F439005

General Info

Members Datasets Scaffolds Average Seq Length
417 294 834 369

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100031005|Ga0068864_1000310053
Length 401
Sequence MLPVHWPLYRPEVRHYVARRLKMNHTPLFSTHQRLGGKLIEFGGWEMPVQYTSITDEHQAVRNAAGIFDISHMGEVRVSGESAASFLNQTLTNDIRKLSVGQGQYTLMCNERGGVVDDLYVYHLGAADYLLIINASRIEADVGWLGNRLASFPERLKVTLEDQSKSTAAVAVQGPRVKEFINQVFSGPALGGSQVGNPTDLKKNQVAKYRFEGAEVWVSRTGYTGEDGFEIVSPGKVIEPIWGRLMGAGGSFGLKPAGLGARDTLRTEACYPLYGHELDENTTPIEAGVGFFVSLDKGDFVGRPVLAEQKEKGVSKKLVAFKMAGRSAPPRPGYGVWSVGAGAACVGAVASGTQSPTLGAGIGLGYVPPQFAKAGTPVEIEIRGKRAGAVVVPKPFYRKAD

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
190 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
191 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
218 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
219 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
220 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
221 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
222 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
223 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
224 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
225 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
226 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
227 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
248 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
249 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
250 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
251 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
252 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
253 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
254 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
255 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
256 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
257 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
258 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
259 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
262 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
263 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
264 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
265 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
266 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
267 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
268 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
269 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
273 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
274 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
275 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
276 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
277 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
278 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
279 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.24
Rhizosphere 99.28
Stem 0
Stem Tuber 0
Unclassified 4.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100031005 3300005618 Bacteria 4534
2 rootH2_10027763 3300003320 Bacteria 3451
3 rootH2_10286843 3300003320 Bacteria 2378
4 JGI26145J50221_1000362 3300003371 Bacteria 3985
5 Ga0065704_10092250 3300005289 Bacteria 2666
6 Ga0065715_10007927 3300005293 Bacteria 4036
7 Ga0065707_10001071 3300005295 Bacteria 15528
8 Ga0070658_10002090 3300005327 Bacteria 16735
9 Ga0070683_100092428 3300005329 Bacteria 2842
10 Ga0070690_100004714 3300005330 Bacteria 7601
11 Ga0070690_100008572 3300005330 Bacteria 5894
12 Ga0070670_100007932 3300005331 Bacteria 9034
13 Ga0068869_100000796 3300005334 Bacteria 18008
14 Ga0070666_10020682 3300005335 Bacteria 4257
15 Ga0070680_100001594 3300005336 Bacteria 16575
16 Ga0068868_100231460 3300005338 Bacteria 1550
17 Ga0070660_100003082 3300005339 Bacteria 11467
18 Ga0070689_100004165 3300005340 Bacteria 9744
19 Ga0070689_100004335 3300005340 Bacteria 9576
20 Ga0070689_100266650 3300005340 Bacteria 1417
21 Ga0070691_10001042 3300005341 Bacteria 11410
22 Ga0070687_100009532 3300005343 Bacteria 4165
23 Ga0070661_100016607 3300005344 Bacteria 5207
24 Ga0070692_10039448 3300005345 Bacteria 2411
25 Ga0070669_100003578 3300005353 Bacteria 11213
26 Ga0070675_100011345 3300005354 Bacteria 6974
27 Ga0070675_100343585 3300005354 Bacteria 1322
