F439079

General Info

Members Datasets Scaffolds Average Seq Length
417 151 834 275

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10125897|Ga0207645_101258971
Length 314
Sequence MLERLRPVARRVAPLQWLYRKYRGVPAASGPEPQTAIPSKLNYGCGHNKLAGYLNVDIDPACQPDLLIKNGDTSAIPRDYFEEVLANDVLEHFPRTQTLSGGYKAYVAEPRTRSLKATVLVIHENRGLNDHIRDVARRLALAGYRAVAPDMLSPTGGTPANEDSARDAINKLDLGKSVADAVAILGELEKSSRGGKVGAVGFCWGGGFVNRLAVAAGDSLNAGVVYYGPAPDPSEAAKVVAPMEFHDAGLDDRVNRGSFLWVTALRQAGKTVKFFLYDGVNHAFNNDTSAERYNKPAADLAWTRTLAFFRRHLN

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
124 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.6
Rhizosphere 95.92
Stem 0
Stem Tuber 0.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10125897 3300025907 Bacteria 1665
2 MBSR1b_contig_4676254 2162886012 Bacteria 1077
3 Ga0065712_10000357 3300005290 Bacteria 13537
4 Ga0070658_10132704 3300005327 Bacteria 2076
5 Ga0070658_10180251 3300005327 Bacteria 1777
6 Ga0070676_10018733 3300005328 Bacteria 3841
7 Ga0070676_10065765 3300005328 Bacteria 2165
8 Ga0070670_100032923 3300005331 Bacteria 4466
9 Ga0070670_100078767 3300005331 Bacteria 2831
10 Ga0070670_100090846 3300005331 Bacteria 2624
11 Ga0070677_10015922 3300005333 Bacteria 2670
12 Ga0068869_100154249 3300005334 Bacteria 1783
13 Ga0070666_10058453 3300005335 Bacteria 2607
14 Ga0070660_100026444 3300005339 Bacteria 4320
15 Ga0070660_100248536 3300005339 Bacteria 1450
16 Ga0070660_100375071 3300005339 Bacteria 1174
17 Ga0070661_100003980 3300005344 Bacteria 10166
18 Ga0070661_100010153 3300005344 Bacteria 6540
19 Ga0070661_100036214 3300005344 Bacteria 3588
20 Ga0070661_100052713 3300005344 Bacteria 2977
21 Ga0070661_100244771 3300005344 Bacteria 1382
22 Ga0070661_100285645 3300005344 Bacteria 1281
23 Ga0070692_10003191 3300005345 Bacteria 6594
24 Ga0070668_100035942 3300005347 Bacteria 3780
25 Ga0070668_100039441 3300005347 Bacteria 3612
26 Ga0070668_100040842 3300005347 Bacteria 3552
27 Ga0070668_100112104 3300005347 Bacteria 2172
28 Ga0070669_100066518 3300005353 Bacteria 2657
29 Ga0070669_100164758 3300005353 Bacteria 1725
30 Ga0070669_100215793 3300005353 Bacteria 1515
31 Ga0070669_100357714 3300005353 Bacteria 1186
32 Ga0070675_100002343 3300005354 Bacteria 14076
33 Ga0070675_100024708 3300005354 Bacteria 4812
34 Ga0070675_100121659 3300005354 Bacteria 2218
35 Ga0070675_100153369 3300005354 Bacteria 1976
36 Ga0070671_100002704 3300005355 Bacteria 13757
37 Ga0070671_100019783 3300005355 Bacteria 5483
38 Ga0070671_100021475 3300005355 Bacteria 5272
39 Ga0070671_100032264 3300005355 Bacteria 4331
40 Ga0070674_100189002 3300005356 Bacteria 1583
41 Ga0070673_100190183 3300005364 Bacteria 1762
42 Ga0070659_100009679 3300005366 Bacteria 7082
43 Ga0070659_100023970 3300005366 Bacteria 4674
44 Ga0070659_100040666 3300005366 Bacteria 3633
45 Ga0070667_100001342 3300005367 Bacteria 22068
46 Ga0070667_100011178 3300005367 Bacteria 7426
47 Ga0070667_100099421 3300005367 Bacteria 2511
48 Ga0070667_100218201 3300005367 Bacteria 1697
49 Ga0070667_100349613 3300005367 Bacteria 1338
50 Ga0070667_100371601 3300005367 Bacteria 1297
51 Ga0070694_100004267 3300005444 Bacteria 8603
52 Ga0070694_100027318 3300005444 Bacteria 3705
53 Ga0070663_100080701 3300005455 Bacteria 2389
54 Ga0070663_100105061 3300005455 Bacteria 2113
55 Ga0070663_100128591 3300005455 Bacteria 1921
56 Ga0070662_100001080 3300005457 Bacteria 16619
57 Ga0070662_100010396 3300005457 Bacteria 6103
58 Ga0070662_100018814 3300005457 Bacteria 4679
59 Ga0070662_100019209 3300005457 Bacteria 4637
60 Ga0070662_100046595 3300005457 Bacteria 3115
61 Ga0070662_100050699 3300005457 Bacteria 2994
62 Ga0070662_100070849 3300005457 Bacteria 2569
63 Ga0070662_100161915 3300005457 Bacteria 1751
64 Ga0070679_100090109 3300005530 Bacteria 3055
65 Ga0070679_100121681 3300005530 Bacteria 2594
66 Ga0070672_100003386 3300005543 Bacteria 10335
67 Ga0070672_100009146 3300005543 Bacteria 6816
68 Ga0070695_100020159 3300005545 Bacteria 4069
