F438845

General Info

Members Datasets Scaffolds Average Seq Length
416 280 412 284

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0081234|Ga0373934_0081234_221_1174
Length 317
Sequence MAGEANHARTVLKSAHACAGMRPEIRDAQPAGEDMTASPSERSSPWGANVLVEFEDGIAWVSLNRPDKRNAMNPPLTQEMLDTIDALETDERCGVLVLTGAGEAFSAGMDLKEYFRANQDKSAIEWARIKRVNANWQWRRLMYYPKPTIAMVNGWCFGGAFTPLVACDLAIAAEEATFGLSEINWGIIPGGVVTRAIAEKMNQADALYYIMTGETFDGKKAAQSGLVNLAVPLADLRARTRALAQTLLKKNPTVLRAAKLAYRHVKHMDWEMADDYLAAKSVEANATDPERGRQQGMSQFLDEKTYRPGLETYRRDK

Samples

Sample ID Description Type Environment
1 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
2 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
3 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
4 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.24
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.97
Nodule 0
Rhizoplane 6.97
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1015261 3300001976 Bacteria 1001
2 JGI24740J21852_10001365 3300001979 Bacteria 11128
3 JGI24744J21845_10027447 3300002077 Bacteria 1100
4 rootH1_10031852 3300003323 Bacteria 5003
5 Ga0055525_1000096 3300003759 Bacteria 137836
6 Ga0070658_10005318 3300005327 Bacteria 10451
7 Ga0070683_100069223 3300005329 Bacteria 3290
8 Ga0070670_100003054 3300005331 Bacteria 13849
9 Ga0070670_100486558 3300005331 Bacteria 1096
10 Ga0068869_100034583 3300005334 Bacteria 3575
11 Ga0070666_10064166 3300005335 Bacteria 2491
12 Ga0070680_100005900 3300005336 Bacteria 9302
13 Ga0070680_100011870 3300005336 Bacteria 6757
14 Ga0070680_100030843 3300005336 Bacteria 4307
15 Ga0070680_100184595 3300005336 Bacteria 1757
16 Ga0068868_100010658 3300005338 Bacteria 6662
17 Ga0068868_100174817 3300005338 Bacteria 1779
18 Ga0070660_100125758 3300005339 Bacteria 2048
19 Ga0070689_100076173 3300005340 Bacteria 2628
20 Ga0070671_100021251 3300005355 Bacteria 5301
21 Ga0070671_100185041 3300005355 Bacteria 1764
22 Ga0070674_100199677 3300005356 Bacteria 1543
23 Ga0070673_100043980 3300005364 Bacteria 3455
24 Ga0070659_100024476 3300005366 Bacteria 4628
25 Ga0070667_100128178 3300005367 Bacteria 2213
26 Ga0070713_100073211 3300005436 Bacteria 2900
27 Ga0070713_100582215 3300005436 Bacteria 1062
28 Ga0070710_10040868 3300005437 Bacteria 2557
29 Ga0070701_10006691 3300005438 Bacteria 4867
30 Ga0070705_100105562 3300005440 Bacteria 1789
31 Ga0070700_100028228 3300005441 Bacteria 3335
32 Ga0070694_100046522 3300005444 Bacteria 2913
33 Ga0070663_100082891 3300005455 Bacteria 2360
34 Ga0070662_100174971 3300005457 Bacteria 1688
35 Ga0070662_100392091 3300005457 Bacteria 1145
36 Ga0070681_10038893 3300005458 Bacteria 4769
37 Ga0070681_10041960 3300005458 Bacteria 4586
38 Ga0070681_10054007 3300005458 Bacteria 4003
39 Ga0068867_100191771 3300005459 Bacteria 1631
40 Ga0070679_100004524 3300005530 Bacteria 12853
41 Ga0070679_100015471 3300005530 Bacteria 7331
42 Ga0070679_100023192 3300005530 Bacteria 6073
43 Ga0070679_100048629 3300005530 Bacteria 4224
44 Ga0070684_100059263 3300005535 Bacteria 3346
45 Ga0070684_100565527 3300005535 Bacteria 1056
46 Ga0068853_100171380 3300005539 Bacteria 1964
47 Ga0070686_100007811 3300005544 Bacteria 5978
48 Ga0070695_100166877 3300005545 Bacteria 1550
49 Ga0070696_100162814 3300005546 Bacteria 1645
50 Ga0070665_100000467 3300005548 Bacteria 58613
51 Ga0070665_100017205 3300005548 Bacteria 7254
52 Ga0070665_100149164 3300005548 Bacteria 2341
53 Ga0068855_100060597 3300005563 Bacteria 4425
54 Ga0068855_100389419 3300005563 Bacteria 1529
55 Ga0070664_100015863 3300005564 Bacteria 6167
56 Ga0070664_100108224 3300005564 Bacteria 2424
57 Ga0068857_100069730 3300005577 Bacteria 3131
58 Ga0068856_100008146 3300005614 Bacteria 10223
59 Ga0068856_100111241 3300005614 Bacteria 2736
60 Ga0068856_100112950 3300005614 Bacteria 2715
61 Ga0068856_100660468 3300005614 Bacteria 1066
62 Ga0070702_100003175 3300005615 Bacteria 7289
63 Ga0070702_100006977 3300005615 Bacteria 5381
64 Ga0068852_100619620 3300005616 Bacteria 1088
65 Ga0068859_100026824 3300005617 Bacteria 5779
66 Ga0068864_100351694 3300005618 Bacteria 1390
67 Ga0068866_10001735 3300005718 Bacteria 9160
68 Ga0068861_100030305 3300005719 Bacteria 3963
69 Ga0068870_10028225 3300005840 Bacteria 2815
70 Ga0068863_100001030 3300005841 Bacteria 27842
71 Ga0068863_100006541 3300005841 Bacteria 11434
72 Ga0068858_100053332 3300005842 Bacteria 3741
73 Ga0068858_100126952 3300005842 Bacteria 2389
74 Ga0068860_100000554 3300005843 Bacteria 45461
75 Ga0068860_100027815 3300005843 Bacteria 5445
76 Ga0068860_100065130 3300005843 Bacteria 3461
77 Ga0068860_100234477 3300005843 Bacteria 1784
78 Ga0068862_100082825 3300005844 Bacteria 2785
79 Ga0068862_100166016 3300005844 Bacteria 1973
80 Ga0081455_10127477 3300005937 Bacteria 1995
81 Ga0075368_10007809 3300006042 Bacteria 3790
82 Ga0075363_100051757 3300006048 Bacteria 2191
83 Ga0070715_10021995 3300006163 Bacteria 2481
84 Ga0075362_10066549 3300006177 Bacteria 1638
85 Ga0075367_10004453 3300006178 Bacteria 6843
86 Ga0075367_10059636 3300006178 Bacteria 2273
87 Ga0075367_10120130 3300006178 Bacteria 1619
88 Ga0075369_10147492 3300006186 Bacteria 1074
89 Ga0075366_10123692 3300006195 Bacteria 1559
90 Ga0097621_100028213 3300006237 Bacteria 4423
91 Ga0097621_100187351 3300006237 Bacteria 1790
92 Ga0075370_10162986 3300006353 Bacteria 1309
93 Ga0068871_100011730 3300006358 Bacteria 6436
94 Ga0068871_100025476 3300006358 Bacteria 4603
95 Ga0068871_100282598 3300006358 Bacteria 1452
96 Ga0075430_100135200 3300006846 Bacteria 2054
97 Ga0075431_100289306 3300006847 Bacteria 1658
98 Ga0075433_10052204 3300006852 Bacteria 3562
99 Ga0075434_100312453 3300006871 Bacteria 1592
100 Ga0075429_100197874 3300006880 Bacteria 1760
101 Ga0068865_100018779 3300006881 Bacteria 4467
102 Ga0097620_100026824 3300006931 Bacteria 5779
103 Ga0099795_10000141 3300007788 Bacteria 11961
104 Ga0105240_10124691 3300009093 Bacteria 3097
105 Ga0105240_10251731 3300009093 Bacteria 2042
106 Ga0105240_10302276 3300009093 Bacteria 1830
