040
358 Ga0501072_0376538 3300049588 Bacteria 1126
359 Ga0501075_0181842 3300049591 Bacteria 1604
360 Ga0501075_0575805 3300049591 Bacteria 859
361 Ga0501076_0157012 3300049592 Bacteria 1852
362 Ga0501076_0272603 3300049592 Bacteria 1386
363 Ga0501077_1121977 3300049593 Bacteria 506
364 Ga0501079_0193382 3300049741 Bacteria 1588
365 Ga0501079_0394392 3300049741 Bacteria 1085
366 Ga0501079_0642808 3300049741 Bacteria 835
367 Ga0501079_1444612 3300049741 Bacteria 541
368 Ga0501080_0711073 3300049742 Bacteria 886
369 Ga0501081_0051649 3300049743 Bacteria 2835
370 Ga0501081_0401364 3300049743 Bacteria 1015
371 Ga0501081_0442327 3300049743 Bacteria 965
372 Ga0501045_0049368 3300049824 Bacteria 3068
373 Ga0501045_0379206 3300049824 Bacteria 1053
374 Ga0501045_0796105 3300049824 Bacteria 696
375 nmdc:mga03n38_111762_c1 3300050490 Bacteria 1331
376 nmdc:mga03n38_122171_c1 3300050490 Bacteria 1281
377 nmdc:mga03n38_2180_c1 3300050490 Bacteria 5971
378 nmdc:mga03n38_338678_c1 3300050490 Bacteria 816
379 nmdc:mga03n38_342024_c1 3300050490 Bacteria 812
380 nmdc:mga03n38_48404_c2 3300050490 Bacteria 1623
381 nmdc:mga03n38_725423_c1 3300050490 Bacteria 574
382 nmdc:mga03n38_870867_c1 3300050490 Bacteria 528
383 nmdc:mga03n38_952359_c1 3300050490 Bacteria 507
384 nmdc:mga00v17_250329_c1 3300050491 Bacteria 1149
385 nmdc:mga00v17_43750_c1 3300050491 Bacteria 2698
386 nmdc:mga00v17_633189_c1 3300050491 Bacteria 688
387 nmdc:mga00v17_670752_c1 3300050491 Bacteria 666
388 nmdc:mga00v17_808692_c1 3300050491 Bacteria 597
389 nmdc:mga00v17_833624_c1 3300050491 Bacteria 586
390 nmdc:mga0yw44_1048753_c1 3300050492 Bacteria 551
391 nmdc:mga0yw44_439597_c1 3300050492 Bacteria 884
392 nmdc:mga0yw44_48664_c1 3300050492 Bacteria 2556
393 nmdc:mga0yw44_491882_c1 3300050492 Bacteria 832
394 nmdc:mga0yw44_494514_c1 3300050492 Bacteria 830
395 nmdc:mga0yw44_63138_c1 3300050492 Bacteria 2277
396 nmdc:mga06z11_220808_c1 3300050494 Bacteria 1107
397 nmdc:mga06z11_535960_c1 3300050494 Bacteria 710
398 nmdc:mga06z11_885834_c1 3300050494 Bacteria 544
399 nmdc:mga04h51_279853_c1 3300050495 Bacteria 675
400 nmdc:mga05p37_494983_c1 3300050507 Bacteria 1405
401 nmdc:mga08y16_67946_c1 3300050511 Bacteria 3717
402 nmdc:mga0n895_8394_c1 3300050512 Bacteria 8944
403 nmdc:mga0a205_215564_c1 3300050515 Bacteria 1807
404 Ga0495601_0000698 3300053077 Bacteria 18035
405 Ga0495601_0210563 3300053077 Bacteria 1270
406 Ga0495655_0000120 3300053083 Bacteria 14477
407 Ga0495655_0126519 3300053083 Bacteria 783
408 Ga0495595_0000005 3300053084 Bacteria 258660
409 Ga0495595_0042997 3300053084 Bacteria 2071
410 Ga0495619_0000069 3300053085 Bacteria 82755
411 Ga0495619_0000489 3300053085 Bacteria 26595
412 Ga0501084_0242867 3300054114 Bacteria 1520
413 Ga0501084_0480546 3300054114 Bacteria 1050
414 Ga0501082_0445333 3300060353 Bacteria 1131