69 Ga0070695_100144127 3300005545 Bacteria 1655
70 Ga0070696_100049930 3300005546 Bacteria 2907
71 Ga0070696_100071776 3300005546 Bacteria 2437
72 Ga0070696_100150788 3300005546 Bacteria 1706
73 Ga0070665_100004160 3300005548 Bacteria 15222
74 Ga0070665_100007827 3300005548 Bacteria 10840
75 Ga0070665_100016678 3300005548 Bacteria 7360
76 Ga0068855_100005570 3300005563 Bacteria 15369
77 Ga0068855_100610883 3300005563 Bacteria 1175
78 Ga0070664_100000093 3300005564 Bacteria 57415
79 Ga0070664_100008112 3300005564 Bacteria 8490
80 Ga0070664_100021415 3300005564 Bacteria 5328
81 Ga0070664_100039464 3300005564 Bacteria 3979
82 Ga0070664_100158186 3300005564 Bacteria 2003
83 Ga0070664_100174468 3300005564 Bacteria 1908
84 Ga0068857_100008863 3300005577 Bacteria 8715
85 Ga0068857_100047812 3300005577 Bacteria 3799
86 Ga0068857_100058508 3300005577 Bacteria 3422
87 Ga0068857_100112343 3300005577 Bacteria 2449
88 Ga0068854_100010449 3300005578 Bacteria 6020
89 Ga0068854_100272304 3300005578 Bacteria 1360
90 Ga0068852_100045734 3300005616 Bacteria 3725
91 Ga0068852_100046080 3300005616 Bacteria 3713
92 Ga0068859_100004108 3300005617 Bacteria 14849
93 Ga0068859_100070846 3300005617 Bacteria 3522
94 Ga0068859_100095195 3300005617 Bacteria 3030
95 Ga0068859_100217447 3300005617 Bacteria 1998
96 Ga0068864_100000078 3300005618 Bacteria 103622
97 Ga0068864_100010856 3300005618 Bacteria 7528
98 Ga0068864_100033794 3300005618 Bacteria 4349
99 Ga0068864_100037437 3300005618 Bacteria 4140
100 Ga0068851_10053932 3300005834 Bacteria 2047
101 Ga0068863_100001062 3300005841 Bacteria 27480
102 Ga0068863_100014076 3300005841 Bacteria 7708
103 Ga0068863_100018261 3300005841 Bacteria 6716
104 Ga0068863_100061978 3300005841 Bacteria 3536
105 Ga0068863_100088692 3300005841 Bacteria 2932
106 Ga0068858_100126401 3300005842 Bacteria 2395
107 Ga0068858_100139563 3300005842 Bacteria 2275
108 Ga0068858_100484044 3300005842 Bacteria 1194
109 Ga0068860_100000894 3300005843 Bacteria 33104
110 Ga0068860_100027098 3300005843 Bacteria 5521
111 Ga0068860_100096022 3300005843 Bacteria 2825
112 Ga0068860_100160219 3300005843 Bacteria 2169
113 Ga0068860_100171926 3300005843 Bacteria 2093
114 Ga0068862_100002973 3300005844 Bacteria 14803
115 Ga0068862_100026406 3300005844 Bacteria 4880
116 Ga0068862_100089940 3300005844 Bacteria 2672
117 Ga0068862_100129058 3300005844 Bacteria 2235
118 Ga0068862_100173486 3300005844 Bacteria 1931
119 Ga0068862_100201024 3300005844 Bacteria 1797
120 Ga0068871_100007849 3300006358 Bacteria 7648
121 Ga0068871_100382823 3300006358 Bacteria 1250
122 Ga0075433_10101954 3300006852 Bacteria 2541
123 Ga0097620_100004108 3300006931 Bacteria 14849
124 Ga0097620_100070846 3300006931 Bacteria 3522
125 Ga0097620_100095197 3300006931 Bacteria 3030
126 Ga0097620_100217452 3300006931 Bacteria 1998
127 Ga0105251_10039842 3300009011 Bacteria 2293
128 Ga0105250_10009478 3300009092 Bacteria 4097
129 Ga0105248_10000317 3300009177 Bacteria 57281
130 Ga0105248_10010064 3300009177 Bacteria 10416
131 Ga0105248_10036113 3300009177 Bacteria 5527
132 Ga0105248_10372329 3300009177 Bacteria 1608
133 Ga0105249_10029303 3300009553 Bacteria 4971
134 Ga0105032_103162 3300009979 Bacteria 1441
135 Ga0105239_10101188 3300010375 Bacteria 3188
136 Ga0105246_10041949 3300011119 Bacteria 3096
137 Ga0157373_10016544 3300013100 Bacteria 5377
138 Ga0157373_10067567 3300013100 Bacteria 2527
139 Ga0157373_10087644 3300013100 Bacteria 2193
140 Ga0157373_10188387 3300013100 Bacteria 1454
141 Ga0157373_10238581 3300013100 Bacteria 1285
142 Ga0157371_10005725 3300013102 Bacteria 10416
143 Ga0157371_10011021 3300013102 Bacteria 7003
144 Ga0157371_10061145 3300013102 Bacteria 2671
145 Ga0157370_10124043 3300013104 Bacteria 2411
146 Ga0157369_10236874 3300013105 Bacteria 1907
147 Ga0157374_10183435 3300013296 Bacteria 2045
148 Ga0163162_10027716 3300013306 Bacteria 5603
149 Ga0163162_10071929 3300013306 Bacteria 3512
150 Ga0157372_10018620 3300013307 Bacteria 7469