28 Ga0070674_100000500 3300005356 Bacteria 19669
29 Ga0070673_100076163 3300005364 Bacteria 2708
30 Ga0070659_100001842 3300005366 Bacteria 15230
31 Ga0070659_100036417 3300005366 Bacteria 3837
32 Ga0070667_100020929 3300005367 Bacteria 5433
33 Ga0070714_100014359 3300005435 Bacteria 6361
34 Ga0070711_100014018 3300005439 Bacteria 5044
35 Ga0070711_100015562 3300005439 Bacteria 4815
36 Ga0070711_100092266 3300005439 Bacteria 2185
37 Ga0070705_100042681 3300005440 Bacteria 2594
38 Ga0070700_100050307 3300005441 Bacteria 2590
39 Ga0070708_100039102 3300005445 Bacteria 4148
40 Ga0070663_100065675 3300005455 Bacteria 2627
41 Ga0070681_10003213 3300005458 Bacteria 15226
42 Ga0068867_100004584 3300005459 Bacteria 9721
43 Ga0070679_100056080 3300005530 Bacteria 3925
44 Ga0070684_100174074 3300005535 Bacteria 1955
45 Ga0070697_100001482 3300005536 Bacteria 17847
46 Ga0068853_100231356 3300005539 Bacteria 1691
47 Ga0070672_100082130 3300005543 Bacteria 2585
48 Ga0070686_100000875 3300005544 Bacteria 17482
49 Ga0070695_100006435 3300005545 Bacteria 6946
50 Ga0070696_100018149 3300005546 Bacteria 4753
51 Ga0070696_100046414 3300005546 Bacteria 3012
52 Ga0068855_100250559 3300005563 Bacteria 1975
53 Ga0070664_100010991 3300005564 Bacteria 7340
54 Ga0068857_100000867 3300005577 Bacteria 22747
55 Ga0068857_100040222 3300005577 Bacteria 4146
56 Ga0068857_100055099 3300005577 Bacteria 3529
57 Ga0068854_100015926 3300005578 Bacteria 4997
58 Ga0068856_100056559 3300005614 Bacteria 3871
59 Ga0070702_100004900 3300005615 Bacteria 6168
60 Ga0070702_100120651 3300005615 Bacteria 1641
61 Ga0068864_100115336 3300005618 Bacteria 2396
62 Ga0068866_10066948 3300005718 Bacteria 1884
63 Ga0068870_10010352 3300005840 Bacteria 4283
64 Ga0068860_100393308 3300005843 Archaea 1370
65 Ga0068862_100012028 3300005844 Bacteria 7151
66 Ga0081455_10000701 3300005937 Bacteria 43499
67 Ga0075432_10000363 3300006058 Bacteria 13055
68 Ga0070716_100027824 3300006173 Bacteria 3041
69 Ga0070712_100257037 3300006175 Unclassified 1398
70 Ga0075427_10011697 3300006194 Bacteria 1325
71 Ga0097621_100009753 3300006237 Bacteria 6989
72 Ga0097621_100078442 3300006237 Bacteria 2744
73 Ga0097621_100207711 3300006237 Unclassified 1702
74 Ga0068871_100001671 3300006358 Bacteria 14916
75 Ga0068871_100003494 3300006358 Bacteria 10806
76 Ga0075428_100054971 3300006844 Bacteria 4363
77 Ga0075430_100007749 3300006846 Bacteria 9071
78 Ga0075431_100004694 3300006847 Bacteria 13427
79 Ga0075431_100231854 3300006847 Bacteria 1881
80 Ga0075431_100296227 3300006847 Bacteria 1635
81 Ga0075433_10068535 3300006852 Bacteria 3115
82 Ga0075429_100012181 3300006880 Bacteria 7454
83 Ga0075429_100012361 3300006880 Bacteria 7406
84 Ga0075429_100035874 3300006880 Bacteria 4312
85 Ga0075429_100042771 3300006880 Bacteria 3942
86 Ga0075429_100098367 3300006880 Bacteria 2553
87 Ga0068865_100002776 3300006881 Bacteria 10402
88 Ga0075436_100045367 3300006914 Bacteria 3032
89 Ga0075436_100136218 3300006914 Bacteria 1724
90 Ga0075435_100148293 3300007076 Bacteria 1971
91 Ga0105240_10006802 3300009093 Bacteria 16723
92 Ga0105240_10148342 3300009093 Bacteria 2796
93 Ga0105240_10226288 3300009093 Bacteria 2176
94 Ga0105240_10429554 3300009093 Unclassified 1482
95 Ga0111539_10025875 3300009094 Bacteria 7184
96 Ga0105245_10068640 3300009098 Bacteria 3213
97 Ga0114129_10021367 3300009147 Bacteria 9187
98 Ga0114129_10027345 3300009147 Bacteria 8076
99 Ga0114129_10101422 3300009147 Bacteria 3982
100 Ga0114129_10511564 3300009147 Bacteria 1567
101 Ga0105243_10005154 3300009148 Bacteria 10237
102 Ga0105241_10016622 3300009174 Bacteria 5400
103 Ga0105242_10000628 3300009176 Bacteria 27736
104 Ga0105238_10000930 3300009551 Bacteria 30002
105 Ga0105249_10008090 3300009553 Bacteria 9168
106 Ga0105239_10006907 3300010375 Bacteria 13095
107 Ga0105246_10001469 3300011119 Bacteria 13998
108 Ga0157371_10042569 3300013102 Bacteria 3237
109 Ga0157371_10098314 3300013102 Archaea 2075
110 Ga0157369_10255268 3300013105 Bacteria 1829
111 Ga0157374_10288764 3300013296 Bacteria 1620
112 Ga0157378_10029859 3300013297 Bacteria 4814
113 Ga0163162_10153261 3300013306 Bacteria 2423
114 Ga0157372_10049273 3300013307 Bacteria 4683
115 Ga0157372_10052099 3300013307 Bacteria 4556
116 Ga0157372_10220892 3300013307 Archaea 2196
117 Ga0157375_10000033 3300013308 Bacteria 184526