415 Ga0501082_0553899 3300060353 Bacteria 1006
416 Ga0530510_0099704 3300061734 Bacteria 2124
417 Ga0316579_10145963
418 JGI24743J22301_10049777
419 JGI24748J21848_1060488
420 JGI24033J26618_1069642
421 JGI25407J50210_10061682
422 Ga0070658_10007473
423 Ga0070683_100602452
424 Ga0070683_101717856
425 Ga0070670_100075753
426 Ga0070670_100202521
427 Ga0068869_100207004
428 Ga0070666_10457852
429 Ga0070682_100000032
430 Ga0070682_100004160
431 Ga0068868_100127815
432 Ga0070660_100004072
433 Ga0070689_100086877
434 Ga0070689_100091070
435 Ga0070691_10004069
436 Ga0070687_100220741
437 Ga0070661_100076927
438 Ga0070692_10020721
439 Ga0070692_10022554
440 Ga0070668_100034700
441 Ga0070675_100015253
442 Ga0070674_100002494
443 Ga0070674_100904281
444 Ga0070673_100123455
445 Ga0070688_100796624
446 Ga0070659_100000983
447 Ga0070659_100020922
448 Ga0070667_100503843
449 Ga0070667_101299323
450 Ga0070714_100048906
451 Ga0070713_100284149
452 Ga0070701_10103034
453 Ga0070711_100091961
454 Ga0070711_100222285
455 Ga0070705_100424217
456 Ga0070705_101546387
457 Ga0070700_100036039
458 Ga0070694_101914297
459 Ga0070663_100005936
460 Ga0070678_100054484
461 Ga0070678_100377259
462 Ga0070662_100012555
463 Ga0068867_100478226
464 Ga0068867_100532094
465 Ga0070685_10027085
466 Ga0070685_10033076
467 Ga0070679_101992832
468 Ga0070684_101640755
469 Ga0068853_100044541
470 Ga0068853_100181868
471 Ga0070672_100000104
472 Ga0070672_101041468
473 Ga0070686_100022071
474 Ga0070686_100172067
475 Ga0070686_101138794
476 Ga0070695_100850584
477 Ga0070693_100581531
478 Ga0070665_100370697
479 Ga0070704_100904207
480 Ga0070704_101015257
481 Ga0070704_101438352
482 Ga0068855_101355048
483 Ga0070664_100020446
484 Ga0070664_101473019
485 Ga0068854_100000939
486 Ga0068854_100005645
487 Ga0068856_100526842
488 Ga0068856_100995515
489 Ga0070702_100905614
490 Ga0070702_101461069
491 Ga0068852_100000024
492 Ga0068852_100008410
493 Ga0068859_100462946
494 Ga0068864_100273073
495 Ga0068866_10012947
496 Ga0068861_102489983
497 Ga0068851_10007702
498 Ga0068851_10017683
499 Ga0068851_10863862
500 Ga0068870_10051897
501 Ga0068858_100317766
502 Ga0068860_100598347
503 Ga0068862_100085173
504 Ga0081455_10025075
505 Ga0081455_10128075
506 Ga0081455_10364500
507 Ga0081455_10721225
508 Ga0081538_10000208
509 Ga0081538_10000396
510 Ga0081538_10061642
511 Ga0081538_10075218
512 Ga0081538_10094957
513 Ga0081540_1000553
514 Ga0075365_10007392
515 Ga0075365_10310900
516 Ga0075365_11064421
517 Ga0075365_11291889
518 Ga0075368_10337157
519 Ga0075363_100013047
520 Ga0075363_100018702
521 Ga0075363_100035304
522 Ga0075363_100149071
523 Ga0075363_100366822
524 Ga0075363_100825457
525 Ga0075364_10096181
526 Ga0075364_10443811
527 Ga0075364_10632867
528 Ga0075364_11224849
529 Ga0075364_11257012
530 Ga0070715_10172356
531 Ga0075362_10127190
532 Ga0075367_10206250
