F439085

General Info

Members Datasets Scaffolds Average Seq Length
417 271 834 403

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10003838|Ga0207712_100038382
Length 459
Sequence VRLSLYPIKWEFATGVFTASELCRRSSHAPFAVLPPEAGLASSRRVQARGGSMLFNLTAEQKRLQARARELAESFVRGRAAETDRTEAYPWDNVRELTKAGLIGYTIPKAYGGSGGSFLDAVLIIEEMARVCGVTGRIAVEANMGAISAVMHYGTDAQRRLAAGIVLAGDKPAICITEPDAGSAAGEMTTSAVKRGNAYVLNGRKHWITGGGVSKLHLIFARAFDEGGREQGIGGFLFVRDDAKAAEAKGFRIGRREPAMGLRGIPETEVILEDLEVPADMVLHPPGGWRRGFAELMNAYNSQRVGAATVALGIAQGAFEQGLDFTKSRTQFGRPIAEFQGLQWMLADMSIQLNAARLAIYNAACSAAPFPDPLLAAQAKVLASEMAIKVTNDALQLFGARGYSRDLPLERMVRDARMFTIGGGTAQVLRTQIASRLLGWKLPQGRDGYLRPPTGLAAE

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
261 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
262 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
263 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
264 2858950400 Achromobacter sp. K91 Isolate Unclassified
265 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
266 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
267 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
268 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
269 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
270 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
271 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.36
Metatranscriptomes 0
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 1.2
Rhizoplane 6.95
Rhizosphere 78.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10003838 3300025961 Bacteria 9490
2 JGI24740J21852_10009504 3300001979 Bacteria 3801
3 JGI25406J46586_10007625 3300003203 Bacteria 4925
4 JGI25406J46586_10016702 3300003203 Bacteria 3054
5 JGI25153J46596_10000514 3300003215 Bacteria 24410
6 rootH1_10013015 3300003323 Bacteria 5899
7 JGI25404J52841_10005140 3300003659 Bacteria 2696
8 JGI25404J52841_10009852 3300003659 Bacteria 2049
9 Ga0055542_1000557 3300003762 Bacteria 32931
10 Ga0055529_1005396 3300003763 Bacteria 1857
11 Ga0055536_1000320 3300003781 Bacteria 35594
12 Ga0070658_10003157 3300005327 Bacteria 13596
13 Ga0068869_100173975 3300005334 Bacteria 1684
14 Ga0070680_100023502 3300005336 Bacteria 4916
15 Ga0070680_100086345 3300005336 Bacteria 2593
16 Ga0070660_100098811 3300005339 Bacteria 2311
17 Ga0070691_10005110 3300005341 Bacteria 5962
18 Ga0070675_100074571 3300005354 Bacteria 2818
19 Ga0070671_100035287 3300005355 Bacteria 4143
20 Ga0070673_100012843 3300005364 Bacteria 5765
21 Ga0070688_100108133 3300005365 Bacteria 1845
22 Ga0070703_10000502 3300005406 Bacteria 15266
23 Ga0070709_10051473 3300005434 Bacteria 2584
24 Ga0070714_100002244 3300005435 Bacteria 14221
25 Ga0070713_100017955 3300005436 Bacteria 5368
26 Ga0070713_100019044 3300005436 Bacteria 5229
27 Ga0070713_100147666 3300005436 Bacteria 2088
28 Ga0070705_100000344 3300005440 Bacteria 27454
29 Ga0070700_100003227 3300005441 Bacteria 8382
30 Ga0070694_100000269 3300005444 Bacteria 27454
31 Ga0070708_100063869 3300005445 Bacteria 3297
32 Ga0070708_100173064 3300005445 Bacteria 2016
