F438889

General Info

Members Datasets Scaffolds Average Seq Length
416 253 395 174

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0008141|Ga0495640_0008141_240_857
Length 205
Sequence MWQLLKQIARTDTPDERVPEGDDAWRTESQQIQQEILDVLGRALCIREIDGGSCNGCELEIHALNNPYYNIEGLGIRFVASPRHADMLLVTGPLTLNMKEAVRRAYEATPHPKLVVAVGECACTGGMFKESYAVCGPLSKALPVDVTVPGCPPPPIDILRGILAALRTKHATSPITAFTGKGSARSPRVMTAPVCHADVFKDDGR

Samples

Sample ID Description Type Environment
1 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
2 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
3 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
4 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
5 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
6 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
7 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
8 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
9 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
10 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
11 2818991450 Burkholderia sp. 604 Isolate Unclassified
12 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
13 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
14 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
15 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
16 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
17 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
250 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
251 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
253 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 0
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0.48
Rhizoplane 3.61
Rhizosphere 88.94
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013230 3300001989 Bacteria 3016
2 JGI24739J22299_10091680 3300001989 Bacteria 925
3 JGI24735J21928_10056939 3300002067 Bacteria 1125
4 rootH1_10192037 3300003316 Bacteria 1932
5 Ga0070683_100642590 3300005329 Bacteria 1016
6 Ga0070670_100218963 3300005331 Bacteria 1656
7 Ga0070680_100024696 3300005336 Bacteria 4804
8 Ga0068868_100122524 3300005338 Bacteria 2122
9 Ga0070660_100008415 3300005339 Bacteria 7210
10 Ga0070689_100061057 3300005340 Bacteria 2931
11 Ga0070691_10516303 3300005341 Bacteria 693
12 Ga0070687_100225683 3300005343 Bacteria 1150
13 Ga0070661_100031817 3300005344 Bacteria 3816
14 Ga0070661_100358236 3300005344 Bacteria 1146
15 Ga0070675_100374826 3300005354 Bacteria 1266
16 Ga0070671_101121974 3300005355 Bacteria 691
17 Ga0070674_100011337 3300005356 Bacteria 5425
18 Ga0070673_100176529 3300005364 Bacteria 1826
19 Ga0070659_100055236 3300005366 Bacteria 3129
20 Ga0070705_100535648 3300005440 Bacteria 895
21 Ga0070678_100211518 3300005456 Bacteria 1607
22 Ga0070681_10001793 3300005458 Bacteria 19292
23 Ga0070681_10062553 3300005458 Bacteria 3696
24 Ga0070707_100589572 3300005468 Bacteria 1074
25 Ga0070679_100004207 3300005530 Bacteria 13276
26 Ga0068853_100497195 3300005539 Bacteria 1151
27 Ga0068855_100051587 3300005563 Bacteria 4846
28 Ga0068855_100136212 3300005563 Bacteria 2802
29 Ga0068857_100148552 3300005577 Bacteria 2122
30 Ga0068857_100161714 3300005577 Bacteria 2032
31 Ga0068856_100003893 3300005614 Bacteria 14976
32 Ga0068856_100025087 3300005614 Bacteria 5810
33 Ga0068856_100180779 3300005614 Bacteria 2122
34 Ga0068852_100547673 3300005616 Bacteria 1157
35 Ga0068859_101293395 3300005617 Bacteria 804
36 Ga0068864_100197695 3300005618 Bacteria 1846
37 Ga0070715_10677792 3300006163 Bacteria 613
38 Ga0097621_100505747 3300006237 Bacteria 1095
39 Ga0075370_10009025 3300006353 Bacteria 5156
40 Ga0068871_101070426 3300006358 Bacteria 753
41 Ga0075429_100072529 3300006880 Bacteria 2998
42 Ga0097620_101293421 3300006931 Bacteria 804
43 Ga0105251_10000043 3300009011 Bacteria 113848
44 Ga0105251_10161038 3300009011 Bacteria 1012
45 Ga0105240_10002714 3300009093 Bacteria 28107
46 Ga0105245_11567571 3300009098 Bacteria 710
47 Ga0105243_10518619 3300009148 Bacteria 1133
48 Ga0105242_10594456 3300009176 Bacteria 1068
49 Ga0105248_10193405 3300009177 Bacteria 2292
50 Ga0105238_10153081 3300009551 Bacteria 2281
51 Ga0105249_10131665 3300009553 Bacteria 2388
52 Ga0105239_11183237 3300010375 Bacteria 881
53 Ga0157373_10214101 3300013100 Bacteria 1359
54 Ga0157370_10026210 3300013104 Bacteria 5759
55 Ga0157370_10779701 3300013104 Bacteria 870
56 Ga0157369_10018189 3300013105 Bacteria 7883
57 Ga0157369_10660780 3300013105 Bacteria 1077
58 Ga0157369_11260162 3300013105 Bacteria 754
59 Ga0157374_11935131 3300013296 Bacteria 616
60 Ga0163162_10006936 3300013306 Bacteria 10983
61 Ga0157372_10036778 3300013307 Bacteria 5398
62 Ga0157372_10168243 3300013307 Bacteria 2535
63 Ga0157372_10250957 3300013307 Bacteria 2054
64 Ga0157375_10013867 3300013308 Bacteria 7186
65 Ga0163163_10748438 3300014325 Bacteria 1041
66 Ga0182008_10104934 3300014497 Bacteria 1398
67 Ga0182006_1008307 3300015261 Bacteria 4707
68 Ga0182007_10000245 3300015262 Bacteria 36521
69 Ga0163161_10294619 3300017792 Bacteria 1276
70 Ga0209026_1000952 3300025250 Bacteria 14523
71 Ga0209564_1027154 3300025295 Bacteria 1868
72 Ga0207713_1000240 3300025735 Bacteria 73219
73 Ga0207682_10110760 3300025893 Bacteria 1208
74 Ga0207647_10001239 3300025904 Bacteria 19642
75 Ga0207707_10005840 3300025912 Bacteria 10757
76 Ga0207707_10354952 3300025912 Bacteria 1263
77 Ga0207695_10000372 3300025913 Bacteria 101840
78 Ga0207660_10115314 3300025917 Bacteria 2027
79 Ga0207660_10871750 3300025917 Bacteria 735
80 Ga0207662_10211381 3300025918 Bacteria 1259
81 Ga0207657_10005143 3300025919 Bacteria 13712
82 Ga0207657_10056042 3300025919 Bacteria 3402
83 Ga0207649_10144966 3300025920 Bacteria 1629
84 Ga0207652_10008490 3300025921 Bacteria 8268
85 Ga0207652_10057989 3300025921 Bacteria 3336
86 Ga0207694_10243201 3300025924 Bacteria 1471
87 Ga0207650_10040073 3300025925 Bacteria 3426
88 Ga0207650_10194635 3300025925 Bacteria 1621
89 Ga0207659_10204454 3300025926 Bacteria 1579
90 Ga0207687_11253391 3300025927 Bacteria 637
