F438892

General Info

Members Datasets Scaffolds Average Seq Length
416 269 832 165

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0097216|Ga0495625_0097216_673_1266
Length 197
Sequence VVIAALYAACPKRAVGGATSGRCENRGMSSPTPFTLRSAELRDVGAIVGLIRELAEFEKLTHLLQVTPEKLRPQLFGERPAAEALVAELGDGKGGGEVVAFALFFTNFSTFLAQPGLYLEDLYVKPEQRGLGIGKALLTRLARLAVERDYGRFEWSVLDWNENAIRFYKSMGAAVMTEWQICRVTGDALAQLGAPTA

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
244 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
245 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
248 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
265 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
269 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.24
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 0.48
Rhizoplane 2.88
Rhizosphere 75.48
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0097216 3300046660 Bacteria 2027
2 rootH1_10059773 3300003316 Bacteria 1138
3 rootL2_10025627 3300003322 Bacteria 2207
4 Ga0055524_1000253 3300003775 Bacteria 55038
5 Ga0055530_10000982 3300003791 Bacteria 22949
6 Ga0055530_10009524 3300003791 Bacteria 3720
7 Ga0055540_1000011 3300003792 Bacteria 282927
8 Ga0055531_10005065 3300003794 Bacteria 7796
9 Ga0065703_1020118 3300005272 Bacteria 2000
10 Ga0065704_10152176 3300005289 Bacteria 1420
11 Ga0065712_10074940 3300005290 Bacteria 3975
12 Ga0070676_10357142 3300005328 Bacteria 1006
13 Ga0070670_100021819 3300005331 Bacteria 5507
14 Ga0070670_100107470 3300005331 Bacteria 2404
15 Ga0068869_100347679 3300005334 Bacteria 1208
16 Ga0068869_100664170 3300005334 Bacteria 886
17 Ga0070666_10165510 3300005335 Bacteria 1547
18 Ga0068868_100132374 3300005338 Bacteria 2041
19 Ga0068868_100268862 3300005338 Bacteria 1440
20 Ga0070660_100110526 3300005339 Bacteria 2186
21 Ga0070689_100322723 3300005340 Bacteria 1290
22 Ga0070661_100060520 3300005344 Bacteria 2778
23 Ga0070692_10008718 3300005345 Bacteria 4536
24 Ga0070668_100012494 3300005347 Bacteria 6325
25 Ga0070669_100040534 3300005353 Bacteria 3385
26 Ga0070669_100130738 3300005353 Bacteria 1925
27 Ga0070675_100077274 3300005354 Bacteria 2771
28 Ga0070675_100643083 3300005354 Bacteria 963
29 Ga0070671_100014529 3300005355 Bacteria 6365
30 Ga0070671_100172053 3300005355 Bacteria 1832
31 Ga0070674_100172055 3300005356 Bacteria 1652
32 Ga0070674_100245888 3300005356 Bacteria 1403
33 Ga0070673_100241096 3300005364 Unclassified 1572
34 Ga0070659_100001171 3300005366 Bacteria 19137
35 Ga0070667_100001979 3300005367 Bacteria 18163
36 Ga0070667_100015955 3300005367 Bacteria 6215
37 Ga0070667_100063828 3300005367 Bacteria 3123
38 Ga0070667_100465274 3300005367 Bacteria 1157
39 Ga0070709_10083056 3300005434 Bacteria 2094
40 Ga0070709_10230963 3300005434 Bacteria 1324
41 Ga0070709_10830010 3300005434 Bacteria 727
42 Ga0070714_100208706 3300005435 Bacteria 1789
43 Ga0070713_100094913 3300005436 Bacteria 2572
44 Ga0070713_100147689 3300005436 Bacteria 2088
45 Ga0070710_10028612 3300005437 Bacteria 2982
46 Ga0070711_100004147 3300005439 Bacteria 8519
47 Ga0070711_100078163 3300005439 Bacteria 2350
48 Ga0070711_100278536 3300005439 Bacteria 1322
49 Ga0070700_100087103 3300005441 Bacteria 2029
50 Ga0070708_100000858 3300005445 Bacteria 22895
51 Ga0070708_100001514 3300005445 Bacteria 17745
52 Ga0070708_100187782 3300005445 Unclassified 1933
53 Ga0070663_100036319 3300005455 Bacteria 3423
54 Ga0070663_100472533 3300005455 Bacteria 1037
55 Ga0070663_100968681 3300005455 Bacteria 738
56 Ga0070678_100611727 3300005456 Bacteria 974
57 Ga0070662_100212997 3300005457 Bacteria 1538
58 Ga0070662_100340843 3300005457 Bacteria 1226
59 Ga0068867_100000083 3300005459 Bacteria 58784
60 Ga0068867_100001775 3300005459 Bacteria 15011
61 Ga0068867_100253235 3300005459 Bacteria 1432
62 Ga0070706_100000297 3300005467 Bacteria 60441
63 Ga0070706_100571264 3300005467 Bacteria 1051
64 Ga0070707_100007490 3300005468 Bacteria 10136
65 Ga0070707_100714738 3300005468 Bacteria 965