33 Ga0070663_100006979 3300005455 Bacteria 6840
34 Ga0070663_100016898 3300005455 Bacteria 4749
35 Ga0070678_100152041 3300005456 Bacteria 1865
36 Ga0070662_100127413 3300005457 Bacteria 1958
37 Ga0070681_10023318 3300005458 Bacteria 6223
38 Ga0068867_100169796 3300005459 Bacteria 1727
39 Ga0070698_100002263 3300005471 Bacteria 21298
40 Ga0070699_100000920 3300005518 Bacteria 27447
41 Ga0070679_100026773 3300005530 Bacteria 5671
42 Ga0070684_100017792 3300005535 Bacteria 5840
43 Ga0070697_100011587 3300005536 Bacteria 6890
44 Ga0070672_100277621 3300005543 Bacteria 1416
45 Ga0070695_100003995 3300005545 Bacteria 8619
46 Ga0070695_100151261 3300005545 Bacteria 1620
47 Ga0070696_100000923 3300005546 Bacteria 19072
48 Ga0070665_100090372 3300005548 Bacteria 3068
49 Ga0070665_100210645 3300005548 Bacteria 1944
50 Ga0070704_100002177 3300005549 Bacteria 10905
51 Ga0068855_100015725 3300005563 Bacteria 9102
52 Ga0068855_100086287 3300005563 Bacteria 3629
53 Ga0070664_100075305 3300005564 Bacteria 2898
54 Ga0070664_100277077 3300005564 Bacteria 1512
55 Ga0068857_100008429 3300005577 Bacteria 8909
56 Ga0068857_100021029 3300005577 Bacteria 5742
57 Ga0070702_100012928 3300005615 Bacteria 4202
58 Ga0068852_100081346 3300005616 Bacteria 2875
59 Ga0068852_100177469 3300005616 Bacteria 2001
60 Ga0068859_100079434 3300005617 Bacteria 3321
61 Ga0068864_100004326 3300005618 Bacteria 11671
62 Ga0068864_100152905 3300005618 Bacteria 2092
63 Ga0068861_100252097 3300005719 Bacteria 1506
64 Ga0068858_100238092 3300005842 Bacteria 1726
65 Ga0068860_100007862 3300005843 Bacteria 10645
66 Ga0068862_100000951 3300005844 Bacteria 27863
67 Ga0068862_100117944 3300005844 Bacteria 2336
68 Ga0081455_10000599 3300005937 Bacteria 46691
69 Ga0081455_10005026 3300005937 Bacteria 14629
70 Ga0081455_10008602 3300005937 Bacteria 10591
71 Ga0081455_10008607 3300005937 Bacteria 10586
72 Ga0081455_10012104 3300005937 Bacteria 8623
73 Ga0081455_10019490 3300005937 Bacteria 6417
74 Ga0081455_10024300 3300005937 Bacteria 5615
75 Ga0081540_1000690 3300005983 Bacteria 31514
76 Ga0081540_1002609 3300005983 Bacteria 14646
77 Ga0081540_1004118 3300005983 Bacteria 11226
78 Ga0081540_1005389 3300005983 Bacteria 9561
79 Ga0081540_1013092 3300005983 Bacteria 5417
80 Ga0081539_10000879 3300005985 Bacteria 57604
81 Ga0081539_10023207 3300005985 Bacteria 4072
82 Ga0070717_10005455 3300006028 Bacteria 9288
83 Ga0070717_10026023 3300006028 Bacteria 4663
84 Ga0075363_100018792 3300006048 Bacteria 3447
85 Ga0070716_100005771 3300006173 Bacteria 6012
86 Ga0070716_100130475 3300006173 Bacteria 1588
87 Ga0070712_100108980 3300006175 Bacteria 2063
88 Ga0075362_10007861 3300006177 Bacteria 4057
89 Ga0075362_10011761 3300006177 Bacteria 3454
90 Ga0075362_10024572 3300006177 Bacteria 2557
91 Ga0075362_10044425 3300006177 Bacteria 1970
92 Ga0075367_10010862 3300006178 Bacteria 4799
93 Ga0075367_10117066 3300006178 Bacteria 1640
94 Ga0075369_10004140 3300006186 Bacteria 5337
95 Ga0075369_10012740 3300006186 Bacteria 3322
96 Ga0075366_10041339 3300006195 Bacteria 2730
97 Ga0097621_100012119 3300006237 Bacteria 6379