91 Ga0207664_10181338 3300025929 Bacteria 1808
92 Ga0207644_10882731 3300025931 Bacteria 749
93 Ga0207690_10185479 3300025932 Bacteria 1569
94 Ga0207706_10541014 3300025933 Bacteria 1003
95 Ga0207686_10642587 3300025934 Bacteria 839
96 Ga0207670_10061872 3300025936 Bacteria 2556
97 Ga0207669_10002388 3300025937 Bacteria 7992
98 Ga0207711_10116428 3300025941 Bacteria 2383
99 Ga0207679_10022730 3300025945 Bacteria 4275
100 Ga0207667_10095726 3300025949 Bacteria 3065
101 Ga0207651_10104811 3300025960 Bacteria 2108
102 Ga0207668_10005437 3300025972 Bacteria 7499
103 Ga0207640_10072511 3300025981 Bacteria 2323
104 Ga0207703_10140973 3300026035 Bacteria 2092
105 Ga0207639_10452325 3300026041 Bacteria 1166
106 Ga0207639_10524435 3300026041 Bacteria 1085
107 Ga0207702_10005806 3300026078 Bacteria 10735
108 Ga0207702_10343141 3300026078 Bacteria 1427
109 Ga0207702_11107467 3300026078 Bacteria 786
110 Ga0207648_10123667 3300026089 Bacteria 2275
111 Ga0207676_10117673 3300026095 Bacteria 2235
112 Ga0207674_10037306 3300026116 Bacteria 5056
113 Ga0207674_10256438 3300026116 Bacteria 1696
114 Ga0207683_10251679 3300026121 Bacteria 1612
115 Ga0209974_10049609 3300027876 Bacteria 1408
116 Ga0265336_10000151 3300028666 Bacteria 49239
117 Ga0265338_10000058 3300028800 Bacteria 198555
118 Ga0265324_10000001 3300029957 Bacteria 562975
119 Ga0265324_10021044 3300029957 Bacteria 2340
120 Ga0265325_10000046 3300031241 Bacteria 83850
121 Ga0265340_10013805 3300031247 Bacteria 4234
122 Ga0265316_10121096 3300031344 Bacteria 1976
123 Ga0307408_100002371 3300031548 Bacteria 13295
124 Ga0307408_100381237 3300031548 Bacteria 1205
125 Ga0316575_10017370 3300031665 Bacteria 2732
126 Ga0316579_10000083 3300031691 Bacteria 24244
127 Ga0265314_10036493 3300031711 Bacteria 3571
128 Ga0316578_10071034 3300031728 Bacteria 2061
129 Ga0307516_10660095 3300031730 Bacteria 701
130 Ga0307405_10240130 3300031731 Bacteria 1341
131 Ga0307413_10473314 3300031824 Bacteria 999
132 Ga0307410_10056641 3300031852 Bacteria 2666
133 Ga0307406_10001891 3300031901 Bacteria 11417
134 Ga0307407_10129091 3300031903 Bacteria 1614
135 Ga0307412_10149499 3300031911 Bacteria 1721
136 Ga0307409_100016227 3300031995 Bacteria 4920
137 Ga0307416_100197792 3300032002 Bacteria 1903
138 Ga0307414_10564693 3300032004 Bacteria 1016
139 Ga0307411_10438490 3300032005 Bacteria 1089
140 Ga0307415_100205808 3300032126 Bacteria 1565
141 Ga0316583_10030966 3300032133 Bacteria 1904
142 Ga0373924_0004144 3300035410 Bacteria 5042
143 Ga0373947_0409881 3300035725 Bacteria 915
144 Ga0373937_0289061 3300036401 Bacteria 1549
145 Ga0316582_0164799 3300036647 Bacteria 1502
146 Ga0316584_0125731 3300036712 Bacteria 1915
147 Ga0395905_0086855 3300037471 Bacteria 2932
148 Ga0316581_0018144 3300037588 Bacteria 2040
149 Ga0436361_0106893 3300039447 Bacteria 33853
150 Ga0439431_0006879 3300041997 Bacteria 2526
151 Ga0439434_0177533 3300042435 Bacteria 712
152 Ga0451577_0003002 3300042876 Bacteria 19230
153 Ga0466963_0616554 3300044694 Bacteria 766
154 Ga0453684_0353428 3300044712 Bacteria 1656
155 Ga0453684_0854000 3300044712 Bacteria 978
156 Ga0466957_0119674 3300044842 Bacteria 1678
157 Ga0495617_008368 3300046452 Bacteria 3568
158 Ga0495617_030924 3300046452 Bacteria 1799
159 Ga0495592_0029918 3300046454 Bacteria 4120
160 Ga0495603_0000088 3300046455 Bacteria 41342
161 Ga0495603_0001866 3300046455 Bacteria 12413
162 Ga0495603_0025691 3300046455 Bacteria 3560
163 Ga0495603_0051884 3300046455 Bacteria 2436
164 Ga0495591_002023 3300046458 Bacteria 11790
165 Ga0495629_0001671 3300046459 Bacteria 17413
166 Ga0495629_0002807 3300046459 Bacteria 13286
167 Ga0495629_0003264 3300046459 Bacteria 12272
168 Ga0495629_0010324 3300046459 Bacteria 6801
169 Ga0495629_0030528 3300046459 Bacteria 3820
170 Ga0495629_0208984 3300046459 Bacteria 1348
171 Ga0495638_0000695 3300046460 Bacteria 36497
172 Ga0495638_0002026 3300046460 Bacteria 17240
173 Ga0495641_0107766 3300046461 Bacteria 1243
174 Ga0495641_0285559 3300046461 Bacteria 743
175 Ga0495651_0047459 3300046462 Bacteria 3320
176 Ga0495651_0112907 3300046462 Bacteria 2007
177 Ga0495651_0160766 3300046462 Bacteria 1609
178 Ga0495651_0270855 3300046462 Bacteria 1151
179 Ga0495653_0001151 3300046463 Bacteria 20356
180 Ga0495653_0001591 3300046463 Bacteria 17839
181 Ga0495653_0001599 3300046463 Bacteria 17790
182 Ga0495653_0006569 3300046463 Bacteria 9545
183 Ga0495653_0017344 3300046463 Bacteria 5856
184 Ga0495653_0295430 3300046463 Bacteria 1058
185 Ga0495650_0002288 3300046471 Bacteria 15923
186 Ga0495580_0000233 3300046472 Bacteria 43728
187 Ga0495580_0000700 3300046472 Bacteria 28661
188 Ga0495580_0002263 3300046472 Bacteria 16815
189 Ga0495580_0003902 3300046472 Bacteria 12604
190 Ga0495580_0009171 3300046472 Bacteria 7800
191 Ga0495580_0014321 3300046472 Bacteria 6016
192 Ga0495580_0045884 3300046472 Bacteria 3103
193 Ga0495580_0082431 3300046472 Bacteria 2241
194 Ga0495580_0129256 3300046472 Bacteria 1752
195 Ga0495580_0177987 3300046472 Bacteria 1469
196 Ga0495580_0592036 3300046472 Bacteria 733
197 Ga0495582_0001731 3300046473 Bacteria 12313
198 Ga0495582_0072485 3300046473 Bacteria 1906
199 Ga0495582_0093561 3300046473 Bacteria 1678
200 Ga0495605_0012119 3300046474 Bacteria 4790
201 Ga0495639_0101230 3300046475 Bacteria 1360
202 Ga0495662_0115531 3300046476 Bacteria 1316
203 Ga0495664_0000429 3300046477 Bacteria 20586
204 Ga0495664_0022530 3300046477 Bacteria 3652
205 Ga0495584_0000538 3300046491 Bacteria 25705
206 Ga0495584_0070597 3300046491 Bacteria 1755
207 Ga0495584_0154371 3300046491 Bacteria 1166
208 Ga0495584_0413799 3300046491 Bacteria 685
209 Ga0495585_0011877 3300046492 Bacteria 5144
210 Ga0495585_0020140 3300046492 Bacteria 3838
211 Ga0495585_0079212 3300046492 Bacteria 1782
212 Ga0495596_0109341 3300046500 Bacteria 1073
213 Ga0495607_0029588 3300046501 Bacteria 3369
214 Ga0495607_0049207 3300046501 Bacteria 2459
215 Ga0495583_0000004 3300046506 Bacteria 655287