151 Ga0157375_10227701 3300013308 Bacteria 2023
152 Ga0157375_10336466 3300013308 Bacteria 1675
153 Ga0163163_10000588 3300014325 Bacteria 32034
154 Ga0163163_10313877 3300014325 Bacteria 1621
155 Ga0163163_10323226 3300014325 Bacteria 1597
156 Ga0157379_10003380 3300014968 Bacteria 13508
157 Ga0157379_10004364 3300014968 Bacteria 12098
158 Ga0163161_10395013 3300017792 Bacteria 1108
159 Ga0207656_10001627 3300025321 Bacteria 7484
160 Ga0207656_10029485 3300025321 Bacteria 2260
161 Ga0207682_10015162 3300025893 Bacteria 3001
162 Ga0207680_10124788 3300025903 Bacteria 1688
163 Ga0207647_10000437 3300025904 Bacteria 34055
164 Ga0207647_10065419 3300025904 Bacteria 2207
165 Ga0207645_10047295 3300025907 Bacteria 2747
166 Ga0207645_10111777 3300025907 Bacteria 1769
167 Ga0207705_10000849 3300025909 Bacteria 25053
168 Ga0207705_10054516 3300025909 Bacteria 2881
169 Ga0207660_10041779 3300025917 Bacteria 3215
170 Ga0207660_10252024 3300025917 Bacteria 1393
171 Ga0207657_10002175 3300025919 Bacteria 21237
172 Ga0207657_10005133 3300025919 Bacteria 13723
173 Ga0207657_10015588 3300025919 Bacteria 7356
174 Ga0207657_10044836 3300025919 Bacteria 3885
175 Ga0207657_10091474 3300025919 Bacteria 2537
176 Ga0207657_10357672 3300025919 Bacteria 1151
177 Ga0207649_10029067 3300025920 Bacteria 3262
178 Ga0207649_10031716 3300025920 Bacteria 3144
179 Ga0207649_10032612 3300025920 Bacteria 3107
180 Ga0207649_10232752 3300025920 Bacteria 1318
181 Ga0207649_10276551 3300025920 Bacteria 1219
182 Ga0207652_10051145 3300025921 Bacteria 3542
183 Ga0207652_10158479 3300025921 Bacteria 2028
184 Ga0207681_10008514 3300025923 Bacteria 6265
185 Ga0207681_10106356 3300025923 Bacteria 2033
186 Ga0207681_10237779 3300025923 Bacteria 1416
187 Ga0207650_10132589 3300025925 Bacteria 1951
188 Ga0207650_10425518 3300025925 Bacteria 1102
189 Ga0207659_10000922 3300025926 Bacteria 17511
190 Ga0207659_10026835 3300025926 Bacteria 3892
191 Ga0207659_10059495 3300025926 Bacteria 2747
192 Ga0207687_10029164 3300025927 Bacteria 3710
193 Ga0207644_10000863 3300025931 Bacteria 19167
194 Ga0207644_10051884 3300025931 Bacteria 2945
195 Ga0207690_10005473 3300025932 Bacteria 7489
196 Ga0207690_10023607 3300025932 Bacteria 3840
197 Ga0207690_10182677 3300025932 Bacteria 1580
198 Ga0207706_10002381 3300025933 Bacteria 18357
199 Ga0207706_10009357 3300025933 Bacteria 8996
200 Ga0207706_10010678 3300025933 Bacteria 8388
201 Ga0207706_10013061 3300025933 Bacteria 7557
202 Ga0207706_10018556 3300025933 Bacteria 6259
203 Ga0207706_10168243 3300025933 Bacteria 1926
204 Ga0207706_10174940 3300025933 Bacteria 1886
205 Ga0207706_10236454 3300025933 Bacteria 1597
206 Ga0207691_10003724 3300025940 Bacteria 14795
207 Ga0207691_10047313 3300025940 Bacteria 3947
208 Ga0207711_10000042 3300025941 Bacteria 158782
209 Ga0207711_10003579 3300025941 Bacteria 13442
210 Ga0207711_10063421 3300025941 Bacteria 3189
211 Ga0207689_10005202 3300025942 Bacteria 11678
212 Ga0207689_10194813 3300025942 Bacteria 1672
213 Ga0207679_10006425 3300025945 Bacteria 7425
214 Ga0207679_10016704 3300025945 Bacteria 4876
215 Ga0207679_10048400 3300025945 Bacteria 3095
216 Ga0207679_10120527 3300025945 Bacteria 2087
217 Ga0207679_10163570 3300025945 Bacteria 1824
218 Ga0207679_10457092 3300025945 Bacteria 1133
219 Ga0207679_10469815 3300025945 Bacteria 1118
220 Ga0207667_10016103 3300025949 Bacteria 8459
221 Ga0207667_10028853 3300025949 Bacteria 6024
222 Ga0207667_10446480 3300025949 Bacteria 1315
223 Ga0207651_10007276 3300025960 Bacteria 5885
224 Ga0207651_10010407 3300025960 Bacteria 5156
225 Ga0207712_10001321 3300025961 Bacteria 16988
226 Ga0207712_10084952 3300025961 Bacteria 2314
227 Ga0207668_10032500 3300025972 Bacteria 3448
228 Ga0207668_10245366 3300025972 Bacteria 1451
229 Ga0207668_10383996 3300025972 Bacteria 1183
230 Ga0207640_10057733 3300025981 Bacteria 2554
231 Ga0207640_10127327 3300025981 Bacteria 1835
232 Ga0207640_10130094 3300025981 Bacteria 1818