98 Ga0068871_100013779 3300006358 Bacteria 6011
99 Ga0075428_100054314 3300006844 Bacteria 4390
100 Ga0068865_100047291 3300006881 Bacteria 2956
101 Ga0097620_100079434 3300006931 Bacteria 3321
102 Ga0075435_100120362 3300007076 Bacteria 2190
103 Ga0099795_10033641 3300007788 Bacteria 1781
104 Ga0105240_10117847 3300009093 Bacteria 3201
105 Ga0105240_10218307 3300009093 Bacteria 2223
106 Ga0111539_10082703 3300009094 Bacteria 3776
107 Ga0105245_10049638 3300009098 Bacteria 3759
108 Ga0105245_10225171 3300009098 Bacteria 1811
109 Ga0105247_10014806 3300009101 Bacteria 4675
110 Ga0105247_10018202 3300009101 Bacteria 4214
111 Ga0105247_10141344 3300009101 Bacteria 1578
112 Ga0114129_10352943 3300009147 Bacteria 1948
113 Ga0105241_10041971 3300009174 Bacteria 3458
114 Ga0105237_10089763 3300009545 Bacteria 3062
115 Ga0105238_10038050 3300009551 Bacteria 4888
116 Ga0105249_10000972 3300009553 Bacteria 25403
117 Ga0105249_10038095 3300009553 Bacteria 4362
118 Ga0105249_10090434 3300009553 Bacteria 2862
119 Ga0105249_10140111 3300009553 Bacteria 2318
120 Ga0105239_10005865 3300010375 Bacteria 14321
121 Ga0105239_10113473 3300010375 Bacteria 3005
122 Ga0105246_10005366 3300011119 Bacteria 7803
123 Ga0105246_10021442 3300011119 Bacteria 4158
124 Ga0157370_10001450 3300013104 Bacteria 29357
125 Ga0157370_10042101 3300013104 Bacteria 4403
126 Ga0157374_10012357 3300013296 Bacteria 7428
127 Ga0157374_10159013 3300013296 Bacteria 2200
128 Ga0157374_10171564 3300013296 Bacteria 2116
129 Ga0157372_10099348 3300013307 Bacteria 3320
130 Ga0163163_10093954 3300014325 Bacteria 3016
131 Ga0157380_10248730 3300014326 Bacteria 1608
132 Ga0182008_10033229 3300014497 Bacteria 2589
133 Ga0157379_10101558 3300014968 Bacteria 2581
134 Ga0157376_10004339 3300014969 Bacteria 9861
135 Ga0157376_10006036 3300014969 Bacteria 8516
136 Ga0157376_10193398 3300014969 Bacteria 1867
137 Ga0163161_10017969 3300017792 Bacteria 4957
138 Ga0209148_1000126 3300025254 Bacteria 181590
139 Ga0209455_1000280 3300025272 Bacteria 55431
140 Ga0207426_1011124 3300025302 Bacteria 3449
141 Ga0209257_1009068 3300025304 Bacteria 5442
142 Ga0207653_10001259 3300025885 Bacteria 8257
143 Ga0207710_10054064 3300025900 Bacteria 1807
144 Ga0207688_10004824 3300025901 Bacteria 7346
145 Ga0207688_10036471 3300025901 Bacteria 2725
146 Ga0207647_10038481 3300025904 Bacteria 3023
147 Ga0207645_10019593 3300025907 Bacteria 4434
148 Ga0207643_10004725 3300025908 Bacteria 7306
149 Ga0207707_10020723 3300025912 Bacteria 5742
150 Ga0207695_10097653 3300025913 Bacteria 2938
151 Ga0207695_10158178 3300025913 Bacteria 2199
152 Ga0207671_10037058 3300025914 Bacteria 3616
153 Ga0207693_10000506 3300025915 Bacteria 35208
154 Ga0207693_10006657 3300025915 Bacteria 9546
155 Ga0207662_10024247 3300025918 Bacteria 3489
156 Ga0207662_10068595 3300025918 Bacteria 2142
157 Ga0207657_10069118 3300025919 Bacteria 2998
158 Ga0207657_10138846 3300025919 Bacteria 1987
159 Ga0207649_10011065 3300025920 Bacteria 4966
160 Ga0207659_10064711 3300025926 Bacteria 2647