216 Ga0495583_0009130 3300046506 Bacteria 5959
217 Ga0495583_0077593 3300046506 Bacteria 1449
218 Ga0495606_0241123 3300046507 Bacteria 1008
219 Ga0495616_0008295 3300046513 Bacteria 6166
220 Ga0495616_0029134 3300046513 Bacteria 2918
221 Ga0495618_0247950 3300046514 Bacteria 1118
222 Ga0495620_0153157 3300046515 Bacteria 898
223 Ga0495628_0000831 3300046516 Bacteria 28661
224 Ga0495628_0003725 3300046516 Bacteria 13566
225 Ga0495628_0004836 3300046516 Bacteria 11851
226 Ga0495628_0033845 3300046516 Bacteria 4115
227 Ga0495630_0006292 3300046517 Bacteria 8434
228 Ga0495644_0000036 3300046523 Bacteria 65040
229 Ga0495648_0000217 3300046524 Bacteria 65806
230 Ga0495648_0002762 3300046524 Bacteria 15851
231 Ga0495648_0051842 3300046524 Bacteria 2496
232 Ga0495648_0111099 3300046524 Bacteria 1491
233 Ga0495648_0111722 3300046524 Bacteria 1485
234 Ga0495666_0000299 3300046526 Bacteria 21603
235 Ga0495666_0110487 3300046526 Bacteria 1291
236 Ga0495666_0317315 3300046526 Bacteria 703
237 Ga0495666_0376685 3300046526 Bacteria 639
238 Ga0495642_0021057 3300046528 Bacteria 2563
239 Ga0495642_0023851 3300046528 Bacteria 2417
240 Ga0495652_0001797 3300046529 Bacteria 22856
241 Ga0495652_0014196 3300046529 Bacteria 7155
242 Ga0495652_0014692 3300046529 Bacteria 7021
243 Ga0495652_0118434 3300046529 Unclassified 2116
244 Ga0495665_0000415 3300046531 Bacteria 21709
245 Ga0495665_0000879 3300046531 Bacteria 15726
246 Ga0495665_0004733 3300046531 Bacteria 7349
247 Ga0495665_0121100 3300046531 Bacteria 1370
248 Ga0495640_0008141 3300046533 Bacteria 8233
249 Ga0495640_0126182 3300046533 Bacteria 1660
250 Ga0495586_0001979 3300046535 Bacteria 11155
251 Ga0495587_0000686 3300046536 Bacteria 22717
252 Ga0495609_0000570 3300046538 Bacteria 28961
253 Ga0495645_0000116 3300046543 Bacteria 54286
254 Ga0495645_0002152 3300046543 Bacteria 13374
255 Ga0495645_0020146 3300046543 Bacteria 4808
256 Ga0495622_0009451 3300046557 Bacteria 4511
257 Ga0495667_0014831 3300046559 Bacteria 5266
258 Ga0495656_0000618 3300046615 Bacteria 11355
259 Ga0495634_0002194 3300046642 Bacteria 16391
260 Ga0495634_0036507 3300046642 Bacteria 3361
261 Ga0495611_0065357 3300046648 Bacteria 1657
262 Ga0495625_0044072 3300046660 Bacteria 3231
263 Ga0495625_0211237 3300046660 Bacteria 1275
264 Ga0495625_0313128 3300046660 Bacteria 1001
265 Ga0495635_0050985 3300046663 Bacteria 2853
266 Ga0495635_0057003 3300046663 Bacteria 2689
267 Ga0495635_0183164 3300046663 Bacteria 1423
268 Ga0495659_0029420 3300046664 Bacteria 1907
269 Ga0495659_0040141 3300046664 Bacteria 1667
270 Ga0495661_0001293 3300046665 Bacteria 21387
271 Ga0495661_0005687 3300046665 Bacteria 8827
272 Ga0495661_0188756 3300046665 Unclassified 1087
273 Ga0495661_0249401 3300046665 Bacteria 907
274 Ga0495588_0028327 3300046674 Bacteria 2803
275 Ga0495588_0032700 3300046674 Bacteria 2623
276 Ga0495657_0340107 3300046675 Bacteria 890
277 Ga0495657_0623658 3300046675 Bacteria 623
278 Ga0495599_0000617 3300046678 Bacteria 20153
279 Ga0495599_0021937 3300046678 Bacteria 3985
280 Ga0495599_0254487 3300046678 Bacteria 1068
281 Ga0495623_0003332 3300046679 Bacteria 10617
282 Ga0495623_0023704 3300046679 Bacteria 3959
283 Ga0495623_0034077 3300046679 Bacteria 3266
284 Ga0495623_0223627 3300046679 Bacteria 1071
285 Ga0495646_0003173 3300046680 Bacteria 10208
286 Ga0495646_0012481 3300046680 Bacteria 5402
287 Ga0495613_0004295 3300046689 Bacteria 10675
288 Ga0495613_0323275 3300046689 Bacteria 1064
289 Ga0495624_0000062 3300046690 Bacteria 67917
290 Ga0495624_0000383 3300046690 Bacteria 35210
291 Ga0495624_0000540 3300046690 Bacteria 29548
292 Ga0495624_0000958 3300046690 Bacteria 22780
293 Ga0495624_0001920 3300046690 Bacteria 15831
294 Ga0495624_0008355 3300046690 Bacteria 7227
295 Ga0495670_0003305 3300046691 Bacteria 7946
296 Ga0495671_0025230 3300046692 Bacteria 3091
297 Ga0495671_0164447 3300046692 Bacteria 1079
298 Ga0495649_0148039 3300046694 Bacteria 1234
299 Ga0495589_0003015 3300046794 Bacteria 9257
300 Ga0495589_0214954 3300046794 Bacteria 904
301 Ga0495600_0117927 3300046809 Bacteria 1727
302 Ga0495660_0206715 3300046810 Bacteria 934
303 Ga0495581_0004550 3300047315 Bacteria 8010
304 Ga0495581_0006191 3300047315 Bacteria 6940
305 Ga0495604_0001008 3300047317 Bacteria 23441
306 Ga0495604_0037883 3300047317 Bacteria 3795
307 Ga0495604_0151915 3300047317 Bacteria 1644
308 Ga0495674_0000741 3300047319 Bacteria 30840
309 Ga0495674_0008223 3300047319 Bacteria 9954
310 Ga0495674_0008525 3300047319 Bacteria 9756
311 Ga0495674_0011158 3300047319 Bacteria 8484
312 Ga0495674_0014935 3300047319 Bacteria 7267
313 Ga0495674_0017698 3300047319 Bacteria 6634
314 Ga0495672_0005937 3300047320 Bacteria 9571
315 Ga0495672_0024445 3300047320 Bacteria 3891
316 Ga0495672_0063240 3300047320 Bacteria 2125
317 Ga0495672_0174028 3300047320 Bacteria 1095
318 Ga0495676_0004775 3300047321 Bacteria 12410
319 Ga0495676_0036381 3300047321 Bacteria 4112
320 Ga0495676_0362913 3300047321 Bacteria 967
321 Ga0495676_0675731 3300047321 Bacteria 669
322 Ga0495680_0001805 3300047322 Bacteria 22616
323 Ga0495680_0013813 3300047322 Bacteria 7027
324 Ga0495680_0057812 3300047322 Bacteria 2998
325 Ga0495680_0246488 3300047322 Bacteria 1267
326 Ga0495683_0028194 3300047323 Bacteria 2871
327 Ga0495683_0068321 3300047323 Bacteria 1748
328 Ga0495683_0113141 3300047323 Bacteria 1294
329 Ga0495683_0213338 3300047323 Bacteria 864
330 Ga0495687_090648 3300047443 Bacteria 1171
331 Ga0495687_101077 3300047443 Unclassified 1081
332 Ga0495675_0004579 3300047444 Bacteria 8388
333 Ga0495675_0072457 3300047444 Bacteria 2173
334 Ga0495675_0227592 3300047444 Bacteria 1126
335 Ga0495675_0348433 3300047444 Bacteria 871
336 Ga0495677_0009012 3300047445 Bacteria 3690
337 Ga0495679_000473 3300047446 Bacteria 29110
338 Ga0495679_000897 3300047446 Bacteria 18689
339 Ga0495685_000003 3300047447 Bacteria 119490
340 Ga0495673_0042762 3300047469 Bacteria 2031
341 Ga0495673_0046467 3300047469 Bacteria 1924