107 Ga0105240_10452925 3300009093 Bacteria 1436
108 Ga0105240_10478226 3300009093 Bacteria 1389
109 Ga0105240_10509390 3300009093 Bacteria 1337
110 Ga0105245_10027188 3300009098 Bacteria 5040
111 Ga0105247_10004678 3300009101 Bacteria 8719
112 Ga0105243_10000235 3300009148 Bacteria 63396
113 Ga0105241_10277792 3300009174 Bacteria 1429
114 Ga0105248_10077773 3300009177 Bacteria 3730
115 Ga0105248_10241406 3300009177 Bacteria 2034
116 Ga0105237_10004761 3300009545 Bacteria 15602
117 Ga0105237_10024037 3300009545 Bacteria 6234
118 Ga0105237_10139522 3300009545 Bacteria 2418
119 Ga0105238_10006142 3300009551 Bacteria 11924
120 Ga0105238_10087166 3300009551 Bacteria 3109
121 Ga0099796_10013428 3300010159 Bacteria 2339
122 Ga0099796_10016190 3300010159 Bacteria 2197
123 Ga0105239_10002028 3300010375 Bacteria 26278
124 Ga0105239_10163232 3300010375 Bacteria 2490
125 Ga0105239_10185810 3300010375 Bacteria 2326
126 Ga0105246_10003742 3300011119 Bacteria 9220
127 Ga0105246_10017902 3300011119 Bacteria 4509
128 Ga0157371_10029339 3300013102 Bacteria 3979
129 Ga0157370_10010037 3300013104 Bacteria 10018
130 Ga0157370_10013376 3300013104 Bacteria 8455
131 Ga0157370_10027981 3300013104 Bacteria 5551
132 Ga0157370_10043779 3300013104 Bacteria 4306
133 Ga0157370_10137732 3300013104 Bacteria 2274
134 Ga0157369_10002099 3300013105 Bacteria 24041
135 Ga0157369_10038846 3300013105 Bacteria 5204
136 Ga0157369_10676266 3300013105 Bacteria 1064
137 Ga0157374_10001205 3300013296 Bacteria 22126
138 Ga0157378_10092583 3300013297 Bacteria 2750
139 Ga0157378_10565670 3300013297 Bacteria 1144
140 Ga0163162_10028154 3300013306 Bacteria 5558
141 Ga0163162_10065002 3300013306 Bacteria 3694
142 Ga0157372_10315893 3300013307 Bacteria 1819
143 Ga0157375_10058597 3300013308 Bacteria 3811
144 Ga0157375_10080564 3300013308 Bacteria 3294
145 Ga0163163_10005227 3300014325 Bacteria 11193
146 Ga0157380_10189363 3300014326 Bacteria 1815
147 Ga0157377_10001312 3300014745 Bacteria 10640
148 Ga0157379_10311827 3300014968 Bacteria 1435
149 Ga0157379_10744218 3300014968 Bacteria 922
150 Ga0157376_10372497 3300014969 Bacteria 1373
151 Ga0157376_10422117 3300014969 Bacteria 1294
152 Ga0157376_10472045 3300014969 Bacteria 1228
153 Ga0206350_10381688 3300020080 Bacteria 1809
154 Ga0209563_100058 3300025230 Bacteria 302571
155 Ga0209758_1000001 3300025297 Bacteria 1981790
156 Ga0209758_1008717 3300025297 Bacteria 6484
157 Ga0207692_10037554 3300025898 Bacteria 2370
158 Ga0207710_10024442 3300025900 Bacteria 2602
159 Ga0207688_10040014 3300025901 Bacteria 2604
160 Ga0207680_10051365 3300025903 Bacteria 2465
161 Ga0207647_10110249 3300025904 Bacteria 1627
162 Ga0207685_10024039 3300025905 Bacteria 2083
163 Ga0207643_10001897 3300025908 Bacteria 11551
164 Ga0207705_10026395 3300025909 Bacteria 4142
165 Ga0207707_10014907 3300025912 Bacteria 6770
166 Ga0207707_10022489 3300025912 Bacteria 5512
167 Ga0207707_10033937 3300025912 Bacteria 4466
168 Ga0207707_10039338 3300025912 Bacteria 4134
169 Ga0207707_10119772 3300025912 Bacteria 2301
170 Ga0207695_10180548 3300025913 Bacteria 2031
171 Ga0207695_10200273 3300025913 Bacteria 1911
172 Ga0207695_10215098 3300025913 Bacteria 1831
173 Ga0207671_10011037 3300025914 Bacteria 7394
174 Ga0207660_10007426 3300025917 Bacteria 7092
175 Ga0207660_10010675 3300025917 Bacteria 5968
176 Ga0207660_10071830 3300025917 Bacteria 2519
177 Ga0207657_10015288 3300025919 Bacteria 7440
178 Ga0207652_10013362 3300025921 Bacteria 6648
179 Ga0207652_10048405 3300025921 Bacteria 3634
180 Ga0207694_10097889 3300025924 Bacteria 2322
181 Ga0207650_10025027 3300025925 Bacteria 4250
182 Ga0207650_10071660 3300025925 Bacteria 2607
183 Ga0207650_10502497 3300025925 Bacteria 1013
184 Ga0207659_10080505 3300025926 Bacteria 2406
185 Ga0207687_10042890 3300025927 Bacteria 3115
186 Ga0207644_10035474 3300025931 Bacteria 3495
187 Ga0207644_10136888 3300025931 Bacteria 1881
188 Ga0207706_10002448 3300025933 Bacteria 18124
189 Ga0207686_10092895 3300025934 Bacteria 1996
190 Ga0207709_10001102 3300025935 Bacteria 19822
191 Ga0207709_10035870 3300025935 Bacteria 2936
192 Ga0207670_10110483 3300025936 Bacteria 1980
193 Ga0207669_10012993 3300025937 Bacteria 4117
194 Ga0207704_10009447 3300025938 Bacteria 4706
195 Ga0207665_10382572 3300025939 Bacteria 1068
196 Ga0207691_10001718 3300025940 Bacteria 21571
197 Ga0207711_10019834 3300025941 Bacteria 5603
198 Ga0207711_10043608 3300025941 Bacteria 3827
199 Ga0207689_10006461 3300025942 Bacteria 10364
200 Ga0207661_10080644 3300025944 Bacteria 2686
201 Ga0207679_10018406 3300025945 Bacteria 4679
202 Ga0207679_10061606 3300025945 Bacteria 2793
203 Ga0207667_10078191 3300025949 Bacteria 3429
204 Ga0207658_10017058 3300025986 Bacteria 5000
205 Ga0207658_10020103 3300025986 Bacteria 4623
206 Ga0207677_10109409 3300026023 Bacteria 2054
207 Ga0207677_10112096 3300026023 Bacteria 2033
208 Ga0207703_10026213 3300026035 Bacteria 4586
209 Ga0207639_10235797 3300026041 Bacteria 1588
210 Ga0207639_10425892 3300026041 Bacteria 1201
211 Ga0207678_10001989 3300026067 Bacteria 18620
212 Ga0207708_10013937 3300026075 Bacteria 6007
213 Ga0207702_10072683 3300026078 Bacteria 2965
214 Ga0207641_10000209 3300026088 Bacteria 75878
215 Ga0207641_10007378 3300026088 Bacteria 9151
216 Ga0207641_10085506 3300026088 Bacteria 2748
217 Ga0207648_10008163 3300026089 Bacteria 10179
218 Ga0207648_10234690 3300026089 Bacteria 1632
219 Ga0207676_10014090 3300026095 Bacteria 5743
220 Ga0207676_10016990 3300026095 Bacteria 5269
221 Ga0207674_10019586 3300026116 Bacteria 7327
222 Ga0207674_10038686 3300026116 Bacteria 4947
223 Ga0207674_10207827 3300026116 Bacteria 1907
224 Ga0209179_1021903 3300027512 Bacteria 1251
225 Ga0207428_10102264 3300027907 Bacteria 2213
226 Ga0268266_10000530 3300028379 Bacteria 53318
227 Ga0268266_10002981 3300028379 Bacteria 17450
228 Ga0268266_10003780 3300028379 Bacteria 14829
229 Ga0268266_10037071 3300028379 Bacteria 4154
230 Ga0268265_10042999 3300028380 Bacteria 3355