161 Ga0207687_10054920 3300025927 Bacteria 2789
162 Ga0207700_10000668 3300025928 Bacteria 20081
163 Ga0207700_10198894 3300025928 Bacteria 1688
164 Ga0207664_10049138 3300025929 Bacteria 3320
165 Ga0207644_10117902 3300025931 Bacteria 2017
166 Ga0207690_10064475 3300025932 Bacteria 2502
167 Ga0207686_10020021 3300025934 Bacteria 3817
168 Ga0207709_10019586 3300025935 Bacteria 3809
169 Ga0207665_10000528 3300025939 Bacteria 25777
170 Ga0207691_10133163 3300025940 Bacteria 2194
171 Ga0207689_10004639 3300025942 Bacteria 12434
172 Ga0207661_10040474 3300025944 Bacteria 3663
173 Ga0207661_10252615 3300025944 Bacteria 1568
174 Ga0207679_10085986 3300025945 Bacteria 2417
175 Ga0207679_10274248 3300025945 Bacteria 1444
176 Ga0207667_10032767 3300025949 Bacteria 5594
177 Ga0207667_10066481 3300025949 Bacteria 3758
178 Ga0207667_10125852 3300025949 Bacteria 2640
179 Ga0207651_10205666 3300025960 Bacteria 1581
180 Ga0207712_10106389 3300025961 Bacteria 2095
181 Ga0207712_10113966 3300025961 Bacteria 2033
182 Ga0207640_10130997 3300025981 Bacteria 1813
183 Ga0207658_10076186 3300025986 Bacteria 2554
184 Ga0207677_10182161 3300026023 Bacteria 1653
185 Ga0207703_10014882 3300026035 Bacteria 6071
186 Ga0207703_10110928 3300026035 Bacteria 2341
187 Ga0207678_10014421 3300026067 Bacteria 6948
188 Ga0207678_10019037 3300026067 Bacteria 6030
189 Ga0207678_10027062 3300026067 Bacteria 5001
190 Ga0207678_10050995 3300026067 Bacteria 3573
191 Ga0207708_10001591 3300026075 Bacteria 16962
192 Ga0207708_10122945 3300026075 Bacteria 2023
193 Ga0207708_10136432 3300026075 Bacteria 1922
194 Ga0207702_10047168 3300026078 Bacteria 3629
195 Ga0207641_10035297 3300026088 Bacteria 4165
196 Ga0207676_10006374 3300026095 Bacteria 8333
197 Ga0207676_10098232 3300026095 Bacteria 2420
198 Ga0207676_10313028 3300026095 Bacteria 1438
199 Ga0207674_10003284 3300026116 Bacteria 19891
200 Ga0207674_10027181 3300026116 Bacteria 6059
201 Ga0207674_10043181 3300026116 Bacteria 4650
202 Ga0207674_10045301 3300026116 Bacteria 4525
203 Ga0207675_100004418 3300026118 Bacteria 13587
204 Ga0207675_100028105 3300026118 Bacteria 5236
205 Ga0207683_10071808 3300026121 Bacteria 3060
206 Ga0207683_10179642 3300026121 Bacteria 1919
207 Ga0207698_10085992 3300026142 Bacteria 2556
208 Ga0209371_1011418 3300027312 Bacteria 2639
209 Ga0268266_10004230 3300028379 Bacteria 13823
210 Ga0268266_10020555 3300028379 Bacteria 5625
211 Ga0268266_10039798 3300028379 Bacteria 4004
212 Ga0268266_10053625 3300028379 Bacteria 3465
213 Ga0268265_10004866 3300028380 Bacteria 9256
214 Ga0268264_10039467 3300028381 Bacteria 3901
215 Ga0268264_10065649 3300028381 Bacteria 3058
216 Ga0268264_10081487 3300028381 Bacteria 2766
217 Ga0265334_10019245 3300028573 Bacteria 2811
218 Ga0307515_10001591 3300028794 Bacteria 50621
219 Ga0268256_1012384 3300030500 Bacteria 2639
220 Ga0265325_10000672 3300031241 Bacteria 24929
221 Ga0265340_10011848 3300031247 Bacteria 4621
222 Ga0265340_10039855 3300031247 Bacteria 2315
223 Ga0307509_10004304 3300031507 Bacteria 20686
224 Ga0307509_10120368 3300031507 Bacteria 2604