66 Ga0070698_100009178 3300005471 Bacteria 10618
67 Ga0070698_100094834 3300005471 Bacteria 2962
68 Ga0070699_100000157 3300005518 Bacteria 64279
69 Ga0070699_100040690 3300005518 Bacteria 4024
70 Ga0070684_100119436 3300005535 Bacteria 2371
71 Ga0070697_100002860 3300005536 Bacteria 13274
72 Ga0070697_100030671 3300005536 Bacteria 4319
73 Ga0070697_100528894 3300005536 Bacteria 1033
74 Ga0068853_100232994 3300005539 Bacteria 1685
75 Ga0068853_101135114 3300005539 Bacteria 754
76 Ga0070672_100767535 3300005543 Bacteria 847
77 Ga0070665_100010342 3300005548 Bacteria 9440
78 Ga0070665_100116422 3300005548 Bacteria 2675
79 Ga0070665_100160392 3300005548 Bacteria 2251
80 Ga0070664_100011088 3300005564 Bacteria 7309
81 Ga0070664_100126343 3300005564 Bacteria 2244
82 Ga0068852_100430617 3300005616 Bacteria 1303
83 Ga0068859_100092348 3300005617 Bacteria 3078
84 Ga0068859_100267465 3300005617 Bacteria 1801
85 Ga0068859_100331237 3300005617 Bacteria 1617
86 Ga0068864_100005843 3300005618 Bacteria 10091
87 Ga0068866_10161217 3300005718 Bacteria 1308
88 Ga0068861_100002440 3300005719 Bacteria 12125
89 Ga0068861_100151182 3300005719 Bacteria 1905
90 Ga0068851_10173714 3300005834 Bacteria 1190
91 Ga0068863_100021181 3300005841 Bacteria 6206
92 Ga0068863_100021959 3300005841 Bacteria 6090
93 Ga0068863_100883110 3300005841 Bacteria 894
94 Ga0068858_101100150 3300005842 Unclassified 780
95 Ga0068860_100000968 3300005843 Bacteria 31798
96 Ga0068860_100020980 3300005843 Bacteria 6330
97 Ga0068860_100270319 3300005843 Bacteria 1659
98 Ga0068860_100307269 3300005843 Bacteria 1555
99 Ga0068862_100085073 3300005844 Bacteria 2748
100 Ga0068862_100136765 3300005844 Bacteria 2172
101 Ga0081455_10544392 3300005937 Bacteria 769
102 Ga0070717_10064620 3300006028 Bacteria 3040
103 Ga0070717_10102413 3300006028 Bacteria 2433
104 Ga0070717_11125163 3300006028 Bacteria 715
105 Ga0075364_10000016 3300006051 Bacteria 57197
106 Ga0075364_10013831 3300006051 Bacteria 4972
107 Ga0070716_100805133 3300006173 Bacteria 728
108 Ga0070712_100885785 3300006175 Bacteria 769
109 Ga0075362_10400235 3300006177 Bacteria 692
110 Ga0075367_10017004 3300006178 Bacteria 3984
111 Ga0075367_10152967 3300006178 Unclassified 1432
112 Ga0075369_10009696 3300006186 Bacteria 3748
113 Ga0075366_10015111 3300006195 Bacteria 4418
114 Ga0075366_10367325 3300006195 Bacteria 884
115 Ga0075370_10295191 3300006353 Bacteria 963
116 Ga0068871_100180209 3300006358 Bacteria 1815
117 Ga0068871_100526508 3300006358 Bacteria 1068
118 Ga0068871_100780147 3300006358 Bacteria 880
119 Ga0075433_10733365 3300006852 Bacteria 865
120 Ga0075434_100336260 3300006871 Bacteria 1531
121 Ga0068865_100038836 3300006881 Bacteria 3225
122 Ga0068865_100063255 3300006881 Bacteria 2600
123 Ga0097620_100092348 3300006931 Bacteria 3078
124 Ga0097620_100145620 3300006931 Bacteria 2444
125 Ga0097620_100267477 3300006931 Bacteria 1801
126 Ga0097620_100331232 3300006931 Bacteria 1617
127 Ga0079104_1000465 3300006946 Bacteria 45434
128 Ga0075435_100938187 3300007076 Unclassified 755
129 Ga0099794_10019424 3300007265 Bacteria 3061
130 Ga0099794_10055449 3300007265 Bacteria 1915
131 Ga0099795_10223702 3300007788 Unclassified 802
132 Ga0105251_10004843 3300009011 Bacteria 8987
133 Ga0105240_10488834 3300009093 Bacteria 1371
134 Ga0105245_10037203 3300009098 Bacteria 4327
135 Ga0105245_10206358 3300009098 Bacteria 1889
136 Ga0105245_12800354 3300009098 Unclassified 540
137 Ga0105247_10348290 3300009101 Bacteria 1041
138 Ga0105243_10000919 3300009148 Bacteria 27591
139 Ga0105243_10198911 3300009148 Bacteria 1756
140 Ga0105242_12233663 3300009176 Unclassified 593
141 Ga0105248_10035409 3300009177 Bacteria 5584
142 Ga0105237_10790542 3300009545 Bacteria 956
143 Ga0105238_10584781 3300009551 Bacteria 1123
144 Ga0105238_10825648 3300009551 Bacteria 943
145 Ga0105239_10352244 3300010375 Bacteria 1662
146 Ga0105239_10930804 3300010375 Bacteria 998
147 Ga0157370_10142438 3300013104 Bacteria 2234
148 Ga0157369_11363140 3300013105 Bacteria 722