231 Ga0268264_10000044 3300028381 Bacteria 368079
232 Ga0268264_10035115 3300028381 Bacteria 4127
233 Ga0268264_10068022 3300028381 Bacteria 3008
234 Ga0268264_10317187 3300028381 Bacteria 1473
235 Ga0316177_1060438 3300030731 Bacteria 1775
236 Ga0265325_10037996 3300031241 Bacteria 2542
237 Ga0265340_10030243 3300031247 Bacteria 2714
238 Ga0265331_10049691 3300031250 Bacteria 2014
239 Ga0307513_10183853 3300031456 Bacteria 1950
240 Ga0307513_10239575 3300031456 Bacteria 1620
241 Ga0316575_10056922 3300031665 Bacteria 1558
242 Ga0316576_10010418 3300031727 Bacteria 6039
243 Ga0316576_10078477 3300031727 Bacteria 2447
244 Ga0307409_100181679 3300031995 Unclassified 1863
245 Ga0307414_10003585 3300032004 Bacteria 8310
246 Ga0307414_10013547 3300032004 Bacteria 4859
247 Ga0307510_10000011 3300033180 Bacteria 355464
248 Ga0307510_10088645 3300033180 Bacteria 2952
249 Ga0373934_0081234 3300035086 Bacteria 1302
250 Ga0373923_0005329 3300035111 Bacteria 4365
251 Ga0373936_0002921 3300035113 Bacteria 6383
252 Ga0373945_0009245 3300035116 Bacteria 3226
253 Ga0373954_0002734 3300035118 Bacteria 7425
254 Ga0373957_0005855 3300035120 Bacteria 3838
255 Ga0373943_0006165 3300035170 Bacteria 5382
256 Ga0373943_0102580 3300035170 Bacteria 1498
257 Ga0373946_0008243 3300035171 Bacteria 3825
258 Ga0373955_0000651 3300035172 Bacteria 14839
259 Ga0373924_0003725 3300035410 Bacteria 5266
260 Ga0373935_0000086 3300035692 Bacteria 40589
261 Ga0373927_0017053 3300035695 Bacteria 4785
262 Ga0373927_0024770 3300035695 Bacteria 3921
263 Ga0373927_0056742 3300035695 Bacteria 2532
264 Ga0373933_0001369 3300035724 Bacteria 14351
265 Ga0373947_0000096 3300035725 Bacteria 44841
266 Ga0373947_0225038 3300035725 Bacteria 1234
267 Ga0373937_0000198 3300036401 Bacteria 59112
268 Ga0373937_0010467 3300036401 Bacteria 8098
269 Ga0373925_0000071 3300037068 Bacteria 106825
270 Ga0373925_0531006 3300037068 Bacteria 967
271 Ga0395901_0176809 3300038443 Bacteria 2239
272 Ga0400483_126179 3300039062 Bacteria 1798
273 Ga0466969_0044531 3300044656 Bacteria 2206
274 Ga0466969_0174086 3300044656 Bacteria 986
275 Ga0466959_0044794 3300045049 Bacteria 3259
276 Ga0451576_0140115 3300045051 Bacteria 2522
277 Ga0466967_0498843 3300045976 Bacteria 1194
278 Ga0466967_0603056 3300045976 Bacteria 1084
279 Ga0495592_0000117 3300046454 Bacteria 69975
280 Ga0495592_0277418 3300046454 Bacteria 1097
281 Ga0495603_0026581 3300046455 Bacteria 3496
282 Ga0495629_0171297 3300046459 Bacteria 1506
283 Ga0495638_0060692 3300046460 Bacteria 2338
284 Ga0495641_0147255 3300046461 Bacteria 1052
285 Ga0495651_0000370 3300046462 Bacteria 34672
286 Ga0495653_0000047 3300046463 Bacteria 111093
287 Ga0495582_0022265 3300046473 Bacteria 3468
288 Ga0495662_0003055 3300046476 Bacteria 8443
289 Ga0495664_0000024 3300046477 Bacteria 126593
290 Ga0495584_0007669 3300046491 Bacteria 5621
291 Ga0495584_0034171 3300046491 Bacteria 2573
292 Ga0495584_0055743 3300046491 Bacteria 1989
293 Ga0495583_0000083 3300046506 Bacteria 165667
294 Ga0495583_0104126 3300046506 Bacteria 1208
295 Ga0495606_0272418 3300046507 Bacteria 929
296 Ga0495608_0000004 3300046511 Bacteria 355027
297 Ga0495618_0000036 3300046514 Bacteria 101535
298 Ga0495628_0000006 3300046516 Bacteria 306606
299 Ga0495630_0000647 3300046517 Bacteria 25227
300 Ga0495637_0082405 3300046520 Bacteria 1281
301 Ga0495643_0000332 3300046522 Bacteria 64478
302 Ga0495643_0004872 3300046522 Bacteria 9243
303 Ga0495652_0000038 3300046529 Bacteria 129311
304 Ga0495665_0061750 3300046531 Bacteria 1979
305 Ga0495640_0000001 3300046533 Bacteria 853827
306 Ga0495640_0041836 3300046533 Bacteria 3200
307 Ga0495586_0151498 3300046535 Bacteria 1305
308 Ga0495586_0376412 3300046535 Bacteria 816
309 Ga0495587_0000004 3300046536 Bacteria 358433
310 Ga0495645_0000001 3300046543 Bacteria 657910
311 Ga0495667_0000093 3300046559 Bacteria 65066
312 Ga0495634_0000133 3300046642 Bacteria 64326
313 Ga0495625_0267652 3300046660 Bacteria 1104
314 Ga0495635_0000003 3300046663 Bacteria 390055
315 Ga0495659_0071670 3300046664 Bacteria 1299
316 Ga0495657_0000143 3300046675 Bacteria 64334
317 Ga0495599_0000012 3300046678 Bacteria 181156
318 Ga0495623_0000015 3300046679 Bacteria 117329
319 Ga0495646_0000005 3300046680 Bacteria 266899
320 Ga0495658_0075041 3300046683 Bacteria 1972
321 Ga0495613_0055678 3300046689 Bacteria 2905
322 Ga0495670_0164347 3300046691 Bacteria 1167
323 Ga0495600_0000051 3300046809 Bacteria 69572
324 Ga0495581_0063685 3300047315 Bacteria 2130
325 Ga0495604_0000002 3300047317 Bacteria 530904
326 Ga0495604_0079518 3300047317 Bacteria 2459
327 Ga0495674_0000004 3300047319 Bacteria 531855
328 Ga0495680_0000142 3300047322 Bacteria 72324
329 Ga0495683_0004505 3300047323 Bacteria 7893
330 Ga0495687_000080 3300047443 Bacteria 147467
331 Ga0495675_0007029 3300047444 Bacteria 6920
332 Ga0495677_0003380 3300047445 Bacteria 6208
333 Ga0495681_0081133 3300047470 Bacteria 1448
334 Ga0495684_0000004 3300047471 Bacteria 307093
335 Ga0495684_0155055 3300047471 Bacteria 1711
336 Ga0495686_0020687 3300047472 Bacteria 4386
337 Ga0495593_0009939 3300047673 Bacteria 5517
338 Ga0495602_0000001 3300048088 Bacteria 510904
339 Ga0496100_0002764 3300048903 Bacteria 8970
340 Ga0496101_0043868 3300048904 Bacteria 3197
341 Ga0496101_0215996 3300048904 Bacteria 1487
342 Ga0496101_0220612 3300048904 Bacteria 1471
343 Ga0496102_0003461 3300048905 Bacteria 13386
344 Ga0496102_0131835 3300048905 Bacteria 2340
345 Ga0496102_0501249 3300048905 Bacteria 1136
346 Ga0496103_0005361 3300048906 Bacteria 7681
347 Ga0496104_0025696 3300048907 Bacteria 5431
348 Ga0496104_0100548 3300048907 Bacteria 2768
349 Ga0496105_0002172 3300048908 Bacteria 14201
350 Ga0496106_0001978 3300048909 Bacteria 15410
351 Ga0496107_0001810 3300048910 Bacteria 13474
352 Ga0496108_0006959 3300048911 Bacteria 9152
353 Ga0496108_0795133 3300048911 Bacteria 816
354 Ga0496109_0012310 3300048912 Bacteria 7385
355 Ga0496109_0036605 3300048912 Bacteria 4430
356 Ga0496110_0010240 3300048913 Bacteria 7615