118 Ga0157375_10059337 3300013308 Bacteria 3790
119 Ga0157375_10283138 3300013308 Bacteria 1821
120 Ga0157375_10299306 3300013308 Bacteria 1772
121 Ga0163163_10000133 3300014325 Bacteria 76552
122 Ga0157380_10005488 3300014326 Bacteria 8861
123 Ga0157377_10126899 3300014745 Bacteria 1553
124 Ga0157376_10000536 3300014969 Bacteria 24425
125 Ga0157376_10053603 3300014969 Bacteria 3359
126 Ga0157376_10078986 3300014969 Bacteria 2819
127 Ga0207688_10007182 3300025901 Bacteria 6059
128 Ga0207680_10008924 3300025903 Bacteria 4945
129 Ga0207647_10028948 3300025904 Bacteria 3591
130 Ga0207645_10001006 3300025907 Bacteria 23299
131 Ga0207643_10005395 3300025908 Bacteria 6842
132 Ga0207705_10006303 3300025909 Bacteria 8804
133 Ga0207684_10000280 3300025910 Bacteria 74107
134 Ga0207707_10023725 3300025912 Bacteria 5365
135 Ga0207663_10011919 3300025916 Bacteria 4683
136 Ga0207660_10004468 3300025917 Bacteria 9120
137 Ga0207662_10007622 3300025918 Bacteria 5898
138 Ga0207657_10001726 3300025919 Bacteria 23562
139 Ga0207649_10052992 3300025920 Bacteria 2519
140 Ga0207652_10023193 3300025921 Bacteria 5140
141 Ga0207681_10011501 3300025923 Bacteria 5438
142 Ga0207694_10091281 3300025924 Bacteria 2404
143 Ga0207650_10083552 3300025925 Bacteria 2425
144 Ga0207659_10070088 3300025926 Bacteria 2556
145 Ga0207659_10305129 3300025926 Bacteria 1309
146 Ga0207687_10014849 3300025927 Bacteria 5100
147 Ga0207664_10179060 3300025929 Bacteria 1819
148 Ga0207664_10342741 3300025929 Bacteria 1321
149 Ga0207690_10029443 3300025932 Bacteria 3492
150 Ga0207706_10001503 3300025933 Bacteria 23142
151 Ga0207686_10001159 3300025934 Bacteria 15203
152 Ga0207670_10004538 3300025936 Bacteria 7494
153 Ga0207670_10006894 3300025936 Bacteria 6322
154 Ga0207670_10009487 3300025936 Bacteria 5556
155 Ga0207669_10010561 3300025937 Bacteria 4449
156 Ga0207704_10000630 3300025938 Bacteria 15558
157 Ga0207691_10000209 3300025940 Bacteria 56763
158 Ga0207689_10014691 3300025942 Bacteria 6649
159 Ga0207661_10116644 3300025944 Bacteria 2267
160 Ga0207679_10013570 3300025945 Bacteria 5340
161 Ga0207667_10155579 3300025949 Bacteria 2352
162 Ga0207667_10239370 3300025949 Bacteria 1857
163 Ga0207651_10130392 3300025960 Bacteria 1923
164 Ga0207712_10037742 3300025961 Bacteria 3298
165 Ga0207639_10139667 3300026041 Bacteria 2017
166 Ga0207708_10005068 3300026075 Bacteria 9717
167 Ga0207702_10017910 3300026078 Bacteria 5861
168 Ga0207648_10000524 3300026089 Bacteria 42870
169 Ga0207676_10092294 3300026095 Bacteria 2490
170 Ga0207674_10000317 3300026116 Bacteria 61434
171 Ga0207683_10000622 3300026121 Bacteria 32569
172 Ga0209969_1000603 3300027360 Bacteria 4817
173 Ga0209967_1000152 3300027364 Bacteria 9408
174 Ga0209981_1000037 3300027378 Bacteria 13566
175 Ga0209996_1000244 3300027395 Bacteria 6957
176 Ga0209984_1000324 3300027424 Bacteria 5381
177 Ga0210000_1000058 3300027462 Bacteria 16365
178 Ga0209995_1000052 3300027471 Bacteria 18186
179 Ga0209995_1009297 3300027471 Bacteria 1589
180 Ga0209968_1001101 3300027526 Bacteria 4121
181 Ga0209999_1000050 3300027543 Bacteria 12958
182 Ga0209970_1000042 3300027614 Bacteria 16675
183 Ga0210002_1000003 3300027617 Bacteria 39460
184 Ga0209983_1000974 3300027665 Bacteria 6306
185 Ga0209971_1000087 3300027682 Bacteria 27940
186 Ga0209971_1007364 3300027682 Bacteria 2611
187 Ga0209966_1000060 3300027695 Bacteria 48304
188 Ga0209998_10000103 3300027717 Bacteria 33725
189 Ga0209974_10000007 3300027876 Bacteria 54941
190 Ga0209974_10006829 3300027876 Bacteria 3961
191 Ga0207428_10000989 3300027907 Bacteria 31495
192 Ga0207428_10026135 3300027907 Bacteria 4876
193 Ga0265337_1006157 3300028556 Bacteria 4665
194 Ga0265326_10028125 3300028558 Bacteria 1602
195 Ga0265319_1000179 3300028563 Bacteria 48318
196 Ga0265334_10008979 3300028573 Bacteria 4241
197 Ga0265323_10000632 3300028653 Bacteria 19237
198 Ga0265336_10000520 3300028666 Bacteria 22239
199 Ga0265336_10021258 3300028666 Bacteria 2076
200 Ga0265338_10000009 3300028800 Bacteria 448611
201 Ga0265338_10000210 3300028800 Bacteria 107885
202 Ga0265338_10000248 3300028800 Bacteria 98976
203 Ga0265338_10000774 3300028800 Bacteria 54489
204 Ga0265338_10001092 3300028800 Bacteria 45086
205 Ga0265338_10005506 3300028800 Bacteria 16502
206 Ga0265338_10018803 3300028800 Bacteria 7371