149 Ga0157374_10181268 3300013296 Bacteria 2057
150 Ga0157374_10947388 3300013296 Bacteria 879
151 Ga0157378_10154991 3300013297 Bacteria 2137
152 Ga0157378_10706261 3300013297 Bacteria 1028
153 Ga0163162_10002126 3300013306 Bacteria 18608
154 Ga0163162_10050639 3300013306 Bacteria 4165
155 Ga0157372_10230675 3300013307 Bacteria 2146
156 Ga0157375_10009646 3300013308 Bacteria 8485
157 Ga0157375_10270243 3300013308 Bacteria 1862
158 Ga0157375_10620708 3300013308 Unclassified 1239
159 Ga0157375_10767225 3300013308 Unclassified 1115
160 Ga0157380_10058463 3300014326 Bacteria 3073
161 Ga0157380_10139080 3300014326 Bacteria 2083
162 Ga0157377_10000104 3300014745 Bacteria 58794
163 Ga0157379_10038612 3300014968 Bacteria 4259
164 Ga0157379_10087314 3300014968 Bacteria 2797
165 Ga0157376_10224851 3300014969 Bacteria 1740
166 Ga0163161_10034618 3300017792 Bacteria 3614
167 Ga0163161_10182921 3300017792 Bacteria 1608
168 Ga0213872_10000012 3300021361 Bacteria 191291
169 Ga0213872_10090878 3300021361 Bacteria 1366
170 Ga0213876_10124884 3300021384 Bacteria 1367
171 Ga0213876_10378139 3300021384 Bacteria 753
172 Ga0224712_10030894 3300022467 Bacteria 1938
173 Ga0209759_1047772 3300025256 Bacteria 682
174 Ga0209565_1007253 3300025263 Bacteria 3008
175 Ga0209675_1037516 3300025291 Bacteria 1088
176 Ga0209050_1000532 3300025298 Bacteria 63063
177 Ga0209050_1026272 3300025298 Bacteria 1955
178 Ga0209256_1000113 3300025299 Bacteria 175296
179 Ga0209051_1000020 3300025303 Bacteria 508628
180 Ga0209257_1000085 3300025304 Bacteria 291117
181 Ga0207697_10085825 3300025315 Bacteria 1330
182 Ga0207656_10373691 3300025321 Bacteria 714
183 Ga0207713_1014656 3300025735 Bacteria 4060
184 Ga0207692_10274796 3300025898 Bacteria 1017
185 Ga0207642_10081761 3300025899 Bacteria 1571
186 Ga0207680_10471553 3300025903 Bacteria 892
187 Ga0207647_10077094 3300025904 Bacteria 2004
188 Ga0207685_10126635 3300025905 Bacteria 1128
189 Ga0207699_10020384 3300025906 Bacteria 3553
190 Ga0207645_10388672 3300025907 Bacteria 937
191 Ga0207645_10814497 3300025907 Bacteria 635
192 Ga0207684_10000081 3300025910 Bacteria 178619
193 Ga0207684_10006860 3300025910 Bacteria 10309
194 Ga0207707_10003161 3300025912 Bacteria 14619
195 Ga0207695_10273296 3300025913 Bacteria 1585
196 Ga0207695_10280672 3300025913 Bacteria 1559
197 Ga0207695_10804516 3300025913 Bacteria 820
198 Ga0207671_10078747 3300025914 Bacteria 2469
199 Ga0207693_10071644 3300025915 Bacteria 2713
200 Ga0207693_10851720 3300025915 Bacteria 701
201 Ga0207663_10109719 3300025916 Bacteria 1870
202 Ga0207663_10765421 3300025916 Bacteria 767
203 Ga0207660_10032857 3300025917 Bacteria 3584
204 Ga0207652_10037233 3300025921 Bacteria 4117
205 Ga0207652_10828351 3300025921 Bacteria 820
206 Ga0207646_10001212 3300025922 Bacteria 32439
207 Ga0207681_10002314 3300025923 Bacteria 12113
208 Ga0207681_10081288 3300025923 Bacteria 2288
209 Ga0207681_10562728 3300025923 Bacteria 939
210 Ga0207681_10603687 3300025923 Bacteria 907
211 Ga0207694_10044446 3300025924 Bacteria 3430
212 Ga0207694_10851963 3300025924 Bacteria 770
213 Ga0207650_10035313 3300025925 Bacteria 3629
214 Ga0207659_10066651 3300025926 Bacteria 2613
215 Ga0207659_10211778 3300025926 Bacteria 1553
216 Ga0207687_10327848 3300025927 Bacteria 1241
217 Ga0207700_10138396 3300025928 Bacteria 1997
218 Ga0207700_11207083 3300025928 Bacteria 675
219 Ga0207664_10037157 3300025929 Bacteria 3767
220 Ga0207644_10008780 3300025931 Bacteria 6617
221 Ga0207644_10607651 3300025931 Unclassified 908
222 Ga0207690_10002213 3300025932 Bacteria 11851
223 Ga0207706_10358987 3300025933 Bacteria 1266
224 Ga0207706_10446995 3300025933 Bacteria 1118
225 Ga0207709_10000675 3300025935 Bacteria 27560
226 Ga0207709_10129773 3300025935 Bacteria 1716
227 Ga0207669_10124418 3300025937 Bacteria 1758
228 Ga0207669_10352230 3300025937 Bacteria 1138
229 Ga0207704_10005770 3300025938 Bacteria 5724
230 Ga0207691_10132070 3300025940 Bacteria 2204
231 Ga0207691_10383678 3300025940 Bacteria 1199