233 Ga0207658_10015261 3300025986 Bacteria 5270
234 Ga0207658_10026929 3300025986 Bacteria 4035
235 Ga0207658_10172432 3300025986 Bacteria 1783
236 Ga0207658_10319891 3300025986 Bacteria 1343
237 Ga0207677_10379017 3300026023 Bacteria 1193
238 Ga0207703_10001651 3300026035 Bacteria 20064
239 Ga0207703_10001950 3300026035 Bacteria 18229
240 Ga0207678_10000676 3300026067 Bacteria 31170
241 Ga0207678_10016070 3300026067 Bacteria 6572
242 Ga0207678_10025565 3300026067 Bacteria 5153
243 Ga0207678_10179339 3300026067 Bacteria 1809
244 Ga0207678_10214872 3300026067 Bacteria 1645
245 Ga0207702_10006382 3300026078 Bacteria 10181
246 Ga0207641_10000444 3300026088 Bacteria 47425
247 Ga0207641_10015148 3300026088 Bacteria 6318
248 Ga0207641_10032307 3300026088 Bacteria 4345
249 Ga0207641_10272134 3300026088 Bacteria 1589
250 Ga0207648_10007709 3300026089 Bacteria 10530
251 Ga0207676_10000740 3300026095 Bacteria 25562
252 Ga0207676_10040528 3300026095 Bacteria 3569
253 Ga0207676_10325494 3300026095 Bacteria 1412
254 Ga0207676_10826455 3300026095 Bacteria 905
255 Ga0207674_10000344 3300026116 Bacteria 59855
256 Ga0207674_10003700 3300026116 Bacteria 18670
257 Ga0207674_10003939 3300026116 Bacteria 18069
258 Ga0207674_10010501 3300026116 Bacteria 10481
259 Ga0207674_10012225 3300026116 Bacteria 9602
260 Ga0207674_10042316 3300026116 Bacteria 4706
261 Ga0207675_100066220 3300026118 Bacteria 3376
262 Ga0207698_10012703 3300026142 Bacteria 5523
263 Ga0207698_10026192 3300026142 Bacteria 4122
264 Ga0209974_10016045 3300027876 Bacteria 2487
265 Ga0268266_10014313 3300028379 Bacteria 6823
266 Ga0268266_10089365 3300028379 Bacteria 2697
267 Ga0268265_10003750 3300028380 Bacteria 10805
268 Ga0268265_10005151 3300028380 Bacteria 8954
269 Ga0268265_10007767 3300028380 Bacteria 7241
270 Ga0268265_10019652 3300028380 Bacteria 4701
271 Ga0268265_10028377 3300028380 Bacteria 4006
272 Ga0268264_10001311 3300028381 Bacteria 23441
273 Ga0268264_10004535 3300028381 Bacteria 11838
274 Ga0268264_10074064 3300028381 Bacteria 2891
275 Ga0268264_10813302 3300028381 Bacteria 934
276 Ga0307408_100083354 3300031548 Bacteria 2395
277 Ga0307408_100083559 3300031548 Bacteria 2393
278 Ga0307408_100260156 3300031548 Bacteria 1436
279 Ga0307405_10004388 3300031731 Bacteria 6662
280 Ga0307405_10030652 3300031731 Bacteria 3156
281 Ga0307405_10042670 3300031731 Bacteria 2762
282 Ga0307405_10064250 3300031731 Bacteria 2332
283 Ga0307405_10125630 3300031731 Bacteria 1763
284 Ga0307405_10498048 3300031731 Bacteria 976
285 Ga0307413_10000510 3300031824 Bacteria 12804
286 Ga0307413_10000727 3300031824 Bacteria 11328
287 Ga0307413_10004432 3300031824 Bacteria 6108
288 Ga0307413_10022140 3300031824 Bacteria 3418
289 Ga0307413_10082136 3300031824 Bacteria 2069
290 Ga0307410_10001078 3300031852 Bacteria 11883
291 Ga0307410_10001464 3300031852 Bacteria 10671
292 Ga0307410_10002704 3300031852 Bacteria 8656
293 Ga0307410_10019449 3300031852 Bacteria 4131
294 Ga0307410_10027156 3300031852 Bacteria 3614
295 Ga0307410_10055745 3300031852 Bacteria 2684
296 Ga0307410_10091314 3300031852 Bacteria 2162
297 Ga0307410_10175722 3300031852 Bacteria 1617
298 Ga0307410_10179078 3300031852 Bacteria 1604
299 Ga0307410_10235014 3300031852 Bacteria 1417
300 Ga0307406_10039207 3300031901 Bacteria 2938
301 Ga0307406_10065932 3300031901 Bacteria 2355
302 Ga0307406_10130503 3300031901 Bacteria 1763
303 Ga0307406_10387877 3300031901 Bacteria 1103
304 Ga0307407_10004628 3300031903 Bacteria 5870
305 Ga0307407_10026729 3300031903 Bacteria 3060
306 Ga0307407_10031205 3300031903 Bacteria 2883
307 Ga0307407_10075321 3300031903 Bacteria 2023
308 Ga0307407_10078686 3300031903 Bacteria 1987
309 Ga0307407_10166621 3300031903 Bacteria 1447
310 Ga0307407_10208834 3300031903 Bacteria 1313
311 Ga0307412_10014512 3300031911 Bacteria 4646
312 Ga0307412_10042261 3300031911 Bacteria 2961
313 Ga0307412_10103468 3300031911 Bacteria 2018
314 Ga0307412_10159089 3300031911 Bacteria 1676