357 Ga0496111_0002567 3300048914 Bacteria 10973
358 Ga0496112_0021890 3300048915 Bacteria 6084
359 Ga0496112_0049410 3300048915 Bacteria 4123
360 Ga0496112_0712438 3300048915 Bacteria 931
361 Ga0496113_0007417 3300048916 Bacteria 7055
362 Ga0496114_0001580 3300048917 Bacteria 17300
363 Ga0496114_0006166 3300048917 Bacteria 9434
364 Ga0496114_0010152 3300048917 Bacteria 7493
365 Ga0496114_0182758 3300048917 Bacteria 1832
366 Ga0496115_0002107 3300048918 Bacteria 14236
367 Ga0496115_0033944 3300048918 Bacteria 4032
368 Ga0496121_0033387 3300048924 Bacteria 4656
369 Ga0496125_0039390 3300048928 Bacteria 4071
370 Ga0496125_0242338 3300048928 Bacteria 1144
371 Ga0496126_0002985 3300048929 Bacteria 21973
372 Ga0495682_0003597 3300049460 Bacteria 6833
373 Ga0501038_0086351 3300049574 Bacteria 2636
374 Ga0501047_0446294 3300049581 Bacteria 1123
375 Ga0501047_0656747 3300049581 Bacteria 868
376 Ga0501080_0045555 3300049742 Bacteria 4083
377 Ga0501080_0444078 3300049742 Bacteria 1164
378 Ga0501035_0516052 3300049822 Bacteria 982
379 Ga0501044_0088514 3300049823 Bacteria 3125
380 Ga0501045_0080741 3300049824 Bacteria 2398
381 nmdc:mga03683_17007_c1 3300050489 Bacteria 2744
382 nmdc:mga03n38_55869_c1 3300050490 Bacteria 1780
383 nmdc:mga0yw44_4923_c1 3300050492 Bacteria 6217
384 nmdc:mga0yw44_97408_c1 3300050492 Bacteria 1869
385 nmdc:mga06z11_119241_c1 3300050494 Bacteria 1470
386 nmdc:mga04h51_105600_c1 3300050495 Bacteria 1032
387 nmdc:mga09592_169131_c1 3300050508 Bacteria 1890
388 nmdc:mga06r32_263988_c1 3300050510 Bacteria 1709
389 nmdc:mga08y16_102791_c1 3300050511 Bacteria 2975
390 nmdc:mga0n895_164620_c1 3300050512 Bacteria 2249
391 nmdc:mga0n895_254059_c1 3300050512 Bacteria 1784
392 nmdc:mga0a205_11989_c2 3300050515 Bacteria 7401
393 Ga0495601_0000026 3300053077 Bacteria 126257
394 Ga0495601_0016151 3300053077 Bacteria 4521
395 Ga0495601_0063546 3300053077 Bacteria 2346
396 Ga0495612_0000005 3300053078 Bacteria 286943
397 Ga0495595_0000058 3300053084 Bacteria 57705
398 Ga0495595_0008069 3300053084 Bacteria 4317
399 Ga0495595_0055879 3300053084 Bacteria 1839
400 Ga0495619_0000003 3300053085 Bacteria 515784
401 Ga0495619_0130657 3300053085 Bacteria 1726
402 Ga0495619_0231963 3300053085 Bacteria 1279
403 Ga0500646_0067342 3300053090 Bacteria 1067
404 Ga0500566_0001508 3300053094 Bacteria 13655
405 Ga0500555_000059 3300053103 Bacteria 55957
406 Ga0500572_000799 3300053111 Bacteria 10057
407 Ga0500595_010941 3300053119 Bacteria 3577
408 Ga0500595_016754 3300053119 Bacteria 2723
409 Ga0500595_042515 3300053119 Bacteria 1453
410 Ga0500658_0000681 3300053134 Bacteria 14018
411 Ga0500622_0002753 3300053156 Bacteria 12392
412 Ga0500637_0129242 3300053178 Bacteria 1465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0656747 Ga0501047_0656747_17_748 243
2 3300035695 Ga0373927_0024770 Ga0373927_0024770_3162_3899 245
3 3300046535 Ga0495586_0376412 Ga0495586_0376412_56_793 245
4 3300048911 Ga0496108_0795133 Ga0496108_0795133_55_792 245
5 3300005444 Ga0070694_100046522 Ga0070694_1000465223 255
6 3300005545 Ga0070695_100166877 Ga0070695_1001668772 255
7 3300005546 Ga0070696_100162814 Ga0070696_1001628142 255
8 3300044656 Ga0466969_0174086 Ga0466969_0174086_209_976 255
9 3300049824 Ga0501045_0080741 Ga0501045_0080741_22_789 255
10 3300053178 Ga0500637_0129242 Ga0500637_0129242_281_1081 259
11 3300005548 Ga0070665_100000467 Ga0070665_10000046716 265
12 3300005614 Ga0068856_100660468 Ga0068856_1006604681 265
13 3300009545 Ga0105237_10024037 Ga0105237_100240375 265
14 3300028379 Ga0268266_10003780 Ga0268266_1000378011 265
15 3300048928 Ga0496125_0242338 Ga0496125_0242338_94_924 265
16 3300053085 Ga0495619_0231963 Ga0495619_0231963_43_846 266
17 3300005548 Ga0070665_100017205 Ga0070665_1000172054 270
18 3300005844 Ga0068862_100082825 Ga0068862_1000828252 270
19 3300009093 Ga0105240_10124691 Ga0105240_101246912 270
20 3300025913 Ga0207695_10215098 Ga0207695_102150982 270
21 3300028379 Ga0268266_10002981 Ga0268266_1000298113 270
22 3300028380 Ga0268265_10042999 Ga0268265_100429992 270
23 3300033180 Ga0307510_10000011 Ga0307510_1000001185 270
24 3300046660 Ga0495625_0267652 Ga0495625_0267652_27_839 270
25 3300009093 Ga0105240_10452925 Ga0105240_104529252 271
26 3300020080 Ga0206350_10381688 Ga0206350_103816881 271
27 3300048904 Ga0496101_0215996 Ga0496101_0215996_626_1444 271
28 3300048907 Ga0496104_0100548 Ga0496104_0100548_47_865 271
29 3300048917 Ga0496114_0010152 Ga0496114_0010152_2877_3695 271
30 3300048929 Ga0496126_0002985 Ga0496126_0002985_20287_21150 271
31 3300053084 Ga0495595_0008069 Ga0495595_0008069_3383_4201 271
32 3300006846 Ga0075430_100135200 Ga0075430_1001352001 272
33 3300006880 Ga0075429_100197874 Ga0075429_1001978742 272
34 3300050508 nmdc:mga09592_169131_c1 nmdc:mga09592_169131_c1_946_1821 272
35 3300053119 Ga0500595_042515 Ga0500595_042515_186_1010 272
36 3300032004 Ga0307414_10013547 Ga0307414_100135473 273
37 3300005331 Ga0070670_100486558 Ga0070670_1004865581 274
38 3300005614 Ga0068856_100008146 Ga0068856_1000081463 274
39 3300005841 Ga0068863_100001030 Ga0068863_10000103010 274
40 3300005843 Ga0068860_100000554 Ga0068860_10000055425 274
41 3300006358 Ga0068871_100282598 Ga0068871_1002825981 274
42 3300009093 Ga0105240_10478226 Ga0105240_104782262 274
43 3300009545 Ga0105237_10004761 Ga0105237_100047612 274
44 3300009551 Ga0105238_10006142 Ga0105238_100061422 274
45 3300010375 Ga0105239_10002028 Ga0105239_1000202816 274
46 3300013306 Ga0163162_10065002 Ga0163162_100650022 274
47 3300025914 Ga0207671_10011037 Ga0207671_100110376 274
48 3300025924 Ga0207694_10097889 Ga0207694_100978892 274
49 3300025925 Ga0207650_10502497 Ga0207650_105024972 274
50 3300026041 Ga0207639_10425892 Ga0207639_104258921 274
51 3300026088 Ga0207641_10000209 Ga0207641_1000020920 274
52 3300028381 Ga0268264_10000044 Ga0268264_10000044249 274
53 3300031241 Ga0265325_10037996 Ga0265325_100379962 274
54 3300031250 Ga0265331_10049691 Ga0265331_100496912 274
55 3300031665 Ga0316575_10056922 Ga0316575_100569221 274