342 Ga0495673_0171956 3300047469 Bacteria 825
343 Ga0495681_0025241 3300047470 Bacteria 3112
344 Ga0495681_0167123 3300047470 Bacteria 912
345 Ga0495684_0130480 3300047471 Bacteria 1888
346 Ga0495684_0167618 3300047471 Bacteria 1635
347 Ga0495686_0245127 3300047472 Bacteria 1009
348 Ga0495593_0001485 3300047673 Bacteria 13787
349 Ga0495593_0007325 3300047673 Bacteria 6465
350 Ga0495593_0011903 3300047673 Bacteria 4989
351 Ga0495593_0012155 3300047673 Bacteria 4925
352 Ga0495593_0164243 3300047673 Bacteria 1120
353 Ga0495602_0001774 3300048088 Bacteria 21600
354 Ga0495602_0041191 3300048088 Bacteria 4222
355 Ga0495602_0078485 3300048088 Bacteria 2788
356 Ga0495602_0084433 3300048088 Bacteria 2656
357 Ga0495602_0106670 3300048088 Unclassified 2286
358 Ga0495602_0116795 3300048088 Bacteria 2155
359 Ga0495614_0000191 3300048089 Bacteria 23174
360 Ga0496100_0038579 3300048903 Bacteria 3028
361 Ga0496100_0558712 3300048903 Bacteria 886
362 Ga0496102_0007226 3300048905 Bacteria 9480
363 Ga0496102_0951096 3300048905 Bacteria 780
364 Ga0496104_0012559 3300048907 Bacteria 7622
365 Ga0496104_0171562 3300048907 Bacteria 2080
366 Ga0496105_0117685 3300048908 Bacteria 2192
367 Ga0496107_0236513 3300048910 Bacteria 1359
368 Ga0496109_0838526 3300048912 Bacteria 857
369 Ga0496114_0202003 3300048917 Bacteria 1741
370 Ga0496115_0246265 3300048918 Bacteria 1472
371 Ga0496115_0770043 3300048918 Bacteria 751
372 Ga0496117_0226381 3300048920 Bacteria 1037
373 Ga0496118_0013636 3300048921 Bacteria 7672
374 Ga0496118_0148855 3300048921 Bacteria 1469
375 Ga0496121_0003416 3300048924 Bacteria 22707
376 Ga0496121_0008989 3300048924 Bacteria 11585
377 Ga0496121_0039120 3300048924 Bacteria 4187
378 Ga0496121_0772841 3300048924 Bacteria 568
379 Ga0496126_0000102 3300048929 Bacteria 201540
380 Ga0496126_0050028 3300048929 Bacteria 3811
381 Ga0495682_0000061 3300049460 Bacteria 101034
382 Ga0495682_0053415 3300049460 Bacteria 1467
383 Ga0501076_0115235 3300049592 Bacteria 2175
384 nmdc:mga03n38_342428_c1 3300050490 Bacteria 812
385 nmdc:mga0k408_33593_c1 3300050493 Bacteria 2934
386 nmdc:mga0k408_70844_c1 3300050493 Bacteria 2034
387 nmdc:mga07m45_12800_c1 3300050496 Bacteria 4438
388 nmdc:mga09592_1049016_c1 3300050508 Bacteria 679
389 nmdc:mga09592_986_c2 3300050508 Bacteria 22169
390 nmdc:mga0qj67_69846_c2 3300050509 Bacteria 2488
391 Ga0500610_0000061 3300053079 Bacteria 34215
392 Ga0500643_005993 3300053087 Bacteria 5146
393 Ga0500562_006267 3300053108 Bacteria 3000
394 Ga0500574_001470 3300053141 Bacteria 3530
395 Ga0590071_000525 3300059421 Bacteria 11181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100211518 Ga0070678_1002115182 161
2 3300005329 Ga0070683_100642590 Ga0070683_1006425902 164
3 3300005339 Ga0070660_100008415 Ga0070660_1000084152 164
4 3300005341 Ga0070691_10516303 Ga0070691_105163031 164
5 3300005344 Ga0070661_100031817 Ga0070661_1000318173 164
6 3300005366 Ga0070659_100055236 Ga0070659_1000552363 164
7 3300005539 Ga0068853_100497195 Ga0068853_1004971952 164
8 3300013104 Ga0157370_10026210 Ga0157370_100262102 164
9 3300013105 Ga0157369_11260162 Ga0157369_112601622 164
10 3300013307 Ga0157372_10168243 Ga0157372_101682432 164
11 3300025919 Ga0207657_10005143 Ga0207657_100051432 164
12 3300025932 Ga0207690_10185479 Ga0207690_101854792 164
13 3300026041 Ga0207639_10452325 Ga0207639_104523252 164
14 3300031548 Ga0307408_100002371 Ga0307408_1000023718 166
15 3300031731 Ga0307405_10240130 Ga0307405_102401302 166
16 3300031824 Ga0307413_10473314 Ga0307413_104733142 166
17 3300031852 Ga0307410_10056641 Ga0307410_100566412 166
18 3300031901 Ga0307406_10001891 Ga0307406_100018914 166
19 3300031903 Ga0307407_10129091 Ga0307407_101290912 166
20 3300031911 Ga0307412_10149499 Ga0307412_101494992 166
21 3300031995 Ga0307409_100016227 Ga0307409_1000162273 166
22 3300032002 Ga0307416_100197792 Ga0307416_1001977922 166
23 3300032004 Ga0307414_10564693 Ga0307414_105646932 166
24 3300032005 Ga0307411_10438490 Ga0307411_104384902 166
25 3300032126 Ga0307415_100205808 Ga0307415_1002058082 166
26 iso_pu_bacteria 2515154189 2516017173 166
27 3300005331 Ga0070670_100218963 Ga0070670_1002189632 167
28 3300005614 Ga0068856_100180779 Ga0068856_1001807793 167
29 3300025925 Ga0207650_10194635 Ga0207650_101946352 167
30 3300026078 Ga0207702_11107467 Ga0207702_111074671 167
31 iso_pu_bacteria 2599185240 2599744995 167
32 iso_pu_bacteria 2599185355 2600206824 167
33 iso_pu_bacteria 2675903129 2676743277 167
34 iso_pu_bacteria 2870068957 2870076552 167
35 iso_pu_bacteria 8020945358 8020948224 167
36 3300005336 Ga0070680_100024696 Ga0070680_1000246963 168
37 3300005344 Ga0070661_100358236 Ga0070661_1003582362 168
38 3300005458 Ga0070681_10001793 Ga0070681_100017937 168
39 3300005530 Ga0070679_100004207 Ga0070679_1000042078 168
40 3300005563 Ga0068855_100051587 Ga0068855_1000515875 168
41 3300005577 Ga0068857_100161714 Ga0068857_1001617142 168
42 3300005614 Ga0068856_100003893 Ga0068856_1000038938 168
43 3300013100 Ga0157373_10214101 Ga0157373_102141012 168
44 3300013296 Ga0157374_11935131 Ga0157374_119351311 168
45 3300013307 Ga0157372_10036778 Ga0157372_100367782 168
46 3300025912 Ga0207707_10005840 Ga0207707_100058403 168
47 3300025917 Ga0207660_10115314 Ga0207660_101153143 168
48 3300025917 Ga0207660_10871750 Ga0207660_108717502 168
49 3300025919 Ga0207657_10056042 Ga0207657_100560422 168
50 3300025920 Ga0207649_10144966 Ga0207649_101449662 168
51 3300025921 Ga0207652_10008490 Ga0207652_100084908 168
52 3300025921 Ga0207652_10057989 Ga0207652_100579892 168
53 3300025929 Ga0207664_10181338 Ga0207664_101813382 168
54 3300025945 Ga0207679_10022730 Ga0207679_100227303 168
55 3300025949 Ga0207667_10095726 Ga0207667_100957262 168
56 3300025981 Ga0207640_10072511 Ga0207640_100725112 168
57 3300026078 Ga0207702_10005806 Ga0207702_100058067 168
58 3300026116 Ga0207674_10037306 Ga0207674_100373062 168
59 3300031665 Ga0316575_10017370 Ga0316575_100173705 168
60 3300031691 Ga0316579_10000083 Ga0316579_100000832 168