315 Ga0307412_10338862 3300031911 Bacteria 1203
316 Ga0307412_10413662 3300031911 Bacteria 1101
317 Ga0307409_100018441 3300031995 Bacteria 4693
318 Ga0307409_100026414 3300031995 Bacteria 4094
319 Ga0307409_100063034 3300031995 Bacteria 2905
320 Ga0307409_100098903 3300031995 Bacteria 2414
321 Ga0307409_100107093 3300031995 Bacteria 2335
322 Ga0307409_100205611 3300031995 Bacteria 1765
323 Ga0307409_100209261 3300031995 Bacteria 1751
324 Ga0307409_100219573 3300031995 Bacteria 1715
325 Ga0307409_100231115 3300031995 Bacteria 1677
326 Ga0307409_100324519 3300031995 Bacteria 1442
327 Ga0307409_100402282 3300031995 Bacteria 1308
328 Ga0307409_100437237 3300031995 Bacteria 1259
329 Ga0307409_100467768 3300031995 Bacteria 1220
330 Ga0307409_100608808 3300031995 Bacteria 1080
331 Ga0307409_100777295 3300031995 Bacteria 963
332 Ga0307409_100796928 3300031995 Bacteria 952
333 Ga0307416_100001379 3300032002 Bacteria 13140
334 Ga0307416_100174011 3300032002 Bacteria 2008
335 Ga0307416_100342023 3300032002 Bacteria 1509
336 Ga0307416_100389273 3300032002 Bacteria 1427
337 Ga0307414_10009087 3300032004 Bacteria 5689
338 Ga0307414_10010481 3300032004 Bacteria 5382
339 Ga0307414_10013888 3300032004 Bacteria 4809
340 Ga0307414_10056628 3300032004 Bacteria 2751
341 Ga0307414_10102671 3300032004 Bacteria 2155
342 Ga0307414_10264756 3300032004 Bacteria 1436
343 Ga0307414_10367267 3300032004 Bacteria 1240
344 Ga0307414_10413390 3300032004 Bacteria 1175
345 Ga0307414_10575320 3300032004 Bacteria 1007
346 Ga0307411_10000972 3300032005 Bacteria 10991
347 Ga0307411_10004515 3300032005 Bacteria 6677
348 Ga0307411_10007309 3300032005 Bacteria 5611
349 Ga0307411_10011352 3300032005 Bacteria 4805
350 Ga0307411_10042820 3300032005 Bacteria 2892
351 Ga0307411_10089835 3300032005 Bacteria 2141
352 Ga0307411_10100872 3300032005 Bacteria 2041
353 Ga0307411_10139502 3300032005 Bacteria 1785
354 Ga0307411_10143294 3300032005 Bacteria 1765
355 Ga0307411_10209586 3300032005 Bacteria 1504
356 Ga0307415_100000293 3300032126 Bacteria 21679
357 Ga0307415_100011361 3300032126 Bacteria 5092
358 Ga0307415_100023981 3300032126 Bacteria 3800
359 Ga0307415_100027157 3300032126 Bacteria 3623
360 Ga0307415_100072961 3300032126 Bacteria 2419
361 Ga0307415_100081353 3300032126 Bacteria 2313
362 Ga0307415_100155119 3300032126 Bacteria 1767
363 Ga0307415_100157380 3300032126 Bacteria 1756
364 Ga0307415_100185936 3300032126 Bacteria 1635
365 Ga0307415_100546216 3300032126 Bacteria 1022
366 Ga0395899_0220252 3300037312 Bacteria 1315
367 Ga0395900_0060277 3300037418 Bacteria 3905
368 Ga0395900_0286896 3300037418 Bacteria 1636
369 Ga0395905_0019468 3300037471 Bacteria 6433
370 Ga0395905_0040805 3300037471 Bacteria 4354
371 Ga0395905_0066074 3300037471 Bacteria 3386
372 Ga0395905_0696758 3300037471 Bacteria 918
373 Ga0395901_0229265 3300038443 Bacteria 1939
374 Ga0395901_0324147 3300038443 Bacteria 1593
375 Ga0439465_0070452 3300041413 Bacteria 1171
376 Ga0439445_0000015 3300042004 Bacteria 22930
377 Ga0439432_012891 3300042006 Bacteria 2847
378 Ga0439432_064124 3300042006 Bacteria 1128
379 Ga0439449_0009640 3300042007 Bacteria 3654
380 Ga0439457_021576 3300042014 Bacteria 1429
381 Ga0450905_002345 3300042142 Bacteria 2430
382 Ga0450889_000099 3300042144 Bacteria 8306
383 Ga0439464_0000736 3300042439 Bacteria 7119
384 Ga0466965_0205090 3300044683 Bacteria 1047
385 Ga0495598_0012671 3300046537 Bacteria 2075
386 Ga0495621_0005348 3300046539 Bacteria 3682
387 Ga0495633_0031973 3300046558 Bacteria 2545
388 Ga0495668_0023986 3300046616 Bacteria 3472
389 Ga0495625_0123830 3300046660 Bacteria 1757
390 Ga0495669_0005990 3300046684 Bacteria 5069
391 Ga0495669_0023996 3300046684 Bacteria 2657
392 Ga0495669_0070113 3300046684 Bacteria 1596
393 Ga0495669_0089218 3300046684 Bacteria 1422
394 Ga0495670_0039739 3300046691 Bacteria 2346
395 Ga0495677_0003782 3300047445 Bacteria 5852
396 Ga0496102_0164371 3300048905 Bacteria 2088