225 Ga0265313_10000525 3300031595 Bacteria 40049
226 Ga0265313_10014920 3300031595 Bacteria 4559
227 Ga0265313_10031750 3300031595 Bacteria 2704
228 Ga0265342_10000563 3300031712 Bacteria 39193
229 Ga0307507_10035807 3300033179 Bacteria 5089
230 Ga0373934_0000114 3300035086 Bacteria 28627
231 Ga0373934_0014724 3300035086 Bacteria 2963
232 Ga0373949_0000122 3300035090 Bacteria 28920
233 Ga0373952_0005064 3300035092 Bacteria 2402
234 Ga0373923_0013020 3300035111 Bacteria 3090
235 Ga0373936_0057971 3300035113 Bacteria 1576
236 Ga0373953_0013857 3300035117 Bacteria 2888
237 Ga0373954_0003348 3300035118 Bacteria 6783
238 Ga0373954_0017992 3300035118 Bacteria 3178
239 Ga0373956_0000137 3300035119 Bacteria 26180
240 Ga0373956_0017988 3300035119 Bacteria 2989
241 Ga0373957_0022779 3300035120 Bacteria 2234
242 Ga0373943_0005080 3300035170 Bacteria 5932
243 Ga0373955_0001129 3300035172 Bacteria 11337
244 Ga0373955_0003660 3300035172 Bacteria 6768
245 Ga0373955_0033592 3300035172 Bacteria 2703
246 Ga0373962_0000472 3300035242 Bacteria 8901
247 Ga0373931_0011209 3300035691 Bacteria 4327
248 Ga0373935_0008187 3300035692 Bacteria 6265
249 Ga0373935_0011756 3300035692 Bacteria 5259
250 Ga0373935_0075054 3300035692 Bacteria 2187
251 Ga0373927_0117424 3300035695 Bacteria 1735
252 Ga0373933_0011385 3300035724 Bacteria 4900
253 Ga0373933_0014049 3300035724 Bacteria 4444
254 Ga0373933_0015913 3300035724 Bacteria 4197
255 Ga0373947_0003215 3300035725 Bacteria 9697
256 Ga0373947_0153341 3300035725 Bacteria 1485
257 Ga0373937_0001819 3300036401 Bacteria 17904
258 Ga0373937_0004563 3300036401 Bacteria 11759
259 Ga0373937_0011092 3300036401 Bacteria 7899
260 Ga0373937_0019022 3300036401 Bacteria 6144
261 Ga0373937_0090334 3300036401 Bacteria 2836
262 Ga0316584_0093205 3300036712 Bacteria 2255
263 Ga0373925_0012467 3300037068 Bacteria 6156
264 Ga0373925_0015077 3300037068 Bacteria 5586
265 Ga0395899_0002058 3300037312 Bacteria 16557
266 Ga0395899_0057935 3300037312 Bacteria 2858
267 Ga0395900_0004809 3300037418 Bacteria 14227
268 Ga0395900_0012284 3300037418 Bacteria 8757
269 Ga0395900_0016562 3300037418 Bacteria 7520
270 Ga0395900_0030182 3300037418 Bacteria 5565
271 Ga0395900_0254336 3300037418 Bacteria 1757
272 Ga0395898_0010168 3300037466 Bacteria 9848
273 Ga0395898_0046489 3300037466 Bacteria 4263
274 Ga0395898_0070656 3300037466 Bacteria 3374
275 Ga0395901_0001024 3300038443 Bacteria 30233
276 Ga0395901_0017632 3300038443 Bacteria 7290
277 Ga0395901_0042119 3300038443 Bacteria 4733
278 Ga0395901_0060773 3300038443 Bacteria 3932
279 Ga0400483_040781 3300039062 Bacteria 6796
280 Ga0400483_097712 3300039062 Bacteria 3582
281 Ga0400483_106809 3300039062 Bacteria 30272
282 Ga0400483_247662 3300039062 Bacteria 19088
283 Ga0436365_1431883 3300039437 Bacteria 4905
284 Ga0436362_0871875 3300039453 Bacteria 2159
285 Ga0439435_0007741 3300042436 Bacteria 2470
286 Ga0466963_0132249 3300044694 Bacteria 1724
287 Ga0466957_0043998 3300044842 Bacteria 2706
288 Ga0466959_0033121 3300045049 Bacteria 3823
289 Ga0466967_0029467 3300045976 Bacteria 4593