56 3300033180 Ga0307510_10088645 Ga0307510_100886452 274
57 3300044656 Ga0466969_0044531 Ga0466969_0044531_638_1468 274
58 3300045049 Ga0466959_0044794 Ga0466959_0044794_429_1259 274
59 3300045976 Ga0466967_0498843 Ga0466967_0498843_36_881 274
60 3300053156 Ga0500622_0002753 Ga0500622_0002753_5166_6002 274
61 iso_pu_bacteria 2808606401 2809065238 274
62 iso_pu_bacteria 2808606404 2809081228 274
63 iso_pu_bacteria 2808606405 2809085570 274
64 iso_pu_bacteria 2880518877 2880522981 274
65 3300005336 Ga0070680_100030843 Ga0070680_1000308433 275
66 3300005336 Ga0070680_100184595 Ga0070680_1001845952 275
67 3300005458 Ga0070681_10054007 Ga0070681_100540072 275
68 3300005530 Ga0070679_100004524 Ga0070679_10000452411 275
69 3300009093 Ga0105240_10251731 Ga0105240_102517312 275
70 3300009093 Ga0105240_10302276 Ga0105240_103022762 275
71 3300013104 Ga0157370_10013376 Ga0157370_100133768 275
72 3300013104 Ga0157370_10137732 Ga0157370_101377322 275
73 3300013105 Ga0157369_10002099 Ga0157369_100020999 275
74 3300013105 Ga0157369_10676266 Ga0157369_106762662 275
75 3300013307 Ga0157372_10315893 Ga0157372_103158932 275
76 3300014968 Ga0157379_10744218 Ga0157379_107442181 275
77 3300025912 Ga0207707_10014907 Ga0207707_100149073 275
78 3300025912 Ga0207707_10119772 Ga0207707_101197722 275
79 3300025913 Ga0207695_10180548 Ga0207695_101805482 275
80 3300025913 Ga0207695_10200273 Ga0207695_102002732 275
81 3300025917 Ga0207660_10071830 Ga0207660_100718302 275
82 3300025921 Ga0207652_10013362 Ga0207652_100133623 275
83 3300026116 Ga0207674_10038686 Ga0207674_100386862 275
84 3300031247 Ga0265340_10030243 Ga0265340_100302434 275
85 3300046664 Ga0495659_0071670 Ga0495659_0071670_379_1230 275
86 3300049742 Ga0501080_0444078 Ga0501080_0444078_196_1026 275
87 3300053111 Ga0500572_000799 Ga0500572_000799_752_1579 275
88 3300001979 JGI24740J21852_10001365 JGI24740J21852_100013658 276
89 3300003323 rootH1_10031852 rootH1_100318522 276
90 3300005327 Ga0070658_10005318 Ga0070658_100053184 276
91 3300005336 Ga0070680_100005900 Ga0070680_1000059007 276
92 3300005339 Ga0070660_100125758 Ga0070660_1001257581 276
93 3300005530 Ga0070679_100023192 Ga0070679_1000231926 276
94 3300005563 Ga0068855_100060597 Ga0068855_1000605974 276
95 3300005614 Ga0068856_100112950 Ga0068856_1001129502 276
96 3300005843 Ga0068860_100234477 Ga0068860_1002344771 276
97 3300006042 Ga0075368_10007809 Ga0075368_100078093 276
98 3300006048 Ga0075363_100051757 Ga0075363_1000517571 276
99 3300006177 Ga0075362_10066549 Ga0075362_100665493 276
100 3300006178 Ga0075367_10004453 Ga0075367_100044535 276
101 3300006178 Ga0075367_10059636 Ga0075367_100596362 276
102 3300006186 Ga0075369_10147492 Ga0075369_101474922 276
103 3300006195 Ga0075366_10123692 Ga0075366_101236923 276
104 3300006353 Ga0075370_10162986 Ga0075370_101629861 276
105 3300013102 Ga0157371_10029339 Ga0157371_100293394 276
106 3300013104 Ga0157370_10010037 Ga0157370_100100379 276
107 3300025297 Ga0209758_1008717 Ga0209758_10087175 276
108 3300025909 Ga0207705_10026395 Ga0207705_100263954 276
109 3300025912 Ga0207707_10039338 Ga0207707_100393384 276
110 3300025917 Ga0207660_10007426 Ga0207660_100074265 276
111 3300025919 Ga0207657_10015288 Ga0207657_100152885 276
112 3300025949 Ga0207667_10078191 Ga0207667_100781912 276
113 3300028381 Ga0268264_10317187 Ga0268264_103171872 276
114 3300031456 Ga0307513_10183853 Ga0307513_101838532 276
115 3300031456 Ga0307513_10239575 Ga0307513_102395752 276
116 3300049581 Ga0501047_0446294 Ga0501047_0446294_243_1094 276
117 3300050489 nmdc:mga03683_17007_c1 nmdc:mga03683_17007_c1_1141_1983 276
118 3300050490 nmdc:mga03n38_55869_c1 nmdc:mga03n38_55869_c1_58_900 276
119 3300050492 nmdc:mga0yw44_97408_c1 nmdc:mga0yw44_97408_c1_112_954 276
120 3300050495 nmdc:mga04h51_105600_c1 nmdc:mga04h51_105600_c1_100_942 276
121 3300053090 Ga0500646_0067342 Ga0500646_0067342_181_1032 276
122 3300053119 Ga0500595_010941 Ga0500595_010941_962_1813 276
123 3300005842 Ga0068858_100053332 Ga0068858_1000533322 277
124 3300005937 Ga0081455_10127477 Ga0081455_101274772 277
125 3300006178 Ga0075367_10120130 Ga0075367_101201302 277
126 3300006847 Ga0075431_100289306 Ga0075431_1002893061 277
127 3300006852 Ga0075433_10052204 Ga0075433_100522042 277
128 3300006871 Ga0075434_100312453 Ga0075434_1003124532 277
129 3300009551 Ga0105238_10087166 Ga0105238_100871662 277
130 3300013297 Ga0157378_10565670 Ga0157378_105656701 277
131 3300014968 Ga0157379_10311827 Ga0157379_103118272 277
132 3300014969 Ga0157376_10372497 Ga0157376_103724972 277
133 3300027907 Ga0207428_10102264 Ga0207428_101022642 277
134 3300028379 Ga0268266_10000530 Ga0268266_1000053016 277
135 3300031727 Ga0316576_10010418 Ga0316576_100104187 277
136 3300035170 Ga0373943_0102580 Ga0373943_0102580_204_1061 277
137 3300035695 Ga0373927_0017053 Ga0373927_0017053_2856_3695 277
138 3300035725 Ga0373947_0225038 Ga0373947_0225038_310_1149 277
139 3300037068 Ga0373925_0531006 Ga0373925_0531006_11_850 277
140 3300046455 Ga0495603_0026581 Ga0495603_0026581_2014_2892 277
141 3300046459 Ga0495629_0171297 Ga0495629_0171297_228_1067 277
142 3300046473 Ga0495582_0022265 Ga0495582_0022265_2236_3126 277
143 3300046531 Ga0495665_0061750 Ga0495665_0061750_916_1806 277
144 3300046533 Ga0495640_0041836 Ga0495640_0041836_1535_2374 277
145 3300046535 Ga0495586_0151498 Ga0495586_0151498_161_1000 277
146 3300046683 Ga0495658_0075041 Ga0495658_0075041_267_1157 277
147 3300047471 Ga0495684_0155055 Ga0495684_0155055_31_870 277
148 3300048915 Ga0496112_0712438 Ga0496112_0712438_58_906 277
149 3300048917 Ga0496114_0182758 Ga0496114_0182758_416_1255 277
150 3300048924 Ga0496121_0033387 Ga0496121_0033387_635_1489 277
151 3300050492 nmdc:mga0yw44_4923_c1 nmdc:mga0yw44_4923_c1_785_1627 277
152 3300050494 nmdc:mga06z11_119241_c1 nmdc:mga06z11_119241_c1_196_1074 277
153 3300050510 nmdc:mga06r32_263988_c1 nmdc:mga06r32_263988_c1_815_1693 277
154 3300050511 nmdc:mga08y16_102791_c1 nmdc:mga08y16_102791_c1_1183_2061 277