397 Ga0496105_0031860 3300048908 Bacteria 4324
398 Ga0496106_0225095 3300048909 Bacteria 1496
399 Ga0496107_0005407 3300048910 Bacteria 8741
400 Ga0496108_0004816 3300048911 Bacteria 10886
401 Ga0496108_0205807 3300048911 Bacteria 1708
402 Ga0496109_0013722 3300048912 Bacteria 7038
403 Ga0496109_0068957 3300048912 Bacteria 3242
404 Ga0496110_0000948 3300048913 Bacteria 20317
405 Ga0496110_0009910 3300048913 Bacteria 7725
406 Ga0496110_0013763 3300048913 Bacteria 6702
407 Ga0496110_0631928 3300048913 Bacteria 970
408 Ga0496111_0024892 3300048914 Bacteria 4221
409 Ga0496112_0062210 3300048915 Bacteria 3681
410 Ga0496113_0008511 3300048916 Bacteria 6687
411 nmdc:mga09592_290277_c1 3300050508 Bacteria 1418
412 nmdc:mga08y16_60274_c1 3300050511 Bacteria 3964
413 nmdc:mga0rr50_314286_c1 3300050513 Bacteria 1312
414 nmdc:mga0a205_17506_c1 3300050515 Bacteria 6721
415 Ga0500658_0000088 3300053134 Bacteria 42563
416 Ga0590077_025513 3300059426 Bacteria 1274
417 2885428670 2885427238 Bacteria 2291351
418 Ga0207645_10125897
419 MBSR1b_contig_4676254
420 Ga0065712_10000357
421 Ga0070658_10132704
422 Ga0070658_10180251
423 Ga0070676_10018733
424 Ga0070676_10065765
425 Ga0070670_100032923
426 Ga0070670_100078767
427 Ga0070670_100090846
428 Ga0070677_10015922
429 Ga0068869_100154249
430 Ga0070666_10058453
431 Ga0070660_100026444
432 Ga0070660_100248536
433 Ga0070660_100375071
434 Ga0070661_100003980
435 Ga0070661_100010153
436 Ga0070661_100036214
437 Ga0070661_100052713
438 Ga0070661_100244771
439 Ga0070661_100285645
440 Ga0070692_10003191
441 Ga0070668_100035942
442 Ga0070668_100039441
443 Ga0070668_100040842
444 Ga0070668_100112104
445 Ga0070669_100066518
446 Ga0070669_100164758
447 Ga0070669_100215793
448 Ga0070669_100357714
449 Ga0070675_100002343
450 Ga0070675_100024708
451 Ga0070675_100121659
452 Ga0070675_100153369
453 Ga0070671_100002704
454 Ga0070671_100019783
455 Ga0070671_100021475
456 Ga0070671_100032264
457 Ga0070674_100189002
458 Ga0070673_100190183
459 Ga0070659_100009679
460 Ga0070659_100023970
461 Ga0070659_100040666
462 Ga0070667_100001342
463 Ga0070667_100011178
464 Ga0070667_100099421
465 Ga0070667_100218201
466 Ga0070667_100349613
467 Ga0070667_100371601
468 Ga0070694_100004267
469 Ga0070694_100027318
470 Ga0070663_100080701
471 Ga0070663_100105061
472 Ga0070663_100128591
473 Ga0070662_100001080
474 Ga0070662_100010396
475 Ga0070662_100018814
476 Ga0070662_100019209
477 Ga0070662_100046595
478 Ga0070662_100050699
479 Ga0070662_100070849
480 Ga0070662_100161915
481 Ga0070679_100090109
482 Ga0070679_100121681
483 Ga0070672_100003386
484 Ga0070672_100009146
485 Ga0070695_100020159
486 Ga0070695_100144127
487 Ga0070696_100049930
488 Ga0070696_100071776
489 Ga0070696_100150788
490 Ga0070665_100004160
491 Ga0070665_100007827
492 Ga0070665_100016678
493 Ga0068855_100005570
494 Ga0068855_100610883
495 Ga0070664_100000093
496 Ga0070664_100008112
497 Ga0070664_100021415
498 Ga0070664_100039464
499 Ga0070664_100158186
500 Ga0070664_100174468
501 Ga0068857_100008863
502 Ga0068857_100047812
503 Ga0068857_100058508
504 Ga0068857_100112343
505 Ga0068854_100010449
506 Ga0068854_100272304
507 Ga0068852_100045734
508 Ga0068852_100046080
509 Ga0068859_100004108
510 Ga0068859_100070846
511 Ga0068859_100095195
512 Ga0068859_100217447
513 Ga0068864_100000078
514 Ga0068864_100010856
515 Ga0068864_100033794
516 Ga0068864_100037437
517 Ga0068851_10053932
518 Ga0068863_100001062
519 Ga0068863_100014076
520 Ga0068863_100018261
521 Ga0068863_100061978
522 Ga0068863_100088692
523 Ga0068858_100126401
524 Ga0068858_100139563
525 Ga0068858_100484044
526 Ga0068860_100000894
527 Ga0068860_100027098
528 Ga0068860_100096022
529 Ga0068860_100160219
530 Ga0068860_100171926
531 Ga0068862_100002973
532 Ga0068862_100026406
533 Ga0068862_100089940
534 Ga0068862_100129058
535 Ga0068862_100173486
536 Ga0068862_100201024
537 Ga0068871_100007849
538 Ga0068871_100382823
539 Ga0075433_10101954
540 Ga0097620_100004108
541 Ga0097620_100070846