290 Ga0466967_0358372 3300045976 Bacteria 1413
291 Ga0495592_0059568 3300046454 Bacteria 2811
292 Ga0495592_0080914 3300046454 Bacteria 2349
293 Ga0495603_0024475 3300046455 Bacteria 3651
294 Ga0495629_0000332 3300046459 Bacteria 40488
295 Ga0495641_0020545 3300046461 Bacteria 3345
296 Ga0495651_0000330 3300046462 Bacteria 36818
297 Ga0495651_0063725 3300046462 Bacteria 2817
298 Ga0495653_0235286 3300046463 Bacteria 1224
299 Ga0495639_0098011 3300046475 Bacteria 1382
300 Ga0495664_0008098 3300046477 Bacteria 5854
301 Ga0495585_0133557 3300046492 Bacteria 1304
302 Ga0495608_0002474 3300046511 Bacteria 13250
303 Ga0495628_0103750 3300046516 Bacteria 2192
304 Ga0495648_0021424 3300046524 Bacteria 4475
305 Ga0495640_0030314 3300046533 Bacteria 3874
306 Ga0495622_0062343 3300046557 Bacteria 1726
307 Ga0495667_0008010 3300046559 Bacteria 7165
308 Ga0495667_0011516 3300046559 Bacteria 5986
309 Ga0495668_0043934 3300046616 Bacteria 2484
310 Ga0495588_0008659 3300046674 Bacteria 4675
311 Ga0495588_0016573 3300046674 Bacteria 3563
312 Ga0495599_0003893 3300046678 Bacteria 8782
313 Ga0495646_0034392 3300046680 Bacteria 3147
314 Ga0495658_0000341 3300046683 Bacteria 26154
315 Ga0495581_0023338 3300047315 Bacteria 3585
316 Ga0495581_0029564 3300047315 Bacteria 3176
317 Ga0495581_0164627 3300047315 Bacteria 1297
318 Ga0495604_0004810 3300047317 Bacteria 10708
319 Ga0495674_0108946 3300047319 Bacteria 2350
320 Ga0495674_0149378 3300047319 Bacteria 1960
321 Ga0495676_0010302 3300047321 Bacteria 8481
322 Ga0495680_0040353 3300047322 Bacteria 3720
323 Ga0495680_0061239 3300047322 Bacteria 2896
324 Ga0495680_0124618 3300047322 Bacteria 1899
325 Ga0495675_0006272 3300047444 Bacteria 7279
326 Ga0495593_0033412 3300047673 Bacteria 2801
327 Ga0495602_0000398 3300048088 Bacteria 40599
328 Ga0495602_0129285 3300048088 Bacteria 2017
329 Ga0495602_0159320 3300048088 Bacteria 1764
330 Ga0495614_0014342 3300048089 Bacteria 3470
331 Ga0496100_0028018 3300048903 Bacteria 3470
332 Ga0496100_0050176 3300048903 Bacteria 2702
333 Ga0496101_0060754 3300048904 Bacteria 2743
334 Ga0496102_0005872 3300048905 Bacteria 10450
335 Ga0496102_0010593 3300048905 Bacteria 7942
336 Ga0496103_0014906 3300048906 Bacteria 4620
337 Ga0496104_0118031 3300048907 Bacteria 2546
338 Ga0496104_0154495 3300048907 Bacteria 2202
339 Ga0496106_0001185 3300048909 Bacteria 19446
340 Ga0496106_0027169 3300048909 Bacteria 4262
341 Ga0496106_0028927 3300048909 Bacteria 4130
342 Ga0496107_0012882 3300048910 Bacteria 5845
343 Ga0496107_0176429 3300048910 Bacteria 1587
344 Ga0496108_0026485 3300048911 Bacteria 4782
345 Ga0496108_0027941 3300048911 Bacteria 4664
346 Ga0496108_0102629 3300048911 Bacteria 2440
347 Ga0496109_0035494 3300048912 Bacteria 4498
348 Ga0496109_0054676 3300048912 Bacteria 3641
349 Ga0496109_0065264 3300048912 Bacteria 3332
350 Ga0496109_0081292 3300048912 Bacteria 2986
351 Ga0496109_0213742 3300048912 Bacteria 1813
352 Ga0496111_0003543 3300048914 Bacteria 9663
353 Ga0496111_0081812 3300048914 Bacteria 2357