232 Ga0207711_10019842 3300025941 Bacteria 5603
233 Ga0207689_10783035 3300025942 Bacteria 805
234 Ga0207679_10000825 3300025945 Bacteria 19928
235 Ga0207679_10104227 3300025945 Bacteria 2225
236 Ga0207679_10882340 3300025945 Bacteria 818
237 Ga0207667_10209765 3300025949 Bacteria 1997
238 Ga0207651_10432448 3300025960 Bacteria 1126
239 Ga0207712_10002801 3300025961 Bacteria 11158
240 Ga0207668_10054611 3300025972 Bacteria 2773
241 Ga0207658_10000889 3300025986 Bacteria 24893
242 Ga0207658_10010462 3300025986 Bacteria 6300
243 Ga0207658_10065286 3300025986 Bacteria 2733
244 Ga0207658_10560024 3300025986 Bacteria 1024
245 Ga0207677_10138929 3300026023 Bacteria 1857
246 Ga0207677_10570579 3300026023 Bacteria 989
247 Ga0207703_11977524 3300026035 Bacteria 559
248 Ga0207639_10198469 3300026041 Bacteria 1719
249 Ga0207639_10429898 3300026041 Bacteria 1195
250 Ga0207678_10004769 3300026067 Bacteria 12168
251 Ga0207678_10096872 3300026067 Bacteria 2521
252 Ga0207678_10798823 3300026067 Bacteria 833
253 Ga0207708_10184420 3300026075 Bacteria 1658
254 Ga0207641_10065872 3300026088 Bacteria 3099
255 Ga0207641_10117668 3300026088 Bacteria 2366
256 Ga0207648_10000243 3300026089 Bacteria 58746
257 Ga0207648_10230221 3300026089 Bacteria 1648
258 Ga0207676_10260081 3300026095 Bacteria 1567
259 Ga0207675_100002727 3300026118 Bacteria 17402
260 Ga0207675_100158426 3300026118 Bacteria 2158
261 Ga0207675_100386458 3300026118 Bacteria 1377
262 Ga0207683_10095132 3300026121 Bacteria 2656
263 Ga0207698_10094053 3300026142 Bacteria 2463
264 Ga0207698_10356231 3300026142 Bacteria 1384
265 Ga0209281_1000195 3300027111 Bacteria 139144
266 Ga0209588_1060381 3300027671 Bacteria 1226
267 Ga0268266_10007968 3300028379 Bacteria 9472
268 Ga0268266_10077823 3300028379 Bacteria 2885
269 Ga0268266_10122509 3300028379 Bacteria 2315
270 Ga0268266_10336048 3300028379 Unclassified 1417
271 Ga0268265_10017063 3300028380 Bacteria 5002
272 Ga0268265_10069284 3300028380 Bacteria 2738
273 Ga0268265_10111954 3300028380 Bacteria 2230
274 Ga0268265_10154859 3300028380 Bacteria 1938
275 Ga0268264_10001679 3300028381 Bacteria 20387
276 Ga0268264_10019102 3300028381 Bacteria 5603
277 Ga0268264_10298324 3300028381 Bacteria 1516
278 Ga0265319_1000567 3300028563 Bacteria 24971
279 Ga0307517_10003893 3300028786 Bacteria 23138
280 Ga0307515_10003241 3300028794 Bacteria 34447
281 Ga0307515_10098462 3300028794 Bacteria 3561
282 Ga0307512_10048750 3300030522 Bacteria 3425
283 Ga0307513_10021286 3300031456 Bacteria 7658
284 Ga0307513_10164826 3300031456 Bacteria 2102
285 Ga0307513_10229462 3300031456 Bacteria 1670
286 Ga0307513_10266735 3300031456 Bacteria 1498
287 Ga0307509_10001216 3300031507 Bacteria 43713
288 Ga0307509_10033595 3300031507 Bacteria 5646
289 Ga0307509_10199632 3300031507 Bacteria 1839
290 Ga0307408_100225720 3300031548 Bacteria 1531
291 Ga0307508_10002246 3300031616 Bacteria 20589
292 Ga0307508_10016234 3300031616 Bacteria 6778
293 Ga0307508_10135789 3300031616 Bacteria 2063
294 Ga0316579_10442190 3300031691 Bacteria 629
295 Ga0316576_10348387 3300031727 Unclassified 1102
296 Ga0316578_10013821 3300031728 Unclassified 4292
297 Ga0316578_10266212 3300031728 Bacteria 1027
298 Ga0307518_10355692 3300031838 Bacteria 849
299 Ga0307507_10139903 3300033179 Bacteria 1860
300 Ga0307510_10001933 3300033180 Bacteria 23281
301 Ga0373928_0107706 3300035084 Bacteria 734
302 Ga0373951_0128255 3300035091 Bacteria 696
303 Ga0373932_0110153 3300035112 Bacteria 906
304 Ga0373939_0270109 3300035114 Bacteria 668
305 Ga0373943_0021072 3300035170 Bacteria 3010
306 Ga0373931_0047357 3300035691 Bacteria 2275
307 Ga0373931_0083298 3300035691 Bacteria 1769
308 Ga0316582_0292035 3300036647 Bacteria 1120
309 Ga0373925_0027997 3300037068 Bacteria 4127
310 Ga0395898_0774529 3300037466 Bacteria 900
311 Ga0395905_0229819 3300037471 Bacteria 1735
312 Ga0436364_0016895 3300037853 Bacteria 788
313 Ga0436364_0107399 3300037853 Bacteria 2235
314 Ga0436364_1097852 3300037853 Bacteria 6052