61 3300031728 Ga0316578_10071034 Ga0316578_100710342 168
62 3300032133 Ga0316583_10030966 Ga0316583_100309662 168
63 3300036647 Ga0316582_0164799 Ga0316582_0164799_47_571 168
64 3300036712 Ga0316584_0125731 Ga0316584_0125731_1304_1828 168
65 3300037588 Ga0316581_0018144 Ga0316581_0018144_160_684 168
66 3300005338 Ga0068868_100122524 Ga0068868_1001225242 169
67 3300005340 Ga0070689_100061057 Ga0070689_1000610573 169
68 3300005354 Ga0070675_100374826 Ga0070675_1003748262 169
69 3300005458 Ga0070681_10062553 Ga0070681_100625534 169
70 3300005563 Ga0068855_100136212 Ga0068855_1001362122 169
71 3300005614 Ga0068856_100025087 Ga0068856_1000250875 169
72 3300005617 Ga0068859_101293395 Ga0068859_1012933951 169
73 3300006931 Ga0097620_101293421 Ga0097620_1012934212 169
74 3300009553 Ga0105249_10131665 Ga0105249_101316652 169
75 3300013104 Ga0157370_10779701 Ga0157370_107797012 169
76 3300013105 Ga0157369_10660780 Ga0157369_106607802 169
77 3300013307 Ga0157372_10250957 Ga0157372_102509573 169
78 3300025912 Ga0207707_10354952 Ga0207707_103549522 169
79 3300025926 Ga0207659_10204454 Ga0207659_102044542 169
80 3300025936 Ga0207670_10061872 Ga0207670_100618722 169
81 3300025972 Ga0207668_10005437 Ga0207668_100054376 169
82 3300026041 Ga0207639_10524435 Ga0207639_105244352 169
83 3300026078 Ga0207702_10343141 Ga0207702_103431412 169
84 3300044694 Ga0466963_0616554 Ga0466963_0616554_101_622 169
85 3300044842 Ga0466957_0119674 Ga0466957_0119674_610_1131 169
86 3300005468 Ga0070707_100589572 Ga0070707_1005895722 170
87 3300005618 Ga0068864_100197695 Ga0068864_1001976952 170
88 3300025925 Ga0207650_10040073 Ga0207650_100400732 170
89 3300026095 Ga0207676_10117673 Ga0207676_101176732 170
90 3300028800 Ga0265338_10000058 Ga0265338_1000005817 170
91 3300029957 Ga0265324_10021044 Ga0265324_100210442 170
92 3300031247 Ga0265340_10013805 Ga0265340_100138054 170
93 3300042876 Ga0451577_0003002 Ga0451577_0003002_6141_6680 170
94 3300044712 Ga0453684_0353428 Ga0453684_0353428_99_638 170
95 3300044712 Ga0453684_0854000 Ga0453684_0854000_432_962 170
96 3300046452 Ga0495617_008368 Ga0495617_008368_1747_2259 170
97 3300046452 Ga0495617_030924 Ga0495617_030924_614_1126 170
98 3300046460 Ga0495638_0000695 Ga0495638_0000695_29114_29626 170
99 3300046462 Ga0495651_0047459 Ga0495651_0047459_1688_2200 170
100 3300046474 Ga0495605_0012119 Ga0495605_0012119_2340_2852 170
101 3300046491 Ga0495584_0000538 Ga0495584_0000538_11865_12377 170
102 3300046491 Ga0495584_0154371 Ga0495584_0154371_59_571 170
103 3300046492 Ga0495585_0011877 Ga0495585_0011877_2067_2579 170
104 3300046501 Ga0495607_0029588 Ga0495607_0029588_154_666 170
105 3300046501 Ga0495607_0049207 Ga0495607_0049207_1304_1816 170
106 3300046506 Ga0495583_0000004 Ga0495583_0000004_448963_449475 170
107 3300046513 Ga0495616_0029134 Ga0495616_0029134_591_1103 170
108 3300046516 Ga0495628_0004836 Ga0495628_0004836_9430_9942 170
109 3300046523 Ga0495644_0000036 Ga0495644_0000036_45802_46314 170
110 3300046524 Ga0495648_0000217 Ga0495648_0000217_4006_4518 170
111 3300046529 Ga0495652_0118434 Ga0495652_0118434_905_1417 170
112 3300046538 Ga0495609_0000570 Ga0495609_0000570_533_1045 170
113 3300046615 Ga0495656_0000618 Ga0495656_0000618_4364_4876 170
114 3300046648 Ga0495611_0065357 Ga0495611_0065357_234_746 170
115 3300046660 Ga0495625_0044072 Ga0495625_0044072_2416_2928 170
116 3300046660 Ga0495625_0211237 Ga0495625_0211237_714_1226 170
117 3300046664 Ga0495659_0029420 Ga0495659_0029420_1023_1535 170
118 3300046664 Ga0495659_0040141 Ga0495659_0040141_329_841 170
119 3300046665 Ga0495661_0188756 Ga0495661_0188756_75_587 170
120 3300046691 Ga0495670_0003305 Ga0495670_0003305_980_1492 170
121 3300047320 Ga0495672_0024445 Ga0495672_0024445_2807_3319 170
122 3300047443 Ga0495687_101077 Ga0495687_101077_431_943 170
123 3300047445 Ga0495677_0009012 Ga0495677_0009012_139_651 170
124 3300047447 Ga0495685_000003 Ga0495685_000003_29730_30242 170
125 3300047469 Ga0495673_0046467 Ga0495673_0046467_87_599 170
126 3300048088 Ga0495602_0106670 Ga0495602_0106670_1537_2049 170
127 3300049460 Ga0495682_0000061 Ga0495682_0000061_83980_84492 170
128 3300001989 JGI24739J22299_10091680 JGI24739J22299_100916802 171
129 3300009093 Ga0105240_10002714 Ga0105240_1000271422 171
130 3300015261 Ga0182006_1008307 Ga0182006_10083075 171
131 3300025913 Ga0207695_10000372 Ga0207695_1000037268 171
132 3300026089 Ga0207648_10123667 Ga0207648_101236674 171
133 3300050508 nmdc:mga09592_1049016_c1 nmdc:mga09592_1049016_c1_125_646 171
134 iso_pu_bacteria 2513237166 2514047652 171
135 iso_pu_bacteria 2562617112 2563056896 171
136 iso_pu_bacteria 2562617112 2563064570 171
137 iso_pu_bacteria 2600255067 2600811094 171
138 iso_pu_bacteria 2711768613 2713472875 171
139 iso_pu_bacteria 2711768613 2713481083 171
140 iso_pu_bacteria 2721755763 2723878253 171
141 iso_pu_bacteria 2791355137 2792837093 171
142 iso_pu_bacteria 2818991450 2819620059 171
143 iso_pu_bacteria 2904615490 2904620159 171
144 iso_pu_bacteria 2928108538 2928110383 171
145 iso_pu_bacteria 2928135762 2928138483 171
146 iso_pu_bacteria 2928503688 2928505455 171
147 iso_pu_bacteria 2990703756 2990710485 171
148 iso_pu_bacteria 642555112 642597776 171
149 3300026035 Ga0207703_10140973 Ga0207703_101409732 172
150 3300031730 Ga0307516_10660095 Ga0307516_106600952 172
151 3300035410 Ga0373924_0004144 Ga0373924_0004144_3506_4024 172
152 3300036401 Ga0373937_0289061 Ga0373937_0289061_131_649 172
153 3300048903 Ga0496100_0558712 Ga0496100_0558712_182_712 173
154 3300059421 Ga0590071_000525 Ga0590071_000525_1333_1872 173
155 3300005356 Ga0070674_100011337 Ga0070674_1000113372 174
156 3300006880 Ga0075429_100072529 Ga0075429_1000725292 174
157 3300025893 Ga0207682_10110760 Ga0207682_101107602 174
158 3300025937 Ga0207669_10002388 Ga0207669_100023887 174
159 3300026121 Ga0207683_10251679 Ga0207683_102516792 174
160 3300028666 Ga0265336_10000151 Ga0265336_1000015128 174