207 Ga0265338_10024645 3300028800 Bacteria 6139
208 Ga0265338_10025142 3300028800 Bacteria 6056
209 Ga0265338_10039437 3300028800 Bacteria 4454
210 Ga0265338_10048452 3300028800 Bacteria 3865
211 Ga0265338_10060800 3300028800 Bacteria 3315
212 Ga0265338_10084822 3300028800 Bacteria 2643
213 Ga0265338_10101733 3300028800 Bacteria 2339
214 Ga0265338_10117973 3300028800 Bacteria 2122
215 Ga0265324_10000643 3300029957 Bacteria 23712
216 Ga0265324_10001294 3300029957 Bacteria 14689
217 Ga0265324_10002463 3300029957 Bacteria 9418
218 Ga0265324_10018198 3300029957 Bacteria 2546
219 Ga0265324_10036763 3300029957 Bacteria 1702
220 Ga0265332_10041498 3300031238 Bacteria 1990
221 Ga0265320_10000501 3300031240 Bacteria 30510
222 Ga0265320_10000683 3300031240 Bacteria 25874
223 Ga0265329_10003297 3300031242 Bacteria 7067
224 Ga0265340_10032631 3300031247 Unclassified 2598
225 Ga0265339_10007123 3300031249 Bacteria 7261
226 Ga0265316_10001824 3300031344 Bacteria 22401
227 Ga0265316_10008087 3300031344 Bacteria 9802
228 Ga0265316_10045969 3300031344 Bacteria 3463
229 Ga0307408_100104476 3300031548 Bacteria 2164
230 Ga0265313_10003644 3300031595 Bacteria 12341
231 Ga0265313_10015471 3300031595 Bacteria 4437
232 Ga0265314_10000087 3300031711 Bacteria 138681
233 Ga0265314_10051555 3300031711 Bacteria 2866
234 Ga0265314_10078288 3300031711 Bacteria 2190
235 Ga0265342_10014990 3300031712 Bacteria 5120
236 Ga0265342_10120406 3300031712 Bacteria 1479
237 Ga0307405_10097919 3300031731 Bacteria 1959
238 Ga0307406_10054734 3300031901 Bacteria 2547
239 Ga0307407_10041902 3300031903 Bacteria 2563
240 Ga0307412_10008024 3300031911 Bacteria 6018
241 Ga0307416_100025246 3300032002 Bacteria 4352
242 Ga0373926_0010096 3300035083 Bacteria 3161
243 Ga0373928_0000050 3300035084 Bacteria 20631
244 Ga0373932_0000003 3300035112 Bacteria 459351
245 Ga0373941_0040357 3300035115 Unclassified 1439
246 Ga0373943_0026975 3300035170 Unclassified 2695
247 Ga0373946_0070811 3300035171 Bacteria 1506
248 Ga0373955_0042223 3300035172 Bacteria 2448
249 Ga0373962_0000093 3300035242 Bacteria 19352
250 Ga0373931_0000017 3300035691 Bacteria 207733
251 Ga0373927_0004636 3300035695 Bacteria 9585
252 Ga0373927_0087176 3300035695 Bacteria 2026
253 Ga0373927_0095926 3300035695 Bacteria 1928
254 Ga0373947_0106878 3300035725 Unclassified 1764
255 Ga0373925_0001786 3300037068 Bacteria 17953
256 Ga0373925_0019997 3300037068 Bacteria 4871
257 Ga0373925_0032335 3300037068 Bacteria 3851
258 Ga0373925_0421105 3300037068 Unclassified 1091
259 Ga0395900_0326654 3300037418 Bacteria 1513
260 Ga0395898_0177491 3300037466 Bacteria 2036
261 Ga0395905_0026159 3300037471 Bacteria 5504
262 Ga0395901_0199722 3300038443 Bacteria 2096
263 Ga0439461_0006289 3300041410 Bacteria 2063
264 Ga0439432_002124 3300042006 Bacteria 7468
265 Ga0439452_010165 3300042010 Bacteria 2748
266 Ga0450914_003330 3300042118 Bacteria 1227
267 Ga0450923_001796 3300042125 Bacteria 2940
268 Ga0450896_000895 3300042133 Bacteria 3426
269 Ga0450896_007388 3300042133 Bacteria 1516
270 Ga0439434_0006232 3300042435 Bacteria 3479
271 Ga0439460_0009741 3300042461 Bacteria 2446
272 Ga0451577_0006299 3300042876 Bacteria 11881
273 Ga0451577_0026345 3300042876 Bacteria 5267
274 Ga0451577_0077367 3300042876 Unclassified 2967
275 Ga0453684_0004787 3300044712 Bacteria 27912
276 Ga0453684_0010817 3300044712 Bacteria 15468
277 Ga0453684_0011897 3300044712 Bacteria 14490
278 Ga0453684_0143833 3300044712 Bacteria 2843
279 Ga0453684_0153358 3300044712 Bacteria 2735
280 Ga0451576_0000578 3300045051 Bacteria 78024
281 Ga0451576_0000912 3300045051 Bacteria 55998
282 Ga0451576_0011205 3300045051 Bacteria 10214
283 Ga0451576_0046213 3300045051 Bacteria 4585
284 Ga0451576_0074938 3300045051 Bacteria 3521
285 Ga0451576_0093894 3300045051 Bacteria 3119
286 Ga0451576_0135882 3300045051 Bacteria 2564
287 Ga0451576_0263419 3300045051 Unclassified 1802
288 Ga0495641_0063559 3300046461 Bacteria 1663
289 Ga0495662_0011277 3300046476 Bacteria 4370
290 Ga0495662_0068657 3300046476 Bacteria 1717
291 Ga0495664_0236907 3300046477 Bacteria 1104
292 Ga0495608_0149326 3300046511 Bacteria 1490
293 Ga0495618_0031117 3300046514 Unclassified 3337
294 Ga0495630_0000023 3300046517 Bacteria 172207
295 Ga0495630_0006208 3300046517 Bacteria 8477
296 Ga0495630_0022346 3300046517 Unclassified 4671