315 Ga0395901_0140405 3300038443 Unclassified 2539
316 Ga0436365_0117846 3300039437 Bacteria 1197
317 Ga0436365_0470530 3300039437 Bacteria 760
318 Ga0436365_0632622 3300039437 Bacteria 3496
319 Ga0436365_0716278 3300039437 Bacteria 6336
320 Ga0436365_1825276 3300039437 Bacteria 3153
321 Ga0436361_0092421 3300039447 Bacteria 1563
322 Ga0436361_0351372 3300039447 Bacteria 183069
323 Ga0451839_0022034 3300041496 Bacteria 791
324 Ga0451839_0897551 3300041496 Bacteria 1030
325 Ga0451577_0071829 3300042876 Bacteria 3087
326 Ga0451577_0199448 3300042876 Bacteria 1806
327 Ga0453683_0005356 3300044673 Bacteria 8963
328 Ga0466963_0114083 3300044694 Unclassified 1856
329 Ga0451576_0004673 3300045051 Bacteria 17635
330 Ga0451576_0096098 3300045051 Bacteria 3082
331 Ga0451576_2255810 3300045051 Unclassified 558
332 Ga0495617_168373 3300046452 Bacteria 693
333 Ga0495592_0000250 3300046454 Bacteria 46017
334 Ga0495603_0086979 3300046455 Bacteria 1829
335 Ga0495638_0246327 3300046460 Bacteria 987
336 Ga0495638_0449123 3300046460 Bacteria 659
337 Ga0495639_0407983 3300046475 Bacteria 687
338 Ga0495632_0196061 3300046519 Bacteria 921
339 Ga0495648_0056022 3300046524 Bacteria 2374
340 Ga0495586_0154422 3300046535 Bacteria 1292
341 Ga0495621_0082167 3300046539 Bacteria 1203
342 Ga0495622_0157036 3300046557 Bacteria 1027
343 Ga0495668_0064765 3300046616 Bacteria 2012
344 Ga0495658_0087148 3300046683 Bacteria 1843
345 Ga0495624_0012823 3300046690 Bacteria 5722
346 Ga0495671_0450769 3300046692 Bacteria 615
347 Ga0495604_0109906 3300047317 Bacteria 2012
348 Ga0495676_0082797 3300047321 Bacteria 2427
349 Ga0495593_0032886 3300047673 Bacteria 2826
350 Ga0496100_0830938 3300048903 Unclassified 724
351 Ga0496101_1187388 3300048904 Bacteria 598
352 Ga0496102_0169289 3300048905 Bacteria 2057
353 Ga0496103_0026064 3300048906 Bacteria 3537
354 Ga0496109_0442330 3300048912 Unclassified 1228
355 Ga0496109_0537019 3300048912 Bacteria 1103
356 Ga0496109_1523468 3300048912 Bacteria 603
357 Ga0496111_0324183 3300048914 Bacteria 1141
358 Ga0496112_0034050 3300048915 Bacteria 4956
359 Ga0496112_0693905 3300048915 Unclassified 946
360 Ga0496113_0195535 3300048916 Bacteria 1606
361 Ga0496114_0422497 3300048917 Bacteria 1181
362 Ga0496116_0057536 3300048919 Bacteria 2541
363 Ga0496117_0028114 3300048920 Bacteria 4359
364 Ga0496117_0249202 3300048920 Bacteria 970
365 Ga0496118_0057690 3300048921 Bacteria 2908
366 Ga0496118_0118922 3300048921 Bacteria 1729
367 Ga0496118_0149080 3300048921 Bacteria 1467
368 Ga0496119_0216641 3300048922 Bacteria 982
369 Ga0496121_0018402 3300048924 Bacteria 7045
370 Ga0496122_0389991 3300048925 Bacteria 711
371 Ga0496123_0151904 3300048926 Bacteria 1248
372 Ga0496124_0394600 3300048927 Bacteria 962
373 Ga0496124_0604567 3300048927 Bacteria 712
374 Ga0496125_0032626 3300048928 Bacteria 4623
375 Ga0496126_0007639 3300048929 Bacteria 11802
376 Ga0496126_0026253 3300048929 Bacteria 5587
377 Ga0501303_014040 3300049526 Bacteria 788
378 Ga0501040_0212759 3300049576 Unclassified 1375
379 Ga0501070_0016140 3300049586 Bacteria 6277
380 Ga0501072_0054042 3300049588 Bacteria 3164
381 Ga0501073_0065292 3300049589 Bacteria 2538
382 Ga0501074_0057588 3300049590 Bacteria 2799
383 Ga0501076_0201267 3300049592 Unclassified 1626
384 Ga0501198_114382 3300049649 Bacteria 562
385 Ga0501206_034329 3300049653 Bacteria 764
386 Ga0501207_020677 3300049654 Bacteria 1052
387 Ga0501080_0052803 3300049742 Bacteria 3783
388 Ga0501262_012615 3300049759 Bacteria 1082
389 Ga0501265_007359 3300049762 Bacteria 1295
390 Ga0501035_1141456 3300049822 Bacteria 607
391 Ga0501044_0103929 3300049823 Bacteria 2855
392 nmdc:mga03683_332848_c1 3300050489 Bacteria 716
393 nmdc:mga00v17_11116_c1 3300050491 Bacteria 4938
394 nmdc:mga00v17_3324_c1 3300050491 Bacteria 8293
395 nmdc:mga00v17_463521_c1 3300050491 Bacteria 822
396 nmdc:mga0k408_53262_c1 3300050493 Bacteria 2345
397 nmdc:mga06z11_124012_c1 3300050494 Unclassified 1444
398 nmdc:mga06z11_34070_c1 3300050494 Bacteria 2496