155 3300050512 nmdc:mga0n895_254059_c1 nmdc:mga0n895_254059_c1_466_1344 277
156 3300050515 nmdc:mga0a205_11989_c2 nmdc:mga0a205_11989_c2_4418_5296 277
157 3300053094 Ga0500566_0001508 Ga0500566_0001508_7629_8477 277
158 3300053119 Ga0500595_016754 Ga0500595_016754_1822_2676 277
159 3300005331 Ga0070670_100003054 Ga0070670_10000305411 278
160 3300005335 Ga0070666_10064166 Ga0070666_100641663 278
161 3300005338 Ga0068868_100174817 Ga0068868_1001748172 278
162 3300005355 Ga0070671_100021251 Ga0070671_1000212513 278
163 3300005367 Ga0070667_100128178 Ga0070667_1001281783 278
164 3300005436 Ga0070713_100582215 Ga0070713_1005822151 278
165 3300005535 Ga0070684_100565527 Ga0070684_1005655271 278
166 3300005563 Ga0068855_100389419 Ga0068855_1003894192 278
167 3300005564 Ga0070664_100108224 Ga0070664_1001082241 278
168 3300005614 Ga0068856_100111241 Ga0068856_1001112413 278
169 3300005615 Ga0070702_100006977 Ga0070702_1000069774 278
170 3300005617 Ga0068859_100026824 Ga0068859_1000268242 278
171 3300005618 Ga0068864_100351694 Ga0068864_1003516941 278
172 3300005843 Ga0068860_100027815 Ga0068860_1000278155 278
173 3300006237 Ga0097621_100028213 Ga0097621_1000282132 278
174 3300006358 Ga0068871_100011730 Ga0068871_1000117304 278
175 3300006931 Ga0097620_100026824 Ga0097620_1000268246 278
176 3300007788 Ga0099795_10000141 Ga0099795_100001418 278
177 3300009098 Ga0105245_10027188 Ga0105245_100271884 278
178 3300009101 Ga0105247_10004678 Ga0105247_100046782 278
179 3300009177 Ga0105248_10077773 Ga0105248_100777731 278
180 3300010159 Ga0099796_10013428 Ga0099796_100134282 278
181 3300010159 Ga0099796_10016190 Ga0099796_100161902 278
182 3300010375 Ga0105239_10185810 Ga0105239_101858102 278
183 3300011119 Ga0105246_10003742 Ga0105246_100037425 278
184 3300013105 Ga0157369_10038846 Ga0157369_100388462 278
185 3300013296 Ga0157374_10001205 Ga0157374_1000120520 278
186 3300013308 Ga0157375_10080564 Ga0157375_100805642 278
187 3300014325 Ga0163163_10005227 Ga0163163_100052276 278
188 3300014969 Ga0157376_10472045 Ga0157376_104720451 278
189 3300025900 Ga0207710_10024442 Ga0207710_100244422 278
190 3300025903 Ga0207680_10051365 Ga0207680_100513653 278
191 3300025925 Ga0207650_10025027 Ga0207650_100250272 278
192 3300025927 Ga0207687_10042890 Ga0207687_100428902 278
193 3300025931 Ga0207644_10136888 Ga0207644_101368882 278
194 3300025939 Ga0207665_10382572 Ga0207665_103825721 278
195 3300025941 Ga0207711_10019834 Ga0207711_100198344 278
196 3300025944 Ga0207661_10080644 Ga0207661_100806443 278
197 3300025945 Ga0207679_10061606 Ga0207679_100616063 278
198 3300025986 Ga0207658_10017058 Ga0207658_100170582 278
199 3300026023 Ga0207677_10109409 Ga0207677_101094092 278
200 3300026088 Ga0207641_10085506 Ga0207641_100855061 278
201 3300026095 Ga0207676_10014090 Ga0207676_100140906 278
202 3300027512 Ga0209179_1021903 Ga0209179_10219032 278
203 3300028381 Ga0268264_10068022 Ga0268264_100680222 278
204 3300030731 Ga0316177_1060438 Ga0316177_10604382 278
205 3300031995 Ga0307409_100181679 Ga0307409_1001816792 278
206 3300032004 Ga0307414_10003585 Ga0307414_100035853 278
207 3300035086 Ga0373934_0081234 Ga0373934_0081234_221_1174 278
208 3300035111 Ga0373923_0005329 Ga0373923_0005329_3494_4345 278
209 3300035113 Ga0373936_0002921 Ga0373936_0002921_4907_5860 278
210 3300035116 Ga0373945_0009245 Ga0373945_0009245_2321_3160 278
211 3300035118 Ga0373954_0002734 Ga0373954_0002734_2109_3062 278
212 3300035120 Ga0373957_0005855 Ga0373957_0005855_2123_3076 278
213 3300035170 Ga0373943_0006165 Ga0373943_0006165_3155_4108 278
214 3300035171 Ga0373946_0008243 Ga0373946_0008243_2271_3224 278
215 3300035172 Ga0373955_0000651 Ga0373955_0000651_1548_2501 278
216 3300035410 Ga0373924_0003725 Ga0373924_0003725_2904_3857 278
217 3300035692 Ga0373935_0000086 Ga0373935_0000086_17747_18700 278
218 3300035695 Ga0373927_0056742 Ga0373927_0056742_1477_2430 278
219 3300035724 Ga0373933_0001369 Ga0373933_0001369_11909_12862 278
220 3300035725 Ga0373947_0000096 Ga0373947_0000096_38581_39534 278
221 3300036401 Ga0373937_0000198 Ga0373937_0000198_21521_22474 278
222 3300036401 Ga0373937_0010467 Ga0373937_0010467_2201_3040 278
223 3300037068 Ga0373925_0000071 Ga0373925_0000071_12823_13776 278
224 3300039062 Ga0400483_126179 Ga0400483_126179_586_1443 278
225 3300045051 Ga0451576_0140115 Ga0451576_0140115_1622_2461 278
226 3300045976 Ga0466967_0603056 Ga0466967_0603056_200_1042 278
227 3300046454 Ga0495592_0000117 Ga0495592_0000117_17365_18318 278
228 3300046454 Ga0495592_0277418 Ga0495592_0277418_41_925 278
229 3300046462 Ga0495651_0000370 Ga0495651_0000370_26623_27576 278
230 3300046463 Ga0495653_0000047 Ga0495653_0000047_87101_88054 278
231 3300046476 Ga0495662_0003055 Ga0495662_0003055_5211_6164 278
232 3300046477 Ga0495664_0000024 Ga0495664_0000024_57948_58901 278
233 3300046491 Ga0495584_0007669 Ga0495584_0007669_3697_4551 278
234 3300046491 Ga0495584_0034171 Ga0495584_0034171_585_1439 278
235 3300046506 Ga0495583_0000083 Ga0495583_0000083_85668_86522 278
236 3300046507 Ga0495606_0272418 Ga0495606_0272418_23_877 278
237 3300046511 Ga0495608_0000004 Ga0495608_0000004_84125_85078 278
238 3300046514 Ga0495618_0000036 Ga0495618_0000036_34935_35888 278
239 3300046516 Ga0495628_0000006 Ga0495628_0000006_65655_66608 278
240 3300046517 Ga0495630_0000647 Ga0495630_0000647_1481_2434 278
241 3300046520 Ga0495637_0082405 Ga0495637_0082405_111_965 278
242 3300046522 Ga0495643_0000332 Ga0495643_0000332_2072_2926 278
243 3300046522 Ga0495643_0004872 Ga0495643_0004872_509_1363 278
244 3300046529 Ga0495652_0000038 Ga0495652_0000038_60666_61619 278
245 3300046533 Ga0495640_0000001 Ga0495640_0000001_32512_33465 278
246 3300046536 Ga0495587_0000004 Ga0495587_0000004_87590_88543 278
247 3300046543 Ga0495645_0000001 Ga0495645_0000001_270038_270991 278
248 3300046559 Ga0495667_0000093 Ga0495667_0000093_51784_52737 278
249 3300046642 Ga0495634_0000133 Ga0495634_0000133_17355_18308 278
250 3300046663 Ga0495635_0000003 Ga0495635_0000003_269669_270622 278
251 3300046675 Ga0495657_0000143 Ga0495657_0000143_17322_18275 278