297 Ga0495666_0013778 3300046526 Bacteria 4030
298 Ga0495586_0000004 3300046535 Bacteria 180620
299 Ga0495645_0034794 3300046543 Bacteria 3673
300 Ga0495659_0134139 3300046664 Bacteria 984
301 Ga0495658_0020451 3300046683 Bacteria 3473
302 Ga0495658_0111541 3300046683 Unclassified 1645
303 Ga0495613_0161729 3300046689 Unclassified 1592
304 Ga0495624_0015073 3300046690 Bacteria 5231
305 Ga0495581_0020831 3300047315 Unclassified 3804
306 Ga0495674_0000508 3300047319 Bacteria 35681
307 Ga0495674_0040581 3300047319 Bacteria 4162
308 Ga0495676_0001340 3300047321 Bacteria 21150
309 Ga0495680_0340244 3300047322 Bacteria 1047
310 Ga0495675_0017083 3300047444 Bacteria 4595
311 Ga0495684_0019159 3300047471 Bacteria 5268
312 Ga0495684_0055766 3300047471 Bacteria 3014
313 Ga0496115_0053540 3300048918 Bacteria 3239
314 Ga0501290_000124 3300049513 Bacteria 11815
315 Ga0501291_000193 3300049514 Bacteria 7714
316 Ga0501292_000678 3300049515 Bacteria 4161
317 Ga0501293_000059 3300049516 Bacteria 6869
318 Ga0501296_000387 3300049519 Bacteria 4400
319 Ga0501297_000093 3300049520 Bacteria 9184
320 Ga0501298_000995 3300049521 Bacteria 4032
321 Ga0501299_000329 3300049522 Bacteria 5500
322 Ga0501300_000115 3300049523 Bacteria 11716
323 Ga0501302_001028 3300049525 Bacteria 1521
324 Ga0501303_000050 3300049526 Bacteria 9249
325 Ga0501031_0000260 3300049568 Bacteria 29811
326 Ga0501031_0020671 3300049568 Bacteria 4293
327 Ga0501032_0226306 3300049569 Bacteria 1216
328 Ga0501033_0004992 3300049570 Bacteria 10555
329 Ga0501033_0189325 3300049570 Bacteria 1473
330 Ga0501036_0032459 3300049572 Bacteria 4412
331 Ga0501036_0158476 3300049572 Bacteria 1909
332 Ga0501037_0059827 3300049573 Bacteria 2778
333 Ga0501038_0174866 3300049574 Bacteria 1736
334 Ga0501038_0184270 3300049574 Bacteria 1683
335 Ga0501039_0002288 3300049575 Bacteria 14206
336 Ga0501040_0023528 3300049576 Bacteria 4132
337 Ga0501040_0155562 3300049576 Bacteria 1614
338 Ga0501041_0000657 3300049577 Bacteria 18222
339 Ga0501041_0004666 3300049577 Bacteria 7951
340 Ga0501042_0001050 3300049578 Bacteria 15757
341 Ga0501043_0063627 3300049579 Unclassified 2897
342 Ga0501043_0173325 3300049579 Bacteria 1682
343 Ga0501046_0000317 3300049580 Bacteria 48581
344 Ga0501046_0115995 3300049580 Unclassified 2042
345 Ga0501047_0190596 3300049581 Bacteria 1914
346 Ga0501048_0015393 3300049582 Bacteria 5648
347 Ga0501068_0016269 3300049584 Bacteria 4287
348 Ga0501071_0000716 3300049587 Bacteria 17448
349 Ga0501075_0005494 3300049591 Bacteria 8673
350 Ga0501076_0127209 3300049592 Bacteria 2065
351 Ga0501076_0211111 3300049592 Unclassified 1586
352 Ga0501076_0358756 3300049592 Bacteria 1197
353 Ga0501077_0027821 3300049593 Bacteria 3591
354 Ga0501201_001813 3300049651 Bacteria 1975
355 Ga0501206_000123 3300049653 Bacteria 8210
356 Ga0501208_000070 3300049655 Bacteria 5888
357 Ga0501209_000139 3300049656 Bacteria 7899
358 Ga0501211_006128 3300049658 Bacteria 1193
359 Ga0501216_000092 3300049660 Bacteria 8602
360 Ga0501217_000219 3300049661 Bacteria 8656
361 Ga0501223_006861 3300049663 Bacteria 2339
362 Ga0501227_001071 3300049665 Bacteria 6088
363 Ga0501230_000129 3300049667 Bacteria 5863
364 Ga0501233_000580 3300049668 Bacteria 5945
365 Ga0501235_000148 3300049669 Bacteria 11934
366 Ga0501239_000027 3300049672 Bacteria 8949
367 Ga0501249_016363 3300049679 Unclassified 1592
368 Ga0501251_000093 3300049681 Bacteria 6971
369 Ga0501256_000523 3300049685 Bacteria 2478
370 Ga0501258_000925 3300049687 Bacteria 2218
371 Ga0501260_000274 3300049689 Bacteria 4012
372 Ga0501221_002081 3300049704 Bacteria 3328
373 Ga0501225_0000219 3300049705 Bacteria 18017
374 Ga0501229_000280 3300049706 Bacteria 5770
375 Ga0501234_000029 3300049707 Bacteria 16229
376 Ga0501245_000301 3300049708 Bacteria 5785
377 Ga0501079_0019720 3300049741 Bacteria 5151
378 Ga0501080_0016931 3300049742 Bacteria 6732
379 Ga0501264_001271 3300049761 Bacteria 2821
380 Ga0501265_003465 3300049762 Bacteria 1790
381 Ga0501266_000720 3300049763 Bacteria 4293
382 Ga0501270_000015 3300049767 Bacteria 16472
383 Ga0501273_000035 3300049770 Bacteria 8555
384 Ga0501274_000078 3300049771 Bacteria 5439
385 Ga0501280_000512 3300049776 Bacteria 9156
386 Ga0501281_01251 3300049777 Bacteria 2020
387 Ga0501035_0002647 3300049822 Bacteria 17437