399 nmdc:mga07m45_29179_c1 3300050496 Bacteria 3049
400 nmdc:mga07m45_420561_c1 3300050496 Bacteria 775
401 nmdc:mga07m45_69774_c1 3300050496 Bacteria 1998
402 nmdc:mga0n895_735126_c1 3300050512 Bacteria 981
403 nmdc:mga0rr50_565433_c1 3300050513 Unclassified 968
404 nmdc:mga0sz30_74208_c1 3300050516 Bacteria 1467
405 Ga0500646_0175626 3300053090 Bacteria 723
406 Ga0500583_0106305 3300053092 Bacteria 1379
407 Ga0500583_0295289 3300053092 Bacteria 793
408 Ga0500641_0003214 3300053096 Bacteria 5774
409 Ga0500652_110660 3300053131 Bacteria 1148
410 Ga0500616_0000726 3300053153 Bacteria 38087
411 Ga0500619_193855 3300053154 Bacteria 683
412 Ga0500611_034855 3300053727 Bacteria 1068
413 Ga0501082_0416500 3300060353 Unclassified 1173
414 Ga0530510_0266496 3300061734 Unclassified 1278
415 2644301867 2643221654 Bacteria 5273570
416 2919139137 2919138771 Bacteria 5281312
417 Ga0495625_0097216
418 rootH1_10059773
419 rootL2_10025627
420 Ga0055524_1000253
421 Ga0055530_10000982
422 Ga0055530_10009524
423 Ga0055540_1000011
424 Ga0055531_10005065
425 Ga0065703_1020118
426 Ga0065704_10152176
427 Ga0065712_10074940
428 Ga0070676_10357142
429 Ga0070670_100021819
430 Ga0070670_100107470
431 Ga0068869_100347679
432 Ga0068869_100664170
433 Ga0070666_10165510
434 Ga0068868_100132374
435 Ga0068868_100268862
436 Ga0070660_100110526
437 Ga0070689_100322723
438 Ga0070661_100060520
439 Ga0070692_10008718
440 Ga0070668_100012494
441 Ga0070669_100040534
442 Ga0070669_100130738
443 Ga0070675_100077274
444 Ga0070675_100643083
445 Ga0070671_100014529
446 Ga0070671_100172053
447 Ga0070674_100172055
448 Ga0070674_100245888
449 Ga0070673_100241096
450 Ga0070659_100001171
451 Ga0070667_100001979
452 Ga0070667_100015955
453 Ga0070667_100063828
454 Ga0070667_100465274
455 Ga0070709_10083056
456 Ga0070709_10230963
457 Ga0070709_10830010
458 Ga0070714_100208706
459 Ga0070713_100094913
460 Ga0070713_100147689
461 Ga0070710_10028612
462 Ga0070711_100004147
463 Ga0070711_100078163
464 Ga0070711_100278536
465 Ga0070700_100087103
466 Ga0070708_100000858
467 Ga0070708_100001514
468 Ga0070708_100187782
469 Ga0070663_100036319
470 Ga0070663_100472533
471 Ga0070663_100968681
472 Ga0070678_100611727
473 Ga0070662_100212997
474 Ga0070662_100340843
475 Ga0068867_100000083
476 Ga0068867_100001775
477 Ga0068867_100253235
478 Ga0070706_100000297
479 Ga0070706_100571264
480 Ga0070707_100007490
481 Ga0070707_100714738
482 Ga0070698_100009178
483 Ga0070698_100094834
484 Ga0070699_100000157
485 Ga0070699_100040690
486 Ga0070684_100119436
487 Ga0070697_100002860
488 Ga0070697_100030671
489 Ga0070697_100528894
490 Ga0068853_100232994
491 Ga0068853_101135114
492 Ga0070672_100767535
493 Ga0070665_100010342
494 Ga0070665_100116422
495 Ga0070665_100160392
496 Ga0070664_100011088
497 Ga0070664_100126343
498 Ga0068852_100430617
499 Ga0068859_100092348
500 Ga0068859_100267465
501 Ga0068859_100331237
502 Ga0068864_100005843
503 Ga0068866_10161217
504 Ga0068861_100002440
505 Ga0068861_100151182
506 Ga0068851_10173714
507 Ga0068863_100021181
508 Ga0068863_100021959
509 Ga0068863_100883110
510 Ga0068858_101100150
511 Ga0068860_100000968
512 Ga0068860_100020980
513 Ga0068860_100270319
514 Ga0068860_100307269
515 Ga0068862_100085073
516 Ga0068862_100136765
517 Ga0081455_10544392
518 Ga0070717_10064620
519 Ga0070717_10102413
520 Ga0070717_11125163
521 Ga0075364_10000016
522 Ga0075364_10013831
523 Ga0070716_100805133
524 Ga0070712_100885785
525 Ga0075362_10400235
526 Ga0075367_10017004
527 Ga0075367_10152967
528 Ga0075369_10009696
529 Ga0075366_10015111
530 Ga0075366_10367325
531 Ga0075370_10295191
532 Ga0068871_100180209
533 Ga0068871_100526508
534 Ga0068871_100780147
535 Ga0075433_10733365
536 Ga0075434_100336260
537 Ga0068865_100038836
538 Ga0068865_100063255
539 Ga0097620_100092348
540 Ga0097620_100145620
541 Ga0097620_100267477
542 Ga0097620_100331232
543 Ga0079104_1000465
544 Ga0075435_100938187
545 Ga0099794_10019424
546 Ga0099794_10055449
547 Ga0099795_10223702