252 3300046678 Ga0495599_0000012 Ga0495599_0000012_27604_28557 278
253 3300046679 Ga0495623_0000015 Ga0495623_0000015_64667_65620 278
254 3300046680 Ga0495646_0000005 Ga0495646_0000005_182209_183162 278
255 3300046689 Ga0495613_0055678 Ga0495613_0055678_1542_2495 278
256 3300046691 Ga0495670_0164347 Ga0495670_0164347_117_971 278
257 3300046809 Ga0495600_0000051 Ga0495600_0000051_20500_21453 278
258 3300047315 Ga0495581_0063685 Ga0495581_0063685_995_1948 278
259 3300047317 Ga0495604_0000002 Ga0495604_0000002_260027_260980 278
260 3300047319 Ga0495674_0000004 Ga0495674_0000004_259576_260529 278
261 3300047322 Ga0495680_0000142 Ga0495680_0000142_48027_48980 278
262 3300047323 Ga0495683_0004505 Ga0495683_0004505_6824_7678 278
263 3300047444 Ga0495675_0007029 Ga0495675_0007029_1094_2047 278
264 3300047445 Ga0495677_0003380 Ga0495677_0003380_4796_5650 278
265 3300047470 Ga0495681_0081133 Ga0495681_0081133_244_1098 278
266 3300047471 Ga0495684_0000004 Ga0495684_0000004_240452_241405 278
267 3300047472 Ga0495686_0020687 Ga0495686_0020687_2218_3072 278
268 3300047673 Ga0495593_0009939 Ga0495593_0009939_3052_4005 278
269 3300048088 Ga0495602_0000001 Ga0495602_0000001_269711_270664 278
270 3300048904 Ga0496101_0220612 Ga0496101_0220612_489_1328 278
271 3300048905 Ga0496102_0131835 Ga0496102_0131835_1451_2290 278
272 3300048905 Ga0496102_0501249 Ga0496102_0501249_65_904 278
273 3300048912 Ga0496109_0036605 Ga0496109_0036605_722_1561 278
274 3300048915 Ga0496112_0021890 Ga0496112_0021890_2278_3117 278
275 3300048917 Ga0496114_0006166 Ga0496114_0006166_1181_2020 278
276 3300048918 Ga0496115_0033944 Ga0496115_0033944_2344_3183 278
277 3300049460 Ga0495682_0003597 Ga0495682_0003597_178_1032 278
278 3300049574 Ga0501038_0086351 Ga0501038_0086351_68_934 278
279 3300049742 Ga0501080_0045555 Ga0501080_0045555_408_1274 278
280 3300049822 Ga0501035_0516052 Ga0501035_0516052_29_895 278
281 3300049823 Ga0501044_0088514 Ga0501044_0088514_2039_2905 278
282 3300053077 Ga0495601_0000026 Ga0495601_0000026_57740_58693 278
283 3300053077 Ga0495601_0016151 Ga0495601_0016151_2236_3075 278
284 3300053078 Ga0495612_0000005 Ga0495612_0000005_45992_46945 278
285 3300053084 Ga0495595_0000058 Ga0495595_0000058_40203_41156 278
286 3300053085 Ga0495619_0000003 Ga0495619_0000003_274833_275786 278
287 3300053085 Ga0495619_0130657 Ga0495619_0130657_808_1671 278
288 3300053103 Ga0500555_000059 Ga0500555_000059_3799_4653 278
289 3300053134 Ga0500658_0000681 Ga0500658_0000681_11679_12533 278
290 3300003759 Ga0055525_1000096 Ga0055525_1000096112 279
291 3300005336 Ga0070680_100011870 Ga0070680_1000118705 279
292 3300005457 Ga0070662_100174971 Ga0070662_1001749712 279
293 3300005458 Ga0070681_10038893 Ga0070681_100388934 279
294 3300005459 Ga0068867_100191771 Ga0068867_1001917712 279
295 3300005530 Ga0070679_100015471 Ga0070679_1000154712 279
296 3300009148 Ga0105243_10000235 Ga0105243_1000023512 279
297 3300013104 Ga0157370_10027981 Ga0157370_100279816 279
298 3300025230 Ga0209563_100058 Ga0209563_10005811 279
299 3300025297 Ga0209758_1000001 Ga0209758_100000192 279
300 3300025912 Ga0207707_10033937 Ga0207707_100339372 279
301 3300025917 Ga0207660_10010675 Ga0207660_100106755 279
302 3300025921 Ga0207652_10048405 Ga0207652_100484052 279
303 3300025935 Ga0207709_10001102 Ga0207709_1000110212 279
304 3300026089 Ga0207648_10234690 Ga0207648_102346902 279
305 3300031727 Ga0316576_10078477 Ga0316576_100784774 279
306 3300046461 Ga0495641_0147255 Ga0495641_0147255_19_861 279
307 3300046506 Ga0495583_0104126 Ga0495583_0104126_217_1080 279
308 3300047443 Ga0495687_000080 Ga0495687_000080_12324_13187 279
309 3300009093 Ga0105240_10509390 Ga0105240_105093902 280
310 3300013104 Ga0157370_10043779 Ga0157370_100437793 280
311 3300026116 Ga0207674_10207827 Ga0207674_102078271 280
312 3300001976 JGI24752J21851_1015261 JGI24752J21851_10152611 281
313 3300002077 JGI24744J21845_10027447 JGI24744J21845_100274472 281
314 3300005329 Ga0070683_100069223 Ga0070683_1000692234 281
315 3300005334 Ga0068869_100034583 Ga0068869_1000345834 281
316 3300005338 Ga0068868_100010658 Ga0068868_1000106582 281
317 3300005340 Ga0070689_100076173 Ga0070689_1000761732 281
318 3300005355 Ga0070671_100185041 Ga0070671_1001850412 281
319 3300005356 Ga0070674_100199677 Ga0070674_1001996772 281
320 3300005364 Ga0070673_100043980 Ga0070673_1000439802 281
321 3300005366 Ga0070659_100024476 Ga0070659_1000244764 281
322 3300005436 Ga0070713_100073211 Ga0070713_1000732111 281
323 3300005437 Ga0070710_10040868 Ga0070710_100408681 281
324 3300005438 Ga0070701_10006691 Ga0070701_100066913 281
325 3300005440 Ga0070705_100105562 Ga0070705_1001055622 281
326 3300005441 Ga0070700_100028228 Ga0070700_1000282282 281
327 3300005455 Ga0070663_100082891 Ga0070663_1000828912 281
328 3300005457 Ga0070662_100392091 Ga0070662_1003920912 281
329 3300005458 Ga0070681_10041960 Ga0070681_100419604 281
330 3300005530 Ga0070679_100048629 Ga0070679_1000486292 281
331 3300005535 Ga0070684_100059263 Ga0070684_1000592632 281
332 3300005539 Ga0068853_100171380 Ga0068853_1001713801 281
333 3300005544 Ga0070686_100007811 Ga0070686_1000078112 281
334 3300005548 Ga0070665_100149164 Ga0070665_1001491642 281
335 3300005564 Ga0070664_100015863 Ga0070664_1000158632 281
336 3300005577 Ga0068857_100069730 Ga0068857_1000697302 281
337 3300005615 Ga0070702_100003175 Ga0070702_1000031756 281
338 3300005616 Ga0068852_100619620 Ga0068852_1006196201 281
339 3300005718 Ga0068866_10001735 Ga0068866_100017357 281
340 3300005719 Ga0068861_100030305 Ga0068861_1000303054 281
341 3300005840 Ga0068870_10028225 Ga0068870_100282252 281
342 3300005841 Ga0068863_100006541 Ga0068863_1000065412 281
343 3300005842 Ga0068858_100126952 Ga0068858_1001269522 281
344 3300005843 Ga0068860_100065130 Ga0068860_1000651304 281
345 3300005844 Ga0068862_100166016 Ga0068862_1001660162 281
346 3300006163 Ga0070715_10021995 Ga0070715_100219952 281
347 3300006237 Ga0097621_100187351 Ga0097621_1001873512 281