533 Ga0068871_101296254
534 Ga0075428_102527428
535 Ga0075433_10334200
536 Ga0075434_100024374
537 Ga0068865_100000024
538 Ga0068865_100011914
539 Ga0068865_101863288
540 Ga0075436_100878436
541 Ga0097620_100462987
542 Ga0075435_100616189
543 Ga0105240_12378100
544 Ga0111539_10399726
545 Ga0105245_10003202
546 Ga0105245_10019614
547 Ga0105245_11958631
548 Ga0105247_10085343
549 Ga0114129_10095204
550 Ga0105243_10009298
551 Ga0105243_10546301
552 Ga0105241_10098691
553 Ga0105242_13018385
554 Ga0105248_10001735
555 Ga0105248_10512033
556 Ga0105237_10059780
557 Ga0105237_12728280
558 Ga0105238_10563122
559 Ga0105249_10044378
560 Ga0105249_10867275
561 Ga0105249_11383662
562 Ga0105239_10304962
563 Ga0105239_10866508
564 Ga0105239_11052857
565 Ga0105239_11411552
566 Ga0105246_10045269
567 Ga0105246_10700585
568 Ga0157342_1023544
569 Ga0157371_10017630
570 Ga0157370_10090235
571 Ga0157370_10258752
572 Ga0157374_10735385
573 Ga0157378_10026190
574 Ga0157378_10027572
575 Ga0163162_10161376
576 Ga0157372_10000809
577 Ga0157372_10295530
578 Ga0157375_10062797
579 Ga0163163_10744832
580 Ga0157380_10000326
581 Ga0157380_10010840
582 Ga0157380_10471564
583 Ga0157377_10676725
584 Ga0157376_10287066
585 Ga0157376_11828628
586 Ga0206356_10420244
587 Ga0154015_1415152
588 Ga0224712_10061337
589 Ga0207656_10001048
590 Ga0207656_10001578
591 Ga0207642_10026043
592 Ga0207710_10044071
593 Ga0207688_10006351
594 Ga0207685_10584550
595 Ga0207643_10049268
596 Ga0207705_10014343
597 Ga0207705_10017125
598 Ga0207654_10018225
599 Ga0207663_10279062
600 Ga0207663_10358779
601 Ga0207662_10275467
602 Ga0207662_11148431
603 Ga0207657_10006521
604 Ga0207649_10195171
605 Ga0207694_10086821
606 Ga0207659_10084754
607 Ga0207687_10002690
608 Ga0207687_10104465
609 Ga0207687_10104611
610 Ga0207687_11242500
611 Ga0207700_10192684
612 Ga0207664_10095738
613 Ga0207690_10012718
614 Ga0207690_10057954
615 Ga0207706_10010003
616 Ga0207709_10244769
617 Ga0207709_10250576
618 Ga0207670_10065719
619 Ga0207670_10253740
620 Ga0207669_10004557
621 Ga0207669_10815999
622 Ga0207704_10000308
623 Ga0207704_10032037
624 Ga0207704_10253947
625 Ga0207704_11338986
626 Ga0207691_10000430
627 Ga0207691_10007355
628 Ga0207711_10000011
629 Ga0207711_10827468
630 Ga0207689_10034455
631 Ga0207661_10164364
632 Ga0207679_10109596
633 Ga0207679_11301954
634 Ga0207651_10009198
635 Ga0207712_10174013
636 Ga0207712_11836349
637 Ga0207668_10076502
638 Ga0207640_10000821
639 Ga0207640_10195794
640 Ga0207658_10482059
641 Ga0207677_10089682
642 Ga0207677_10890630
643 Ga0207703_10255088
644 Ga0207639_10024085
645 Ga0207639_10030133
646 Ga0207678_10013734
647 Ga0207708_10020783
648 Ga0207702_10055370
649 Ga0207702_10645948
650 Ga0207648_10013324
651 Ga0207676_10203711
652 Ga0207683_10123809
653 Ga0207683_10564436
654 Ga0207683_10764217
655 Ga0207698_10000014