548 Ga0105251_10004843
549 Ga0105240_10488834
550 Ga0105245_10037203
551 Ga0105245_10206358
552 Ga0105245_12800354
553 Ga0105247_10348290
554 Ga0105243_10000919
555 Ga0105243_10198911
556 Ga0105242_12233663
557 Ga0105248_10035409
558 Ga0105237_10790542
559 Ga0105238_10584781
560 Ga0105238_10825648
561 Ga0105239_10352244
562 Ga0105239_10930804
563 Ga0157370_10142438
564 Ga0157369_11363140
565 Ga0157374_10181268
566 Ga0157374_10947388
567 Ga0157378_10154991
568 Ga0157378_10706261
569 Ga0163162_10002126
570 Ga0163162_10050639
571 Ga0157372_10230675
572 Ga0157375_10009646
573 Ga0157375_10270243
574 Ga0157375_10620708
575 Ga0157375_10767225
576 Ga0157380_10058463
577 Ga0157380_10139080
578 Ga0157377_10000104
579 Ga0157379_10038612
580 Ga0157379_10087314
581 Ga0157376_10224851
582 Ga0163161_10034618
583 Ga0163161_10182921
584 Ga0213872_10000012
585 Ga0213872_10090878
586 Ga0213876_10124884
587 Ga0213876_10378139
588 Ga0224712_10030894
589 Ga0209759_1047772
590 Ga0209565_1007253
591 Ga0209675_1037516
592 Ga0209050_1000532
593 Ga0209050_1026272
594 Ga0209256_1000113
595 Ga0209051_1000020
596 Ga0209257_1000085
597 Ga0207697_10085825
598 Ga0207656_10373691
599 Ga0207713_1014656
600 Ga0207692_10274796
601 Ga0207642_10081761
602 Ga0207680_10471553
603 Ga0207647_10077094
604 Ga0207685_10126635
605 Ga0207699_10020384
606 Ga0207645_10388672
607 Ga0207645_10814497
608 Ga0207684_10000081
609 Ga0207684_10006860
610 Ga0207707_10003161
611 Ga0207695_10273296
612 Ga0207695_10280672
613 Ga0207695_10804516
614 Ga0207671_10078747
615 Ga0207693_10071644
616 Ga0207693_10851720
617 Ga0207663_10109719
618 Ga0207663_10765421
619 Ga0207660_10032857
620 Ga0207652_10037233
621 Ga0207652_10828351
622 Ga0207646_10001212
623 Ga0207681_10002314
624 Ga0207681_10081288
625 Ga0207681_10562728
626 Ga0207681_10603687
627 Ga0207694_10044446
628 Ga0207694_10851963
629 Ga0207650_10035313
630 Ga0207659_10066651
631 Ga0207659_10211778
632 Ga0207687_10327848
633 Ga0207700_10138396
634 Ga0207700_11207083
635 Ga0207664_10037157
636 Ga0207644_10008780
637 Ga0207644_10607651
638 Ga0207690_10002213
639 Ga0207706_10358987
640 Ga0207706_10446995
641 Ga0207709_10000675
642 Ga0207709_10129773
643 Ga0207669_10124418
644 Ga0207669_10352230
645 Ga0207704_10005770
646 Ga0207691_10132070
647 Ga0207691_10383678
648 Ga0207711_10019842
649 Ga0207689_10783035
650 Ga0207679_10000825
651 Ga0207679_10104227
652 Ga0207679_10882340
653 Ga0207667_10209765
654 Ga0207651_10432448
655 Ga0207712_10002801
656 Ga0207668_10054611
657 Ga0207658_10000889
658 Ga0207658_10010462
659 Ga0207658_10065286
660 Ga0207658_10560024
661 Ga0207677_10138929
662 Ga0207677_10570579
663 Ga0207703_11977524
664 Ga0207639_10198469
665 Ga0207639_10429898
666 Ga0207678_10004769
667 Ga0207678_10096872
668 Ga0207678_10798823
669 Ga0207708_10184420
670 Ga0207641_10065872
671 Ga0207641_10117668
672 Ga0207648_10000243
673 Ga0207648_10230221
674 Ga0207676_10260081
675 Ga0207675_100002727
676 Ga0207675_100158426
677 Ga0207675_100386458
678 Ga0207683_10095132
679 Ga0207698_10094053
680 Ga0207698_10356231
681 Ga0209281_1000195
682 Ga0209588_1060381
683 Ga0268266_10007968
684 Ga0268266_10077823
685 Ga0268266_10122509
686 Ga0268266_10336048
687 Ga0268265_10017063
688 Ga0268265_10069284
689 Ga0268265_10111954
690 Ga0268265_10154859
691 Ga0268264_10001679
692 Ga0268264_10019102
693 Ga0268264_10298324
694 Ga0265319_1000567
695 Ga0307517_10003893
696 Ga0307515_10003241
697 Ga0307515_10098462
698 Ga0307512_10048750
699 Ga0307513_10021286
700 Ga0307513_10164826
701 Ga0307513_10229462
702 Ga0307513_10266735
703 Ga0307509_10001216
704 Ga0307509_10033595
705 Ga0307509_10199632
706 Ga0307408_100225720
707 Ga0307508_10002246
708 Ga0307508_10016234
709 Ga0307508_10135789
710 Ga0316579_10442190
711 Ga0316576_10348387
712 Ga0316578_10013821
713 Ga0316578_10266212
714 Ga0307518_10355692
715 Ga0307507_10139903
716 Ga0307510_10001933
717 Ga0373928_0107706
718 Ga0373951_0128255
719 Ga0373932_0110153
720 Ga0373939_0270109