354 Ga0496112_0006403 3300048915 Bacteria 10332
355 Ga0496112_0071647 3300048915 Bacteria 3425
356 Ga0496112_0184747 3300048915 Bacteria 2048
357 Ga0496114_0009690 3300048917 Bacteria 7651
358 Ga0496114_0026718 3300048917 Bacteria 4728
359 Ga0496115_0055622 3300048918 Bacteria 3179
360 Ga0496116_0000563 3300048919 Bacteria 49675
361 Ga0496117_0114765 3300048920 Bacteria 1669
362 Ga0496126_0138302 3300048929 Bacteria 2098
363 Ga0501034_0000734 3300049571 Bacteria 49577
364 Ga0501036_0178008 3300049572 Bacteria 1791
365 Ga0501041_0177969 3300049577 Bacteria 1331
366 Ga0501047_0044120 3300049581 Bacteria 4307
367 Ga0501068_0015615 3300049584 Bacteria 4364
368 Ga0501072_0045059 3300049588 Bacteria 3467
369 Ga0501072_0269901 3300049588 Bacteria 1354
370 Ga0501074_0155201 3300049590 Bacteria 1636
371 Ga0501076_0175094 3300049592 Bacteria 1749
372 Ga0501079_0179861 3300049741 Bacteria 1650
373 Ga0501035_0375297 3300049822 Bacteria 1187
374 Ga0501044_0101270 3300049823 Bacteria 2898
375 Ga0501045_0075659 3300049824 Bacteria 2480
376 nmdc:mga03683_553_c1 3300050489 Bacteria 10748
377 nmdc:mga03683_74864_c1 3300050489 Bacteria 1453
378 nmdc:mga00v17_21400_c1 3300050491 Bacteria 3718
379 nmdc:mga0yw44_66617_c1 3300050492 Bacteria 2223
380 nmdc:mga0k408_44929_c1 3300050493 Bacteria 2548
381 nmdc:mga06z11_4611_c1 3300050494 Bacteria 5435
382 nmdc:mga07m45_36339_c1 3300050496 Bacteria 2743
383 nmdc:mga07m45_66616_c1 3300050496 Bacteria 2046
384 nmdc:mga07m45_79275_c1 3300050496 Bacteria 1874
385 nmdc:mga05p37_226935_c1 3300050507 Bacteria 2251
386 nmdc:mga0qj67_306055_c1 3300050509 Bacteria 1287
387 nmdc:mga0n895_37599_c1 3300050512 Bacteria 4684
388 nmdc:mga0n895_39922_c1 3300050512 Bacteria 4558
389 nmdc:mga0rr50_18510_c1 3300050513 Bacteria 4681
390 nmdc:mga0sz30_3496_c1 3300050516 Bacteria 5368
391 Ga0495601_0000712 3300053077 Bacteria 17859
392 Ga0495601_0016300 3300053077 Bacteria 4503
393 Ga0495612_0000609 3300053078 Bacteria 14381
394 Ga0495595_0006141 3300053084 Bacteria 4884
395 Ga0495595_0011010 3300053084 Bacteria 3775
396 Ga0495619_0000591 3300053085 Bacteria 24073
397 Ga0495619_0031777 3300053085 Bacteria 3422
398 Ga0500651_0042585 3300053093 Bacteria 2861
399 Ga0500641_0010749 3300053096 Bacteria 3314
400 Ga0500641_0063761 3300053096 Bacteria 1538
401 Ga0500568_0034121 3300053139 Bacteria 2083
402 Ga0500603_019370 3300053150 Bacteria 1651
403 Ga0500616_0000769 3300053153 Bacteria 36906
404 Ga0500639_091242 3300053163 Bacteria 1517
405 Ga0501084_0192233 3300054114 Bacteria 1722
406 Ga0530510_0047049 3300061734 Bacteria 3117
407 2513721327 2513237104 Bacteria 10034502
408 2514042699 2513237165 Bacteria 6771773
409 2524442603 2524023205 Bacteria 8918781
410 2858950571 2858950400 Bacteria 6783797
411 2902407442 2902405164 Bacteria 6784948
412 2929201477 2929199973 Bacteria 7260745
413 2937972682 2937972304 Bacteria 7532020
414 2997603180 2997600082 Bacteria 9896405
415 8006990080 8006984368 Bacteria 9651211
416 8055916634 8055909800 Bacteria 7278581
417 8056676796 8056673599 Bacteria 7871253
418 Ga0207712_10003838
419 JGI24740J21852_10009504