656 Ga0207698_10033531
657 Ga0209813_10248838
658 Ga0209974_10444699
659 Ga0268266_10923732
660 Ga0268265_10064910
661 Ga0268264_10495479
662 Ga0307408_100268035
663 Ga0316578_10071340
664 Ga0307413_11576919
665 Ga0307410_10022163
666 Ga0307406_10191787
667 Ga0307412_10256374
668 Ga0307409_100025652
669 Ga0307409_101276460
670 Ga0307416_101200078
671 Ga0307416_102347015
672 Ga0307411_10242177
673 Ga0307411_10795204
674 Ga0307415_100278238
675 Ga0307415_100344836
676 Ga0307415_101494810
677 Ga0316584_0522912
678 Ga0316584_0865306
679 Ga0395900_1787437
680 Ga0395898_0335481
681 Ga0395905_1150971
682 Ga0395901_1056627
683 Ga0451845_0155321
684 Ga0451855_1461436
685 Ga0439460_0082564
686 Ga0450918_070633
687 Ga0466957_0004792
688 Ga0466958_0014240
689 Ga0466967_0000003
690 Ga0495603_0371022
691 Ga0495591_097056
692 Ga0495629_0000543
693 Ga0495641_0014568
694 Ga0495662_0004441
695 Ga0495584_0668197
696 Ga0495607_0242905
697 Ga0495607_0385833
698 Ga0495606_0000283
699 Ga0495608_0000010
700 Ga0495616_0340042
701 Ga0495628_0139730
702 Ga0495630_0000148
703 Ga0495654_0277628
704 Ga0495598_0413338
705 Ga0495609_0393510
706 Ga0495633_0492716
707 Ga0495657_0000005
708 Ga0495647_0000114
709 Ga0495613_0000087
710 Ga0495624_0000429
711 Ga0495670_0083149
712 Ga0495670_0204597
713 Ga0495600_0019425
714 Ga0495604_0078464
715 Ga0495672_0064599
716 Ga0495676_0507331
717 Ga0495675_0000398
718 Ga0495602_0000038
719 Ga0496101_0476195
720 Ga0496101_1555374
721 Ga0496102_0116265
722 Ga0496102_0385145
723 Ga0496102_0834968
724 Ga0496103_0106099
725 Ga0496104_0037414
726 Ga0496104_0787422
727 Ga0496105_0336757
728 Ga0496106_0007743
729 Ga0496106_0502246
730 Ga0496107_0122066
731 Ga0496107_0135884
732 Ga0496108_0111271
733 Ga0496108_0176708
734 Ga0496109_0001077
735 Ga0496109_0119801
736 Ga0496109_1314572
737 Ga0496110_0000325
738 Ga0496110_0018233
739 Ga0496110_0022729
740 Ga0496110_0041415
741 Ga0496110_1171983
742 Ga0496111_0000171
743 Ga0496111_0062842
744 Ga0496111_0106252
745 Ga0496111_0271350
746 Ga0496112_0034473
747 Ga0496112_0339284
748 Ga0496112_1042174
749 Ga0496113_0000002
750 Ga0496113_0016658
751 Ga0496124_0627090
752 Ga0501032_0649581
753 Ga0501036_0138257
754 Ga0501036_0288534
755 Ga0501039_0227515
756 Ga0501040_0103523
757 Ga0501040_1106271
758 Ga0501041_0882312
759 Ga0501042_0465744
760 Ga0501042_0712246
761 Ga0501042_1217199
762 Ga0501043_0245301
763 Ga0501046_0196179
764 Ga0501048_0169109
765 Ga0501067_0671342
766 Ga0501068_0572329
767 Ga0501068_0859893
768 Ga0501069_0623124
769 Ga0501071_0087536
770 Ga0501071_0102488
771 Ga0501071_0690824
772 Ga0501071_1095709
773 Ga0501072_0126046
774 Ga0501072_0376538
775 Ga0501075_0181842
776 Ga0501075_0575805
777 Ga0501076_0157012
778 Ga0501076_0272603
779 Ga0501077_1121977
780 Ga0501079_0193382
781 Ga0501079_0394392
782 Ga0501079_0642808