348 3300006358 Ga0068871_100025476 Ga0068871_1000254762 281
349 3300006881 Ga0068865_100018779 Ga0068865_1000187792 281
350 3300009174 Ga0105241_10277792 Ga0105241_102777921 281
351 3300009177 Ga0105248_10241406 Ga0105248_102414062 281
352 3300009545 Ga0105237_10139522 Ga0105237_101395222 281
353 3300010375 Ga0105239_10163232 Ga0105239_101632322 281
354 3300011119 Ga0105246_10017902 Ga0105246_100179022 281
355 3300013297 Ga0157378_10092583 Ga0157378_100925832 281
356 3300013306 Ga0163162_10028154 Ga0163162_100281544 281
357 3300013308 Ga0157375_10058597 Ga0157375_100585974 281
358 3300014326 Ga0157380_10189363 Ga0157380_101893632 281
359 3300014745 Ga0157377_10001312 Ga0157377_100013125 281
360 3300014969 Ga0157376_10422117 Ga0157376_104221172 281
361 3300025898 Ga0207692_10037554 Ga0207692_100375542 281
362 3300025901 Ga0207688_10040014 Ga0207688_100400142 281
363 3300025904 Ga0207647_10110249 Ga0207647_101102492 281
364 3300025905 Ga0207685_10024039 Ga0207685_100240392 281
365 3300025908 Ga0207643_10001897 Ga0207643_100018972 281
366 3300025912 Ga0207707_10022489 Ga0207707_100224895 281
367 3300025925 Ga0207650_10071660 Ga0207650_100716602 281
368 3300025926 Ga0207659_10080505 Ga0207659_100805052 281
369 3300025931 Ga0207644_10035474 Ga0207644_100354742 281
370 3300025933 Ga0207706_10002448 Ga0207706_1000244810 281
371 3300025934 Ga0207686_10092895 Ga0207686_100928952 281
372 3300025935 Ga0207709_10035870 Ga0207709_100358702 281
373 3300025936 Ga0207670_10110483 Ga0207670_101104832 281
374 3300025937 Ga0207669_10012993 Ga0207669_100129934 281
375 3300025938 Ga0207704_10009447 Ga0207704_100094472 281
376 3300025940 Ga0207691_10001718 Ga0207691_1000171815 281
377 3300025941 Ga0207711_10043608 Ga0207711_100436082 281
378 3300025942 Ga0207689_10006461 Ga0207689_1000646110 281
379 3300025945 Ga0207679_10018406 Ga0207679_100184063 281
380 3300025986 Ga0207658_10020103 Ga0207658_100201032 281
381 3300026023 Ga0207677_10112096 Ga0207677_101120962 281
382 3300026035 Ga0207703_10026213 Ga0207703_100262134 281
383 3300026041 Ga0207639_10235797 Ga0207639_102357971 281
384 3300026067 Ga0207678_10001989 Ga0207678_100019896 281
385 3300026075 Ga0207708_10013937 Ga0207708_100139376 281
386 3300026078 Ga0207702_10072683 Ga0207702_100726832 281
387 3300026088 Ga0207641_10007378 Ga0207641_100073789 281
388 3300026089 Ga0207648_10008163 Ga0207648_100081633 281
389 3300026095 Ga0207676_10016990 Ga0207676_100169905 281
390 3300026116 Ga0207674_10019586 Ga0207674_100195862 281
391 3300028379 Ga0268266_10037071 Ga0268266_100370712 281
392 3300028381 Ga0268264_10035115 Ga0268264_100351154 281
393 3300038443 Ga0395901_0176809 Ga0395901_0176809_1207_2055 281
394 3300046460 Ga0495638_0060692 Ga0495638_0060692_366_1238 281
395 3300046491 Ga0495584_0055743 Ga0495584_0055743_432_1307 281
396 3300047317 Ga0495604_0079518 Ga0495604_0079518_107_997 281
397 3300048903 Ga0496100_0002764 Ga0496100_0002764_4779_5669 281
398 3300048904 Ga0496101_0043868 Ga0496101_0043868_1452_2342 281
399 3300048905 Ga0496102_0003461 Ga0496102_0003461_7215_8105 281
400 3300048906 Ga0496103_0005361 Ga0496103_0005361_1595_2485 281
401 3300048907 Ga0496104_0025696 Ga0496104_0025696_3637_4527 281
402 3300048908 Ga0496105_0002172 Ga0496105_0002172_6745_7635 281
403 3300048909 Ga0496106_0001978 Ga0496106_0001978_7536_8426 281
404 3300048910 Ga0496107_0001810 Ga0496107_0001810_3954_4844 281
405 3300048911 Ga0496108_0006959 Ga0496108_0006959_7358_8248 281
406 3300048912 Ga0496109_0012310 Ga0496109_0012310_1417_2307 281
407 3300048913 Ga0496110_0010240 Ga0496110_0010240_2435_3325 281
408 3300048914 Ga0496111_0002567 Ga0496111_0002567_5330_6220 281
409 3300048915 Ga0496112_0049410 Ga0496112_0049410_2542_3432 281
410 3300048916 Ga0496113_0007417 Ga0496113_0007417_3010_3900 281
411 3300048917 Ga0496114_0001580 Ga0496114_0001580_10761_11651 281
412 3300048918 Ga0496115_0002107 Ga0496115_0002107_11468_12358 281
413 3300048928 Ga0496125_0039390 Ga0496125_0039390_1579_2451 281
414 3300050512 nmdc:mga0n895_164620_c1 nmdc:mga0n895_164620_c1_1138_2028 281
415 3300053077 Ga0495601_0063546 Ga0495601_0063546_906_1796 281
416 3300053084 Ga0495595_0055879 Ga0495595_0055879_719_1609 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

53

307

0.89

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

58

300

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vsu-assembly1.cif.gz_D a ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism. 0.9908 9 249
2vss-assembly1.cif.gz_F wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin 0.9902 9 247
2vsu-assembly1.cif.gz_F a ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism. 0.9902 9 247
6p5u-assembly1.cif.gz_E structure of an enoyl-coa hydratase/aldolase isolated from a lignin-degrading consortium 0.9888 10 249
6p5u-assembly1.cif.gz_F structure of an enoyl-coa hydratase/aldolase isolated from a lignin-degrading consortium 0.9887 10 249
ID Description Score Start End Superfamily
2j5iC02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9922 212 249 6.10.250.2850
2j5iJ02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9887 212 249 6.10.250.2850
2j5iA02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9885 212 249 6.10.250.2850
2vssE02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.985 212 249 6.10.250.2850
2vssC02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9847 212 249 6.10.250.2850
ID Description Score Start End GO Terms
AF-A0A3M3M664-F1-model_v4 4-hydroxycinnamoyl CoA hydratase/lyase 0.9918 29 277 GO:0008300
GO:0016829
AF-O05618-F1-model_v4 Enoyl-CoA hydratase 0.9915 33 276 GO:0003824
GO:0008300
AF-A0A5A9GSK0-F1-model_v4 p-hydroxycinnamoyl CoA hydratase/lyase (EC 4.1.2.41, EC 4.2.1.101) 0.99 11 277 GO:0008300
GO:0016829
AF-A0A2D8G5W3-F1-model_v4 p-hydroxycinnamoyl CoA hydratase/lyase (EC 4.2.1.17) 0.9889 10 276 GO:0004300
GO:0008300
AF-A0A7K0JWN9-F1-model_v4 deleted 0.9882 10 276

Feature Viewer

pLDDT pTM Quality
92.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map