388 Ga0501035_0009411 3300049822 Bacteria 9084
389 Ga0501035_0086322 3300049822 Bacteria 2765
390 Ga0501035_0162813 3300049822 Bacteria 1930
391 Ga0501044_0000207 3300049823 Bacteria 74769
392 Ga0501044_0045203 3300049823 Bacteria 4564
393 Ga0501044_0181276 3300049823 Bacteria 2073
394 Ga0501045_0006843 3300049824 Bacteria 7898
395 Ga0501226_000278 3300049853 Bacteria 7680
396 nmdc:mga05p37_12926_c1 3300050507 Bacteria 9985
397 nmdc:mga05p37_13394_c1 3300050507 Bacteria 9829
398 nmdc:mga05p37_418279_c1 3300050507 Bacteria 1560
399 nmdc:mga09592_15586_c1 3300050508 Bacteria 6211
400 nmdc:mga09592_37816_c1 3300050508 Bacteria 4050
401 nmdc:mga09592_39705_c1 3300050508 Bacteria 3953
402 nmdc:mga09592_99391_c1 3300050508 Bacteria 2491
403 nmdc:mga0qj67_5506_c1 3300050509 Bacteria 9254
404 nmdc:mga06r32_275470_c1 3300050510 Bacteria 1670
405 nmdc:mga06r32_292331_c1 3300050510 Bacteria 1616
406 nmdc:mga06r32_404886_c1 3300050510 Bacteria 1346
407 nmdc:mga08y16_11629_c1 3300050511 Bacteria 9246
408 nmdc:mga0n895_207561_c1 3300050512 Bacteria 1989
409 nmdc:mga0n895_20791_c1 3300050512 Bacteria 6129
410 nmdc:mga0n895_21466_c1 3300050512 Bacteria 6039
411 nmdc:mga0rr50_34326_c1 3300050513 Bacteria 3632
412 nmdc:mga08x19_12706_c1 3300050514 Bacteria 5078
413 nmdc:mga0a205_218444_c1 3300050515 Bacteria 1793
414 nmdc:mga0a205_52620_c1 3300050515 Bacteria 3929
415 Ga0495601_0192420 3300053077 Bacteria 1333
416 Ga0501084_0051970 3300054114 Bacteria 3429
417 Ga0501084_0185059 3300054114 Bacteria 1758
418 Ga0068864_100031005
419 rootH2_10027763
420 rootH2_10286843
421 JGI26145J50221_1000362
422 Ga0065704_10092250
423 Ga0065715_10007927
424 Ga0065707_10001071
425 Ga0070658_10002090
426 Ga0070683_100092428
427 Ga0070690_100004714
428 Ga0070690_100008572
429 Ga0070670_100007932
430 Ga0068869_100000796
431 Ga0070666_10020682
432 Ga0070680_100001594
433 Ga0068868_100231460
434 Ga0070660_100003082
435 Ga0070689_100004165
436 Ga0070689_100004335
437 Ga0070689_100266650
438 Ga0070691_10001042
439 Ga0070687_100009532
440 Ga0070661_100016607
441 Ga0070692_10039448
442 Ga0070669_100003578
443 Ga0070675_100011345
444 Ga0070675_100343585
445 Ga0070674_100000500
446 Ga0070673_100076163
447 Ga0070659_100001842
448 Ga0070659_100036417
449 Ga0070667_100020929
450 Ga0070714_100014359
451 Ga0070711_100014018
452 Ga0070711_100015562
453 Ga0070711_100092266
454 Ga0070705_100042681
455 Ga0070700_100050307
456 Ga0070708_100039102
457 Ga0070663_100065675
458 Ga0070681_10003213
459 Ga0068867_100004584
460 Ga0070679_100056080
461 Ga0070684_100174074
462 Ga0070697_100001482
463 Ga0068853_100231356
464 Ga0070672_100082130
465 Ga0070686_100000875
466 Ga0070695_100006435
467 Ga0070696_100018149
468 Ga0070696_100046414
469 Ga0068855_100250559
470 Ga0070664_100010991
471 Ga0068857_100000867
472 Ga0068857_100040222
473 Ga0068857_100055099
474 Ga0068854_100015926
475 Ga0068856_100056559
476 Ga0070702_100004900
477 Ga0070702_100120651
478 Ga0068864_100115336
479 Ga0068866_10066948
480 Ga0068870_10010352
481 Ga0068860_100393308
482 Ga0068862_100012028
483 Ga0081455_10000701
484 Ga0075432_10000363
485 Ga0070716_100027824
486 Ga0070712_100257037
487 Ga0075427_10011697
488 Ga0097621_100009753
489 Ga0097621_100078442
490 Ga0097621_100207711
491 Ga0068871_100001671
492 Ga0068871_100003494
493 Ga0075428_100054971
494 Ga0075430_100007749
495 Ga0075431_100004694
496 Ga0075431_100231854
497 Ga0075431_100296227
498 Ga0075433_10068535
499 Ga0075429_100012181
500 Ga0075429_100012361
501 Ga0075429_100035874
502 Ga0075429_100042771
503 Ga0075429_100098367
504 Ga0068865_100002776
505 Ga0075436_100045367
506 Ga0075436_100136218
507 Ga0075435_100148293
508 Ga0105240_10006802
509 Ga0105240_10148342
510 Ga0105240_10226288
511 Ga0105240_10429554
512 Ga0111539_10025875
513 Ga0105245_10068640
514 Ga0114129_10021367
515 Ga0114129_10027345
516 Ga0114129_10101422
517 Ga0114129_10511564
518 Ga0105243_10005154
519 Ga0105241_10016622
520 Ga0105242_10000628
521 Ga0105238_10000930
522 Ga0105249_10008090
523 Ga0105239_10006907
524 Ga0105246_10001469
525 Ga0157371_10042569
526 Ga0157371_10098314
527 Ga0157369_10255268
528 Ga0157374_10288764
529 Ga0157378_10029859
530 Ga0163162_10153261
531 Ga0157372_10049273
532 Ga0157372_10052099
533 Ga0157372_10220892
534 Ga0157375_10000033
535 Ga0157375_10059337
536 Ga0157375_10283138