783 Ga0501079_1444612
784 Ga0501080_0711073
785 Ga0501081_0051649
786 Ga0501081_0401364
787 Ga0501081_0442327
788 Ga0501045_0049368
789 Ga0501045_0379206
790 Ga0501045_0796105
791 nmdc:mga03n38_111762_c1
792 nmdc:mga03n38_122171_c1
793 nmdc:mga03n38_2180_c1
794 nmdc:mga03n38_338678_c1
795 nmdc:mga03n38_342024_c1
796 nmdc:mga03n38_48404_c2
797 nmdc:mga03n38_725423_c1
798 nmdc:mga03n38_870867_c1
799 nmdc:mga03n38_952359_c1
800 nmdc:mga00v17_250329_c1
801 nmdc:mga00v17_43750_c1
802 nmdc:mga00v17_633189_c1
803 nmdc:mga00v17_670752_c1
804 nmdc:mga00v17_808692_c1
805 nmdc:mga00v17_833624_c1
806 nmdc:mga0yw44_1048753_c1
807 nmdc:mga0yw44_439597_c1
808 nmdc:mga0yw44_48664_c1
809 nmdc:mga0yw44_491882_c1
810 nmdc:mga0yw44_494514_c1
811 nmdc:mga0yw44_63138_c1
812 nmdc:mga06z11_220808_c1
813 nmdc:mga06z11_535960_c1
814 nmdc:mga06z11_885834_c1
815 nmdc:mga04h51_279853_c1
816 nmdc:mga05p37_494983_c1
817 nmdc:mga08y16_67946_c1
818 nmdc:mga0n895_8394_c1
819 nmdc:mga0a205_215564_c1
820 Ga0495601_0000698
821 Ga0495601_0210563
822 Ga0495655_0000120
823 Ga0495655_0126519
824 Ga0495595_0000005
825 Ga0495595_0042997
826 Ga0495619_0000069
827 Ga0495619_0000489
828 Ga0501084_0242867
829 Ga0501084_0480546
830 Ga0501082_0445333
831 Ga0501082_0553899
832 Ga0530510_0099704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

4

54

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fxc-assembly1.cif.gz_AX the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus 0.9871 2 57
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9846 4 57
6wdf-assembly1.cif.gz_z cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure vi-a) 0.9824 3 57
8fn2-assembly1.cif.gz_b the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9819 2 59
6ddd-assembly1.cif.gz_M structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-5 0.9789 4 57
ID Description Score Start End Superfamily
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9837 3 59 3.30.1390.20
af_Q54GH8_53_110_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9813 4 57 3.30.1390.20
6dddM00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9789 4 57 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9786 2 57 3.30.1390.20
4tomZ00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9771 3 57 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A838V3G0-F1-model_v4 Large ribosomal subunit protein uL30 1.007 1 57 GO:0003735
GO:0006412
GO:0022625
AF-A0A2G9SML1-F1-model_v4 Large ribosomal subunit protein uL30 1.004 2 57 GO:0003735
GO:0006412
GO:0022625
AF-A0A316LQW5-F1-model_v4 Large ribosomal subunit protein uL30 1.004 2 57 GO:0003735
GO:0006412
GO:0015934
AF-B3EGX2-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 1.003 2 57 GO:0003735
GO:0006412
GO:0022625
AF-A0A350IKY4-F1-model_v4 Large ribosomal subunit protein uL30 1.003 1 57 GO:0003735
GO:0006412
GO:0022625

Map