721 Ga0373943_0021072
722 Ga0373931_0047357
723 Ga0373931_0083298
724 Ga0316582_0292035
725 Ga0373925_0027997
726 Ga0395898_0774529
727 Ga0395905_0229819
728 Ga0436364_0016895
729 Ga0436364_0107399
730 Ga0436364_1097852
731 Ga0395901_0140405
732 Ga0436365_0117846
733 Ga0436365_0470530
734 Ga0436365_0632622
735 Ga0436365_0716278
736 Ga0436365_1825276
737 Ga0436361_0092421
738 Ga0436361_0351372
739 Ga0451839_0022034
740 Ga0451839_0897551
741 Ga0451577_0071829
742 Ga0451577_0199448
743 Ga0453683_0005356
744 Ga0466963_0114083
745 Ga0451576_0004673
746 Ga0451576_0096098
747 Ga0451576_2255810
748 Ga0495617_168373
749 Ga0495592_0000250
750 Ga0495603_0086979
751 Ga0495638_0246327
752 Ga0495638_0449123
753 Ga0495639_0407983
754 Ga0495632_0196061
755 Ga0495648_0056022
756 Ga0495586_0154422
757 Ga0495621_0082167
758 Ga0495622_0157036
759 Ga0495668_0064765
760 Ga0495658_0087148
761 Ga0495624_0012823
762 Ga0495671_0450769
763 Ga0495604_0109906
764 Ga0495676_0082797
765 Ga0495593_0032886
766 Ga0496100_0830938
767 Ga0496101_1187388
768 Ga0496102_0169289
769 Ga0496103_0026064
770 Ga0496109_0442330
771 Ga0496109_0537019
772 Ga0496109_1523468
773 Ga0496111_0324183
774 Ga0496112_0034050
775 Ga0496112_0693905
776 Ga0496113_0195535
777 Ga0496114_0422497
778 Ga0496116_0057536
779 Ga0496117_0028114
780 Ga0496117_0249202
781 Ga0496118_0057690
782 Ga0496118_0118922
783 Ga0496118_0149080
784 Ga0496119_0216641
785 Ga0496121_0018402
786 Ga0496122_0389991
787 Ga0496123_0151904
788 Ga0496124_0394600
789 Ga0496124_0604567
790 Ga0496125_0032626
791 Ga0496126_0007639
792 Ga0496126_0026253
793 Ga0501303_014040
794 Ga0501040_0212759
795 Ga0501070_0016140
796 Ga0501072_0054042
797 Ga0501073_0065292
798 Ga0501074_0057588
799 Ga0501076_0201267
800 Ga0501198_114382
801 Ga0501206_034329
802 Ga0501207_020677
803 Ga0501080_0052803
804 Ga0501262_012615
805 Ga0501265_007359
806 Ga0501035_1141456
807 Ga0501044_0103929
808 nmdc:mga03683_332848_c1
809 nmdc:mga00v17_11116_c1
810 nmdc:mga00v17_3324_c1
811 nmdc:mga00v17_463521_c1
812 nmdc:mga0k408_53262_c1
813 nmdc:mga06z11_124012_c1
814 nmdc:mga06z11_34070_c1
815 nmdc:mga07m45_29179_c1
816 nmdc:mga07m45_420561_c1
817 nmdc:mga07m45_69774_c1
818 nmdc:mga0n895_735126_c1
819 nmdc:mga0rr50_565433_c1
820 nmdc:mga0sz30_74208_c1
821 Ga0500646_0175626
822 Ga0500583_0106305
823 Ga0500583_0295289
824 Ga0500641_0003214
825 Ga0500652_110660
826 Ga0500616_0000726
827 Ga0500619_193855
828 Ga0500611_034855
829 Ga0501082_0416500
830 Ga0530510_0266496
831 2644301867
832 2919139137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

108

184

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

100

181

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

46

173

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

80

172

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9543 4 166
2g3t-assembly1.cif.gz_A crystal structure of human spermidine/spermine n1-acetyltransferase (hssat) 0.9286 4 168
2b5g-assembly1.cif.gz_B wild type ssat- 1.7a structure 0.9271 5 168
2b3u-assembly1.cif.gz_B human spermine spermidine acetyltransferase k26r mutant 0.9269 5 168
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9252 5 166
ID Description Score Start End Superfamily
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9557 2 166 3.40.630.30
af_A4ICI2_5_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9365 4 158 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9252 5 166 3.40.630.30
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9248 1 166 3.40.630.30
af_A4ICI2_5_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9247 4 158 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2N6LCB9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9744 71 148 GO:0008080
AF-A0A837VEI5-F1-model_v4 deleted 0.9727 2 168
AF-A0A494XQ53-F1-model_v4 GNAT family N-acetyltransferase 0.9695 4 166 GO:0008080
AF-A0A3E0LN59-F1-model_v4 deleted 0.9695 4 170
AF-A0A1B7W3L4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9689 1 128 GO:0008080

Map