161 3300029957 Ga0265324_10000001 Ga0265324_10000001119 174
162 3300031241 Ga0265325_10000046 Ga0265325_1000004618 174
163 3300031344 Ga0265316_10121096 Ga0265316_101210962 174
164 3300031711 Ga0265314_10036493 Ga0265314_100364934 174
165 3300041997 Ga0439431_0006879 Ga0439431_0006879_670_1206 174
166 3300042435 Ga0439434_0177533 Ga0439434_0177533_128_664 174
167 3300049592 Ga0501076_0115235 Ga0501076_0115235_1539_2075 174
168 3300050508 nmdc:mga09592_986_c2 nmdc:mga09592_986_c2_2228_2764 174
169 3300050509 nmdc:mga0qj67_69846_c2 nmdc:mga0qj67_69846_c2_1883_2419 174
170 3300001989 JGI24739J22299_10013230 JGI24739J22299_100132303 175
171 3300002067 JGI24735J21928_10056939 JGI24735J21928_100569392 175
172 3300003316 rootH1_10192037 rootH1_101920372 175
173 3300005343 Ga0070687_100225683 Ga0070687_1002256831 175
174 3300005355 Ga0070671_101121974 Ga0070671_1011219741 175
175 3300005364 Ga0070673_100176529 Ga0070673_1001765292 175
176 3300005440 Ga0070705_100535648 Ga0070705_1005356482 175
177 3300005577 Ga0068857_100148552 Ga0068857_1001485522 175
178 3300005616 Ga0068852_100547673 Ga0068852_1005476731 175
179 3300006163 Ga0070715_10677792 Ga0070715_106777921 175
180 3300006237 Ga0097621_100505747 Ga0097621_1005057472 175
181 3300006353 Ga0075370_10009025 Ga0075370_100090256 175
182 3300006358 Ga0068871_101070426 Ga0068871_1010704262 175
183 3300009011 Ga0105251_10000043 Ga0105251_1000004388 175
184 3300009011 Ga0105251_10161038 Ga0105251_101610381 175
185 3300009098 Ga0105245_11567571 Ga0105245_115675711 175
186 3300009148 Ga0105243_10518619 Ga0105243_105186192 175
187 3300009176 Ga0105242_10594456 Ga0105242_105944561 175
188 3300009177 Ga0105248_10193405 Ga0105248_101934052 175
189 3300009551 Ga0105238_10153081 Ga0105238_101530812 175
190 3300010375 Ga0105239_11183237 Ga0105239_111832371 175
191 3300013105 Ga0157369_10018189 Ga0157369_100181892 175
192 3300013306 Ga0163162_10006936 Ga0163162_100069365 175
193 3300013308 Ga0157375_10013867 Ga0157375_100138676 175
194 3300014325 Ga0163163_10748438 Ga0163163_107484382 175
195 3300014497 Ga0182008_10104934 Ga0182008_101049341 175
196 3300015262 Ga0182007_10000245 Ga0182007_1000024519 175
197 3300017792 Ga0163161_10294619 Ga0163161_102946192 175
198 3300025250 Ga0209026_1000952 Ga0209026_10009526 175
199 3300025295 Ga0209564_1027154 Ga0209564_10271543 175
200 3300025735 Ga0207713_1000240 Ga0207713_100024030 175
201 3300025904 Ga0207647_10001239 Ga0207647_1000123913 175
202 3300025918 Ga0207662_10211381 Ga0207662_102113812 175
203 3300025924 Ga0207694_10243201 Ga0207694_102432012 175
204 3300025927 Ga0207687_11253391 Ga0207687_112533911 175
205 3300025931 Ga0207644_10882731 Ga0207644_108827311 175
206 3300025933 Ga0207706_10541014 Ga0207706_105410142 175
207 3300025934 Ga0207686_10642587 Ga0207686_106425871 175
208 3300025941 Ga0207711_10116428 Ga0207711_101164282 175
209 3300025960 Ga0207651_10104811 Ga0207651_101048112 175
210 3300026116 Ga0207674_10256438 Ga0207674_102564382 175
211 3300027876 Ga0209974_10049609 Ga0209974_100496092 175
212 3300031548 Ga0307408_100381237 Ga0307408_1003812372 175
213 3300035725 Ga0373947_0409881 Ga0373947_0409881_352_894 175
214 3300037471 Ga0395905_0086855 Ga0395905_0086855_1612_2142 175
215 3300039447 Ga0436361_0106893 Ga0436361_0106893_1803_2372 175
216 3300046454 Ga0495592_0029918 Ga0495592_0029918_814_1341 175
217 3300046455 Ga0495603_0000088 Ga0495603_0000088_40523_41053 175
218 3300046455 Ga0495603_0001866 Ga0495603_0001866_5409_5936 175
219 3300046455 Ga0495603_0025691 Ga0495603_0025691_2098_2625 175
220 3300046455 Ga0495603_0051884 Ga0495603_0051884_308_835 175
221 3300046458 Ga0495591_002023 Ga0495591_002023_2394_2921 175
222 3300046459 Ga0495629_0001671 Ga0495629_0001671_3631_4158 175
223 3300046459 Ga0495629_0002807 Ga0495629_0002807_9030_9557 175
224 3300046459 Ga0495629_0003264 Ga0495629_0003264_7545_8072 175
225 3300046459 Ga0495629_0010324 Ga0495629_0010324_5187_5714 175
226 3300046459 Ga0495629_0030528 Ga0495629_0030528_272_799 175
227 3300046459 Ga0495629_0208984 Ga0495629_0208984_27_554 175
228 3300046460 Ga0495638_0002026 Ga0495638_0002026_9844_10371 175
229 3300046461 Ga0495641_0107766 Ga0495641_0107766_410_937 175
230 3300046461 Ga0495641_0285559 Ga0495641_0285559_173_700 175
231 3300046462 Ga0495651_0112907 Ga0495651_0112907_883_1410 175
232 3300046462 Ga0495651_0160766 Ga0495651_0160766_874_1401 175
233 3300046462 Ga0495651_0270855 Ga0495651_0270855_403_930 175
234 3300046463 Ga0495653_0001151 Ga0495653_0001151_14732_15274 175
235 3300046463 Ga0495653_0001591 Ga0495653_0001591_13246_13773 175
236 3300046463 Ga0495653_0001599 Ga0495653_0001599_2494_3021 175
237 3300046463 Ga0495653_0006569 Ga0495653_0006569_3045_3572 175
238 3300046463 Ga0495653_0017344 Ga0495653_0017344_4834_5361 175
239 3300046463 Ga0495653_0295430 Ga0495653_0295430_33_560 175
240 3300046471 Ga0495650_0002288 Ga0495650_0002288_10220_10747 175
241 3300046472 Ga0495580_0000233 Ga0495580_0000233_39316_39843 175
242 3300046472 Ga0495580_0000700 Ga0495580_0000700_7587_8114 175
243 3300046472 Ga0495580_0002263 Ga0495580_0002263_209_736 175
244 3300046472 Ga0495580_0003902 Ga0495580_0003902_11488_12018 175
245 3300046472 Ga0495580_0009171 Ga0495580_0009171_2739_3266 175
246 3300046472 Ga0495580_0014321 Ga0495580_0014321_2449_2976 175
247 3300046472 Ga0495580_0045884 Ga0495580_0045884_1737_2279 175
248 3300046472 Ga0495580_0082431 Ga0495580_0082431_91_618 175
249 3300046472 Ga0495580_0129256 Ga0495580_0129256_209_736 175
250 3300046472 Ga0495580_0177987 Ga0495580_0177987_142_684 175
251 3300046472 Ga0495580_0592036 Ga0495580_0592036_75_602 175
252 3300046473 Ga0495582_0001731 Ga0495582_0001731_4200_4727 175
253 3300046473 Ga0495582_0072485 Ga0495582_0072485_275_802 175
254 3300046473 Ga0495582_0093561 Ga0495582_0093561_64_591 175
255 3300046475 Ga0495639_0101230 Ga0495639_0101230_95_622 175
256 3300046476 Ga0495662_0115531 Ga0495662_0115531_714_1241 175
257 3300046477 Ga0495664_0000429 Ga0495664_0000429_5529_6056 175