542 Ga0097620_100095197
543 Ga0097620_100217452
544 Ga0105251_10039842
545 Ga0105250_10009478
546 Ga0105248_10000317
547 Ga0105248_10010064
548 Ga0105248_10036113
549 Ga0105248_10372329
550 Ga0105249_10029303
551 Ga0105032_103162
552 Ga0105239_10101188
553 Ga0105246_10041949
554 Ga0157373_10016544
555 Ga0157373_10067567
556 Ga0157373_10087644
557 Ga0157373_10188387
558 Ga0157373_10238581
559 Ga0157371_10005725
560 Ga0157371_10011021
561 Ga0157371_10061145
562 Ga0157370_10124043
563 Ga0157369_10236874
564 Ga0157374_10183435
565 Ga0163162_10027716
566 Ga0163162_10071929
567 Ga0157372_10018620
568 Ga0157375_10227701
569 Ga0157375_10336466
570 Ga0163163_10000588
571 Ga0163163_10313877
572 Ga0163163_10323226
573 Ga0157379_10003380
574 Ga0157379_10004364
575 Ga0163161_10395013
576 Ga0207656_10001627
577 Ga0207656_10029485
578 Ga0207682_10015162
579 Ga0207680_10124788
580 Ga0207647_10000437
581 Ga0207647_10065419
582 Ga0207645_10047295
583 Ga0207645_10111777
584 Ga0207705_10000849
585 Ga0207705_10054516
586 Ga0207660_10041779
587 Ga0207660_10252024
588 Ga0207657_10002175
589 Ga0207657_10005133
590 Ga0207657_10015588
591 Ga0207657_10044836
592 Ga0207657_10091474
593 Ga0207657_10357672
594 Ga0207649_10029067
595 Ga0207649_10031716
596 Ga0207649_10032612
597 Ga0207649_10232752
598 Ga0207649_10276551
599 Ga0207652_10051145
600 Ga0207652_10158479
601 Ga0207681_10008514
602 Ga0207681_10106356
603 Ga0207681_10237779
604 Ga0207650_10132589
605 Ga0207650_10425518
606 Ga0207659_10000922
607 Ga0207659_10026835
608 Ga0207659_10059495
609 Ga0207687_10029164
610 Ga0207644_10000863
611 Ga0207644_10051884
612 Ga0207690_10005473
613 Ga0207690_10023607
614 Ga0207690_10182677
615 Ga0207706_10002381
616 Ga0207706_10009357
617 Ga0207706_10010678
618 Ga0207706_10013061
619 Ga0207706_10018556
620 Ga0207706_10168243
621 Ga0207706_10174940
622 Ga0207706_10236454
623 Ga0207691_10003724
624 Ga0207691_10047313
625 Ga0207711_10000042
626 Ga0207711_10003579
627 Ga0207711_10063421
628 Ga0207689_10005202
629 Ga0207689_10194813
630 Ga0207679_10006425
631 Ga0207679_10016704
632 Ga0207679_10048400
633 Ga0207679_10120527
634 Ga0207679_10163570
635 Ga0207679_10457092
636 Ga0207679_10469815
637 Ga0207667_10016103
638 Ga0207667_10028853
639 Ga0207667_10446480
640 Ga0207651_10007276
641 Ga0207651_10010407
642 Ga0207712_10001321
643 Ga0207712_10084952
644 Ga0207668_10032500
645 Ga0207668_10245366
646 Ga0207668_10383996
647 Ga0207640_10057733
648 Ga0207640_10127327
649 Ga0207640_10130094
650 Ga0207658_10015261
651 Ga0207658_10026929
652 Ga0207658_10172432
653 Ga0207658_10319891
654 Ga0207677_10379017
655 Ga0207703_10001651
656 Ga0207703_10001950
657 Ga0207678_10000676
658 Ga0207678_10016070
659 Ga0207678_10025565
660 Ga0207678_10179339
661 Ga0207678_10214872
662 Ga0207702_10006382
663 Ga0207641_10000444
664 Ga0207641_10015148
665 Ga0207641_10032307
666 Ga0207641_10272134
667 Ga0207648_10007709
668 Ga0207676_10000740
669 Ga0207676_10040528
670 Ga0207676_10325494
671 Ga0207676_10826455
672 Ga0207674_10000344
673 Ga0207674_10003700
674 Ga0207674_10003939
675 Ga0207674_10010501
676 Ga0207674_10012225
677 Ga0207674_10042316
678 Ga0207675_100066220
679 Ga0207698_10012703
680 Ga0207698_10026192
681 Ga0209974_10016045
682 Ga0268266_10014313
683 Ga0268266_10089365
684 Ga0268265_10003750
685 Ga0268265_10005151
686 Ga0268265_10007767
687 Ga0268265_10019652
688 Ga0268265_10028377
689 Ga0268264_10001311
690 Ga0268264_10004535
691 Ga0268264_10074064
692 Ga0268264_10813302
693 Ga0307408_100083354
694 Ga0307408_100083559
695 Ga0307408_100260156
696 Ga0307405_10004388
697 Ga0307405_10030652
698 Ga0307405_10042670
699 Ga0307405_10064250
700 Ga0307405_10125630
701 Ga0307405_10498048
702 Ga0307413_10000510
703 Ga0307413_10000727
704 Ga0307413_10004432
705 Ga0307413_10022140
706 Ga0307413_10082136
707 Ga0307410_10001078
708 Ga0307410_10001464
709 Ga0307410_10002704
710 Ga0307410_10019449
711 Ga0307410_10027156
712 Ga0307410_10055745
713 Ga0307410_10091314