537 Ga0157375_10299306
538 Ga0163163_10000133
539 Ga0157380_10005488
540 Ga0157377_10126899
541 Ga0157376_10000536
542 Ga0157376_10053603
543 Ga0157376_10078986
544 Ga0207688_10007182
545 Ga0207680_10008924
546 Ga0207647_10028948
547 Ga0207645_10001006
548 Ga0207643_10005395
549 Ga0207705_10006303
550 Ga0207684_10000280
551 Ga0207707_10023725
552 Ga0207663_10011919
553 Ga0207660_10004468
554 Ga0207662_10007622
555 Ga0207657_10001726
556 Ga0207649_10052992
557 Ga0207652_10023193
558 Ga0207681_10011501
559 Ga0207694_10091281
560 Ga0207650_10083552
561 Ga0207659_10070088
562 Ga0207659_10305129
563 Ga0207687_10014849
564 Ga0207664_10179060
565 Ga0207664_10342741
566 Ga0207690_10029443
567 Ga0207706_10001503
568 Ga0207686_10001159
569 Ga0207670_10004538
570 Ga0207670_10006894
571 Ga0207670_10009487
572 Ga0207669_10010561
573 Ga0207704_10000630
574 Ga0207691_10000209
575 Ga0207689_10014691
576 Ga0207661_10116644
577 Ga0207679_10013570
578 Ga0207667_10155579
579 Ga0207667_10239370
580 Ga0207651_10130392
581 Ga0207712_10037742
582 Ga0207639_10139667
583 Ga0207708_10005068
584 Ga0207702_10017910
585 Ga0207648_10000524
586 Ga0207676_10092294
587 Ga0207674_10000317
588 Ga0207683_10000622
589 Ga0209969_1000603
590 Ga0209967_1000152
591 Ga0209981_1000037
592 Ga0209996_1000244
593 Ga0209984_1000324
594 Ga0210000_1000058
595 Ga0209995_1000052
596 Ga0209995_1009297
597 Ga0209968_1001101
598 Ga0209999_1000050
599 Ga0209970_1000042
600 Ga0210002_1000003
601 Ga0209983_1000974
602 Ga0209971_1000087
603 Ga0209971_1007364
604 Ga0209966_1000060
605 Ga0209998_10000103
606 Ga0209974_10000007
607 Ga0209974_10006829
608 Ga0207428_10000989
609 Ga0207428_10026135
610 Ga0265337_1006157
611 Ga0265326_10028125
612 Ga0265319_1000179
613 Ga0265334_10008979
614 Ga0265323_10000632
615 Ga0265336_10000520
616 Ga0265336_10021258
617 Ga0265338_10000009
618 Ga0265338_10000210
619 Ga0265338_10000248
620 Ga0265338_10000774
621 Ga0265338_10001092
622 Ga0265338_10005506
623 Ga0265338_10018803
624 Ga0265338_10024645
625 Ga0265338_10025142
626 Ga0265338_10039437
627 Ga0265338_10048452
628 Ga0265338_10060800
629 Ga0265338_10084822
630 Ga0265338_10101733
631 Ga0265338_10117973
632 Ga0265324_10000643
633 Ga0265324_10001294
634 Ga0265324_10002463
635 Ga0265324_10018198
636 Ga0265324_10036763
637 Ga0265332_10041498
638 Ga0265320_10000501
639 Ga0265320_10000683
640 Ga0265329_10003297
641 Ga0265340_10032631
642 Ga0265339_10007123
643 Ga0265316_10001824
644 Ga0265316_10008087
645 Ga0265316_10045969
646 Ga0307408_100104476
647 Ga0265313_10003644
648 Ga0265313_10015471
649 Ga0265314_10000087
650 Ga0265314_10051555
651 Ga0265314_10078288
652 Ga0265342_10014990
653 Ga0265342_10120406
654 Ga0307405_10097919
655 Ga0307406_10054734
656 Ga0307407_10041902
657 Ga0307412_10008024
658 Ga0307416_100025246
659 Ga0373926_0010096
660 Ga0373928_0000050
661 Ga0373932_0000003
662 Ga0373941_0040357
663 Ga0373943_0026975
664 Ga0373946_0070811
665 Ga0373955_0042223
666 Ga0373962_0000093
667 Ga0373931_0000017
668 Ga0373927_0004636
669 Ga0373927_0087176
670 Ga0373927_0095926
671 Ga0373947_0106878
672 Ga0373925_0001786
673 Ga0373925_0019997
674 Ga0373925_0032335
675 Ga0373925_0421105
676 Ga0395900_0326654
677 Ga0395898_0177491
678 Ga0395905_0026159
679 Ga0395901_0199722
680 Ga0439461_0006289
681 Ga0439432_002124
682 Ga0439452_010165
683 Ga0450914_003330
684 Ga0450923_001796
685 Ga0450896_000895
686 Ga0450896_007388
687 Ga0439434_0006232
688 Ga0439460_0009741
689 Ga0451577_0006299
690 Ga0451577_0026345
691 Ga0451577_0077367
692 Ga0453684_0004787
693 Ga0453684_0010817
694 Ga0453684_0011897
695 Ga0453684_0143833
696 Ga0453684_0153358
697 Ga0451576_0000578
698 Ga0451576_0000912
699 Ga0451576_0011205
700 Ga0451576_0046213
701 Ga0451576_0074938
702 Ga0451576_0093894
703 Ga0451576_0135882
704 Ga0451576_0263419
705 Ga0495641_0063559
706 Ga0495662_0011277
707 Ga0495662_0068657
708 Ga0495664_0236907
709 Ga0495608_0149326
710 Ga0495618_0031117
711 Ga0495630_0000023
712 Ga0495630_0006208
713 Ga0495630_0022346
714 Ga0495666_0013778
715 Ga0495586_0000004
716 Ga0495645_0034794
717 Ga0495659_0134139
718 Ga0495658_0020451
719 Ga0495658_0111541
720 Ga0495613_0161729
721 Ga0495624_0015073
722 Ga0495581_0020831
723 Ga0495674_0000508
724 Ga0495674_0040581
725 Ga0495676_0001340
726 Ga0495680_0340244
727 Ga0495675_0017083