258 3300046477 Ga0495664_0022530 Ga0495664_0022530_1463_1990 175
259 3300046491 Ga0495584_0070597 Ga0495584_0070597_1213_1740 175
260 3300046491 Ga0495584_0413799 Ga0495584_0413799_79_606 175
261 3300046492 Ga0495585_0020140 Ga0495585_0020140_711_1238 175
262 3300046492 Ga0495585_0079212 Ga0495585_0079212_981_1508 175
263 3300046500 Ga0495596_0109341 Ga0495596_0109341_389_916 175
264 3300046506 Ga0495583_0009130 Ga0495583_0009130_2057_2587 175
265 3300046506 Ga0495583_0077593 Ga0495583_0077593_360_887 175
266 3300046507 Ga0495606_0241123 Ga0495606_0241123_442_969 175
267 3300046513 Ga0495616_0008295 Ga0495616_0008295_1629_2156 175
268 3300046514 Ga0495618_0247950 Ga0495618_0247950_99_626 175
269 3300046515 Ga0495620_0153157 Ga0495620_0153157_63_590 175
270 3300046516 Ga0495628_0000831 Ga0495628_0000831_7587_8114 175
271 3300046516 Ga0495628_0003725 Ga0495628_0003725_7479_8006 175
272 3300046516 Ga0495628_0033845 Ga0495628_0033845_59_586 175
273 3300046517 Ga0495630_0006292 Ga0495630_0006292_1556_2083 175
274 3300046524 Ga0495648_0002762 Ga0495648_0002762_3714_4241 175
275 3300046524 Ga0495648_0051842 Ga0495648_0051842_1557_2084 175
276 3300046524 Ga0495648_0111099 Ga0495648_0111099_564_1091 175
277 3300046524 Ga0495648_0111722 Ga0495648_0111722_887_1414 175
278 3300046526 Ga0495666_0000299 Ga0495666_0000299_14663_15190 175
279 3300046526 Ga0495666_0110487 Ga0495666_0110487_659_1186 175
280 3300046526 Ga0495666_0317315 Ga0495666_0317315_117_647 175
281 3300046526 Ga0495666_0376685 Ga0495666_0376685_63_590 175
282 3300046528 Ga0495642_0021057 Ga0495642_0021057_1890_2417 175
283 3300046528 Ga0495642_0023851 Ga0495642_0023851_117_644 175
284 3300046529 Ga0495652_0001797 Ga0495652_0001797_14743_15270 175
285 3300046529 Ga0495652_0014196 Ga0495652_0014196_4183_4725 175
286 3300046529 Ga0495652_0014692 Ga0495652_0014692_5389_5916 175
287 3300046531 Ga0495665_0000415 Ga0495665_0000415_14705_15232 175
288 3300046531 Ga0495665_0000879 Ga0495665_0000879_9924_10466 175
289 3300046531 Ga0495665_0004733 Ga0495665_0004733_5760_6287 175
290 3300046531 Ga0495665_0121100 Ga0495665_0121100_681_1208 175
291 3300046533 Ga0495640_0008141 Ga0495640_0008141_240_857 175
292 3300046533 Ga0495640_0126182 Ga0495640_0126182_319_846 175
293 3300046535 Ga0495586_0001979 Ga0495586_0001979_4201_4728 175
294 3300046536 Ga0495587_0000686 Ga0495587_0000686_14614_15141 175
295 3300046543 Ga0495645_0000116 Ga0495645_0000116_46806_47333 175
296 3300046543 Ga0495645_0002152 Ga0495645_0002152_8572_9099 175
297 3300046543 Ga0495645_0020146 Ga0495645_0020146_4141_4668 175
298 3300046557 Ga0495622_0009451 Ga0495622_0009451_3103_3633 175
299 3300046559 Ga0495667_0014831 Ga0495667_0014831_4641_5168 175
300 3300046642 Ga0495634_0002194 Ga0495634_0002194_14575_15102 175
301 3300046642 Ga0495634_0036507 Ga0495634_0036507_1780_2307 175
302 3300046660 Ga0495625_0313128 Ga0495625_0313128_442_969 175
303 3300046663 Ga0495635_0050985 Ga0495635_0050985_1114_1641 175
304 3300046663 Ga0495635_0057003 Ga0495635_0057003_800_1342 175
305 3300046663 Ga0495635_0183164 Ga0495635_0183164_260_787 175
306 3300046665 Ga0495661_0001293 Ga0495661_0001293_14601_15128 175
307 3300046665 Ga0495661_0005687 Ga0495661_0005687_7421_7948 175
308 3300046665 Ga0495661_0249401 Ga0495661_0249401_335_862 175
309 3300046674 Ga0495588_0028327 Ga0495588_0028327_192_719 175
310 3300046674 Ga0495588_0032700 Ga0495588_0032700_224_751 175
311 3300046675 Ga0495657_0340107 Ga0495657_0340107_260_787 175
312 3300046675 Ga0495657_0623658 Ga0495657_0623658_59_589 175
313 3300046678 Ga0495599_0000617 Ga0495599_0000617_16711_17238 175
314 3300046678 Ga0495599_0021937 Ga0495599_0021937_1105_1632 175
315 3300046678 Ga0495599_0254487 Ga0495599_0254487_378_905 175
316 3300046679 Ga0495623_0003332 Ga0495623_0003332_7023_7550 175
317 3300046679 Ga0495623_0023704 Ga0495623_0023704_3301_3828 175
318 3300046679 Ga0495623_0034077 Ga0495623_0034077_2413_2955 175
319 3300046679 Ga0495623_0223627 Ga0495623_0223627_509_1036 175
320 3300046680 Ga0495646_0003173 Ga0495646_0003173_8644_9171 175
321 3300046680 Ga0495646_0012481 Ga0495646_0012481_4685_5212 175
322 3300046689 Ga0495613_0004295 Ga0495613_0004295_7581_8108 175
323 3300046689 Ga0495613_0323275 Ga0495613_0323275_351_878 175
324 3300046690 Ga0495624_0000062 Ga0495624_0000062_13284_13811 175
325 3300046690 Ga0495624_0000383 Ga0495624_0000383_3984_4511 175
326 3300046690 Ga0495624_0000540 Ga0495624_0000540_17421_17948 175
327 3300046690 Ga0495624_0000958 Ga0495624_0000958_7588_8115 175
328 3300046690 Ga0495624_0001920 Ga0495624_0001920_14239_14781 175
329 3300046690 Ga0495624_0008355 Ga0495624_0008355_1115_1642 175
330 3300046692 Ga0495671_0025230 Ga0495671_0025230_1277_1804 175
331 3300046692 Ga0495671_0164447 Ga0495671_0164447_410_937 175
332 3300046694 Ga0495649_0148039 Ga0495649_0148039_243_770 175
333 3300046794 Ga0495589_0003015 Ga0495589_0003015_5900_6427 175
334 3300046794 Ga0495589_0214954 Ga0495589_0214954_261_788 175
335 3300046809 Ga0495600_0117927 Ga0495600_0117927_255_782 175
336 3300046810 Ga0495660_0206715 Ga0495660_0206715_104_631 175
337 3300047315 Ga0495581_0004550 Ga0495581_0004550_2445_2972 175
338 3300047315 Ga0495581_0006191 Ga0495581_0006191_3568_4095 175
339 3300047317 Ga0495604_0001008 Ga0495604_0001008_623_1150 175
340 3300047317 Ga0495604_0037883 Ga0495604_0037883_2150_2677 175
341 3300047317 Ga0495604_0151915 Ga0495604_0151915_990_1517 175
342 3300047319 Ga0495674_0000741 Ga0495674_0000741_7587_8114 175
343 3300047319 Ga0495674_0008223 Ga0495674_0008223_3472_3999 175
344 3300047319 Ga0495674_0008525 Ga0495674_0008525_4654_5196 175
345 3300047319 Ga0495674_0011158 Ga0495674_0011158_3118_3645 175
346 3300047319 Ga0495674_0014935 Ga0495674_0014935_5605_6132 175
347 3300047319 Ga0495674_0017698 Ga0495674_0017698_2449_2976 175
348 3300047320 Ga0495672_0005937 Ga0495672_0005937_8059_8586 175
349 3300047320 Ga0495672_0063240 Ga0495672_0063240_1373_1900 175