714 Ga0307410_10175722
715 Ga0307410_10179078
716 Ga0307410_10235014
717 Ga0307406_10039207
718 Ga0307406_10065932
719 Ga0307406_10130503
720 Ga0307406_10387877
721 Ga0307407_10004628
722 Ga0307407_10026729
723 Ga0307407_10031205
724 Ga0307407_10075321
725 Ga0307407_10078686
726 Ga0307407_10166621
727 Ga0307407_10208834
728 Ga0307412_10014512
729 Ga0307412_10042261
730 Ga0307412_10103468
731 Ga0307412_10159089
732 Ga0307412_10338862
733 Ga0307412_10413662
734 Ga0307409_100018441
735 Ga0307409_100026414
736 Ga0307409_100063034
737 Ga0307409_100098903
738 Ga0307409_100107093
739 Ga0307409_100205611
740 Ga0307409_100209261
741 Ga0307409_100219573
742 Ga0307409_100231115
743 Ga0307409_100324519
744 Ga0307409_100402282
745 Ga0307409_100437237
746 Ga0307409_100467768
747 Ga0307409_100608808
748 Ga0307409_100777295
749 Ga0307409_100796928
750 Ga0307416_100001379
751 Ga0307416_100174011
752 Ga0307416_100342023
753 Ga0307416_100389273
754 Ga0307414_10009087
755 Ga0307414_10010481
756 Ga0307414_10013888
757 Ga0307414_10056628
758 Ga0307414_10102671
759 Ga0307414_10264756
760 Ga0307414_10367267
761 Ga0307414_10413390
762 Ga0307414_10575320
763 Ga0307411_10000972
764 Ga0307411_10004515
765 Ga0307411_10007309
766 Ga0307411_10011352
767 Ga0307411_10042820
768 Ga0307411_10089835
769 Ga0307411_10100872
770 Ga0307411_10139502
771 Ga0307411_10143294
772 Ga0307411_10209586
773 Ga0307415_100000293
774 Ga0307415_100011361
775 Ga0307415_100023981
776 Ga0307415_100027157
777 Ga0307415_100072961
778 Ga0307415_100081353
779 Ga0307415_100155119
780 Ga0307415_100157380
781 Ga0307415_100185936
782 Ga0307415_100546216
783 Ga0395899_0220252
784 Ga0395900_0060277
785 Ga0395900_0286896
786 Ga0395905_0019468
787 Ga0395905_0040805
788 Ga0395905_0066074
789 Ga0395905_0696758
790 Ga0395901_0229265
791 Ga0395901_0324147
792 Ga0439465_0070452
793 Ga0439445_0000015
794 Ga0439432_012891
795 Ga0439432_064124
796 Ga0439449_0009640
797 Ga0439457_021576
798 Ga0450905_002345
799 Ga0450889_000099
800 Ga0439464_0000736
801 Ga0466965_0205090
802 Ga0495598_0012671
803 Ga0495621_0005348
804 Ga0495633_0031973
805 Ga0495668_0023986
806 Ga0495625_0123830
807 Ga0495669_0005990
808 Ga0495669_0023996
809 Ga0495669_0070113
810 Ga0495669_0089218
811 Ga0495670_0039739
812 Ga0495677_0003782
813 Ga0496102_0164371
814 Ga0496105_0031860
815 Ga0496106_0225095
816 Ga0496107_0005407
817 Ga0496108_0004816
818 Ga0496108_0205807
819 Ga0496109_0013722
820 Ga0496109_0068957
821 Ga0496110_0000948
822 Ga0496110_0009910
823 Ga0496110_0013763
824 Ga0496110_0631928
825 Ga0496111_0024892
826 Ga0496112_0062210
827 Ga0496113_0008511
828 nmdc:mga09592_290277_c1
829 nmdc:mga08y16_60274_c1
830 nmdc:mga0rr50_314286_c1
831 nmdc:mga0a205_17506_c1
832 Ga0500658_0000088
833 Ga0590077_025513
834 2885428670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

103

313

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.941 39 263
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8875 39 263
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.8672 46 263
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8665 42 259
1zi9-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a 0.8662 46 263
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9198 39 263 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.882 39 263 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8662 46 263 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8563 41 263 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8507 42 259 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4R2BIH8-F1-model_v4 Dienelactone hydrolase family protein 0.9689 159 262 GO:0016787
AF-A0A3C1TI09-F1-model_v4 Carboxymethylenebutenolidase 0.9683 153 262 GO:0016787
AF-A0A6N3QHR6-F1-model_v4 Putative enzyme 0.9673 148 263 GO:0016787
AF-A0A2N1UQI7-F1-model_v4 Dienelactone hydrolase 0.9659 146 263 GO:0016787
AF-A0A3N5H463-F1-model_v4 Dienelactone hydrolase family protein 0.9638 157 262 GO:0016787

Map