728 Ga0495684_0019159
729 Ga0495684_0055766
730 Ga0496115_0053540
731 Ga0501290_000124
732 Ga0501291_000193
733 Ga0501292_000678
734 Ga0501293_000059
735 Ga0501296_000387
736 Ga0501297_000093
737 Ga0501298_000995
738 Ga0501299_000329
739 Ga0501300_000115
740 Ga0501302_001028
741 Ga0501303_000050
742 Ga0501031_0000260
743 Ga0501031_0020671
744 Ga0501032_0226306
745 Ga0501033_0004992
746 Ga0501033_0189325
747 Ga0501036_0032459
748 Ga0501036_0158476
749 Ga0501037_0059827
750 Ga0501038_0174866
751 Ga0501038_0184270
752 Ga0501039_0002288
753 Ga0501040_0023528
754 Ga0501040_0155562
755 Ga0501041_0000657
756 Ga0501041_0004666
757 Ga0501042_0001050
758 Ga0501043_0063627
759 Ga0501043_0173325
760 Ga0501046_0000317
761 Ga0501046_0115995
762 Ga0501047_0190596
763 Ga0501048_0015393
764 Ga0501068_0016269
765 Ga0501071_0000716
766 Ga0501075_0005494
767 Ga0501076_0127209
768 Ga0501076_0211111
769 Ga0501076_0358756
770 Ga0501077_0027821
771 Ga0501201_001813
772 Ga0501206_000123
773 Ga0501208_000070
774 Ga0501209_000139
775 Ga0501211_006128
776 Ga0501216_000092
777 Ga0501217_000219
778 Ga0501223_006861
779 Ga0501227_001071
780 Ga0501230_000129
781 Ga0501233_000580
782 Ga0501235_000148
783 Ga0501239_000027
784 Ga0501249_016363
785 Ga0501251_000093
786 Ga0501256_000523
787 Ga0501258_000925
788 Ga0501260_000274
789 Ga0501221_002081
790 Ga0501225_0000219
791 Ga0501229_000280
792 Ga0501234_000029
793 Ga0501245_000301
794 Ga0501079_0019720
795 Ga0501080_0016931
796 Ga0501264_001271
797 Ga0501265_003465
798 Ga0501266_000720
799 Ga0501270_000015
800 Ga0501273_000035
801 Ga0501274_000078
802 Ga0501280_000512
803 Ga0501281_01251
804 Ga0501035_0002647
805 Ga0501035_0009411
806 Ga0501035_0086322
807 Ga0501035_0162813
808 Ga0501044_0000207
809 Ga0501044_0045203
810 Ga0501044_0181276
811 Ga0501045_0006843
812 Ga0501226_000278
813 nmdc:mga05p37_12926_c1
814 nmdc:mga05p37_13394_c1
815 nmdc:mga05p37_418279_c1
816 nmdc:mga09592_15586_c1
817 nmdc:mga09592_37816_c1
818 nmdc:mga09592_39705_c1
819 nmdc:mga09592_99391_c1
820 nmdc:mga0qj67_5506_c1
821 nmdc:mga06r32_275470_c1
822 nmdc:mga06r32_292331_c1
823 nmdc:mga06r32_404886_c1
824 nmdc:mga08y16_11629_c1
825 nmdc:mga0n895_207561_c1
826 nmdc:mga0n895_20791_c1
827 nmdc:mga0n895_21466_c1
828 nmdc:mga0rr50_34326_c1
829 nmdc:mga08x19_12706_c1
830 nmdc:mga0a205_218444_c1
831 nmdc:mga0a205_52620_c1
832 Ga0495601_0192420
833 Ga0501084_0051970
834 Ga0501084_0185059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

28

292

0.98

PF08669

GCV_T_C

Glycine cleavage T-protein C-terminal barrel domain

316

398

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1woo-assembly1.cif.gz_A crystal structure of t-protein of the glycine cleavage system 0.969 8 370
1woo-assembly1.cif.gz_A crystal structure of t-protein of the glycine cleavage system 0.9506 8 370
1yx2-assembly1.cif.gz_A crystal structure of the probable aminomethyltransferase from bacillus subtilis 0.9498 7 368
4paa-assembly2.cif.gz_B crystal structure of the mature form of rat dmgdh complexed with tetrahydrofolate 0.9493 9 370
1yx2-assembly1.cif.gz_A crystal structure of the probable aminomethyltransferase from bacillus subtilis 0.9472 7 368
ID Description Score Start End Superfamily
af_Q4D100_288_361_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.996 293 364 2.40.30.110
af_P48015_310_389_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.9846 289 365 2.40.30.110
af_O14110_304_377_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.9612 291 365 2.40.30.110
af_A9C3Q7_322_398_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.9586 288 365 2.40.30.110
af_Q9VKR4_313_397_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.957 288 371 2.40.30.110
ID Description Score Start End GO Terms
AF-A0A7V6X2U1-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9944 6 119 GO:0005829
GO:0008168
GO:0032259
AF-A0A381ZQK3-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9853 8 120 GO:0005829
AF-A0A660RE58-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9833 5 128 GO:0005829
GO:0008168
GO:0032259
AF-A0A7V2ATS3-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9822 8 131 GO:0005829
AF-A0A2V2RV07-F1-model_v4 Aminomethyltransferase (EC 2.1.2.10) (Glycine cleavage system T protein) 0.9816 1 373 GO:0004047
GO:0005737
GO:0005960
GO:0008483
GO:0019464

Map