350 3300047320 Ga0495672_0174028 Ga0495672_0174028_498_1025 175
351 3300047321 Ga0495676_0004775 Ga0495676_0004775_7563_8090 175
352 3300047321 Ga0495676_0036381 Ga0495676_0036381_2420_2947 175
353 3300047321 Ga0495676_0362913 Ga0495676_0362913_296_823 175
354 3300047321 Ga0495676_0675731 Ga0495676_0675731_58_585 175
355 3300047322 Ga0495680_0001805 Ga0495680_0001805_14710_15237 175
356 3300047322 Ga0495680_0013813 Ga0495680_0013813_2317_2874 175
357 3300047322 Ga0495680_0057812 Ga0495680_0057812_2442_2969 175
358 3300047322 Ga0495680_0246488 Ga0495680_0246488_660_1187 175
359 3300047323 Ga0495683_0028194 Ga0495683_0028194_2193_2720 175
360 3300047323 Ga0495683_0068321 Ga0495683_0068321_1054_1581 175
361 3300047323 Ga0495683_0113141 Ga0495683_0113141_427_954 175
362 3300047323 Ga0495683_0213338 Ga0495683_0213338_75_602 175
363 3300047443 Ga0495687_090648 Ga0495687_090648_264_791 175
364 3300047444 Ga0495675_0004579 Ga0495675_0004579_5966_6493 175
365 3300047444 Ga0495675_0072457 Ga0495675_0072457_1271_1798 175
366 3300047444 Ga0495675_0227592 Ga0495675_0227592_480_1022 175
367 3300047444 Ga0495675_0348433 Ga0495675_0348433_220_747 175
368 3300047446 Ga0495679_000473 Ga0495679_000473_6428_6955 175
369 3300047446 Ga0495679_000897 Ga0495679_000897_10676_11203 175
370 3300047469 Ga0495673_0042762 Ga0495673_0042762_35_562 175
371 3300047469 Ga0495673_0171956 Ga0495673_0171956_230_757 175
372 3300047470 Ga0495681_0025241 Ga0495681_0025241_990_1517 175
373 3300047470 Ga0495681_0167123 Ga0495681_0167123_83_610 175
374 3300047471 Ga0495684_0130480 Ga0495684_0130480_1330_1857 175
375 3300047471 Ga0495684_0167618 Ga0495684_0167618_1081_1608 175
376 3300047472 Ga0495686_0245127 Ga0495686_0245127_267_794 175
377 3300047673 Ga0495593_0001485 Ga0495593_0001485_8922_9449 175
378 3300047673 Ga0495593_0007325 Ga0495593_0007325_1180_1707 175
379 3300047673 Ga0495593_0011903 Ga0495593_0011903_1355_1897 175
380 3300047673 Ga0495593_0012155 Ga0495593_0012155_3626_4153 175
381 3300047673 Ga0495593_0164243 Ga0495593_0164243_507_1034 175
382 3300048088 Ga0495602_0001774 Ga0495602_0001774_14596_15123 175
383 3300048088 Ga0495602_0041191 Ga0495602_0041191_2561_3088 175
384 3300048088 Ga0495602_0078485 Ga0495602_0078485_1409_1936 175
385 3300048088 Ga0495602_0084433 Ga0495602_0084433_361_888 175
386 3300048088 Ga0495602_0116795 Ga0495602_0116795_318_860 175
387 3300048089 Ga0495614_0000191 Ga0495614_0000191_15061_15588 175
388 3300048903 Ga0496100_0038579 Ga0496100_0038579_1641_2168 175
389 3300048905 Ga0496102_0007226 Ga0496102_0007226_3067_3594 175
390 3300048905 Ga0496102_0951096 Ga0496102_0951096_224_751 175
391 3300048907 Ga0496104_0012559 Ga0496104_0012559_6661_7188 175
392 3300048907 Ga0496104_0171562 Ga0496104_0171562_1142_1669 175
393 3300048908 Ga0496105_0117685 Ga0496105_0117685_1632_2159 175
394 3300048910 Ga0496107_0236513 Ga0496107_0236513_765_1292 175
395 3300048912 Ga0496109_0838526 Ga0496109_0838526_43_570 175
396 3300048917 Ga0496114_0202003 Ga0496114_0202003_1174_1701 175
397 3300048918 Ga0496115_0246265 Ga0496115_0246265_780_1307 175
398 3300048918 Ga0496115_0770043 Ga0496115_0770043_175_702 175
399 3300048920 Ga0496117_0226381 Ga0496117_0226381_100_627 175
400 3300048921 Ga0496118_0013636 Ga0496118_0013636_5514_6041 175
401 3300048921 Ga0496118_0148855 Ga0496118_0148855_594_1121 175
402 3300048924 Ga0496121_0003416 Ga0496121_0003416_12464_12991 175
403 3300048924 Ga0496121_0008989 Ga0496121_0008989_1979_2506 175
404 3300048924 Ga0496121_0039120 Ga0496121_0039120_2853_3380 175
405 3300048924 Ga0496121_0772841 Ga0496121_0772841_13_540 175
406 3300048929 Ga0496126_0000102 Ga0496126_0000102_53392_53919 175
407 3300048929 Ga0496126_0050028 Ga0496126_0050028_1647_2174 175
408 3300049460 Ga0495682_0053415 Ga0495682_0053415_464_991 175
409 3300050490 nmdc:mga03n38_342428_c1 nmdc:mga03n38_342428_c1_249_788 175
410 3300050493 nmdc:mga0k408_33593_c1 nmdc:mga0k408_33593_c1_1932_2471 175
411 3300050493 nmdc:mga0k408_70844_c1 nmdc:mga0k408_70844_c1_749_1288 175
412 3300050496 nmdc:mga07m45_12800_c1 nmdc:mga07m45_12800_c1_721_1260 175
413 3300053079 Ga0500610_0000061 Ga0500610_0000061_29441_29968 175
414 3300053087 Ga0500643_005993 Ga0500643_005993_4156_4683 175
415 3300053108 Ga0500562_006267 Ga0500562_006267_1515_2042 175
416 3300053141 Ga0500574_001470 Ga0500574_001470_2872_3399 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

54

165

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nz1-assembly1.cif.gz_B respiratory complex i from escherichia coli - focused refinement of cytoplasmic arm 0.8923 48 169
6cfw-assembly1.cif.gz_J cryoem structure of a respiratory membrane-bound hydrogenase 0.8816 37 169
7q5y-assembly4.cif.gz_X structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus 0.8509 43 170
7p7e-assembly1.cif.gz_B complex i from e. coli, ddm/lmng-purified, apo, resting state 0.8407 34 167
7p7k-assembly1.cif.gz_B complex i from e. coli, ddm/lmng-purified, with dq, resting state 0.836 35 175
ID Description Score Start End Superfamily
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8923 43 168 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8816 37 169 3.40.50.12280
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8704 39 168 3.40.50.12280
af_P77668_14_171_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8567 28 175 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8183 37 169 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A800BTY2-F1-model_v4 NADH-quinone oxidoreductase subunit B 0.9194 39 168 GO:0008137
GO:0046872
GO:0048038
GO:0051539
AF-A0A7C4PQD8-F1-model_v4 GNAT family N-acetyltransferase 0.9188 42 168 GO:0016747
GO:0051539
AF-A0A1I5QKT0-F1-model_v4 Ech hydrogenase subunit C 0.9178 42 168 GO:0051539
AF-A0A1V6DNL1-F1-model_v4 deleted 0.9171 42 168
AF-A0A1Y4DPS5-F1-model_v4 NADH-quinone oxidoreductase subunit B 0.9162 42 168 GO:0051539

Feature Viewer

pLDDT pTM Quality
84.47 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map