420 JGI25406J46586_10007625
421 JGI25406J46586_10016702
422 JGI25153J46596_10000514
423 rootH1_10013015
424 JGI25404J52841_10005140
425 JGI25404J52841_10009852
426 Ga0055542_1000557
427 Ga0055529_1005396
428 Ga0055536_1000320
429 Ga0070658_10003157
430 Ga0068869_100173975
431 Ga0070680_100023502
432 Ga0070680_100086345
433 Ga0070660_100098811
434 Ga0070691_10005110
435 Ga0070675_100074571
436 Ga0070671_100035287
437 Ga0070673_100012843
438 Ga0070688_100108133
439 Ga0070703_10000502
440 Ga0070709_10051473
441 Ga0070714_100002244
442 Ga0070713_100017955
443 Ga0070713_100019044
444 Ga0070713_100147666
445 Ga0070705_100000344
446 Ga0070700_100003227
447 Ga0070694_100000269
448 Ga0070708_100063869
449 Ga0070708_100173064
450 Ga0070663_100006979
451 Ga0070663_100016898
452 Ga0070678_100152041
453 Ga0070662_100127413
454 Ga0070681_10023318
455 Ga0068867_100169796
456 Ga0070698_100002263
457 Ga0070699_100000920
458 Ga0070679_100026773
459 Ga0070684_100017792
460 Ga0070697_100011587
461 Ga0070672_100277621
462 Ga0070695_100003995
463 Ga0070695_100151261
464 Ga0070696_100000923
465 Ga0070665_100090372
466 Ga0070665_100210645
467 Ga0070704_100002177
468 Ga0068855_100015725
469 Ga0068855_100086287
470 Ga0070664_100075305
471 Ga0070664_100277077
472 Ga0068857_100008429
473 Ga0068857_100021029
474 Ga0070702_100012928
475 Ga0068852_100081346
476 Ga0068852_100177469
477 Ga0068859_100079434
478 Ga0068864_100004326
479 Ga0068864_100152905
480 Ga0068861_100252097
481 Ga0068858_100238092
482 Ga0068860_100007862
483 Ga0068862_100000951
484 Ga0068862_100117944
485 Ga0081455_10000599
486 Ga0081455_10005026
487 Ga0081455_10008602
488 Ga0081455_10008607
489 Ga0081455_10012104
490 Ga0081455_10019490
491 Ga0081455_10024300
492 Ga0081540_1000690
493 Ga0081540_1002609
494 Ga0081540_1004118
495 Ga0081540_1005389
496 Ga0081540_1013092
497 Ga0081539_10000879
498 Ga0081539_10023207
499 Ga0070717_10005455
500 Ga0070717_10026023
501 Ga0075363_100018792
502 Ga0070716_100005771
503 Ga0070716_100130475
504 Ga0070712_100108980
505 Ga0075362_10007861
506 Ga0075362_10011761
507 Ga0075362_10024572
508 Ga0075362_10044425
509 Ga0075367_10010862
510 Ga0075367_10117066
511 Ga0075369_10004140
512 Ga0075369_10012740
513 Ga0075366_10041339
514 Ga0097621_100012119
515 Ga0068871_100013779
516 Ga0075428_100054314
517 Ga0068865_100047291
518 Ga0097620_100079434
519 Ga0075435_100120362
520 Ga0099795_10033641
521 Ga0105240_10117847
522 Ga0105240_10218307
523 Ga0111539_10082703
524 Ga0105245_10049638
525 Ga0105245_10225171
526 Ga0105247_10014806
527 Ga0105247_10018202
528 Ga0105247_10141344
529 Ga0114129_10352943
530 Ga0105241_10041971
531 Ga0105237_10089763
532 Ga0105238_10038050
533 Ga0105249_10000972
534 Ga0105249_10038095
535 Ga0105249_10090434
536 Ga0105249_10140111
537 Ga0105239_10005865
538 Ga0105239_10113473
539 Ga0105246_10005366
540 Ga0105246_10021442
541 Ga0157370_10001450
542 Ga0157370_10042101
543 Ga0157374_10012357
544 Ga0157374_10159013
545 Ga0157374_10171564
546 Ga0157372_10099348
547 Ga0163163_10093954
548 Ga0157380_10248730
549 Ga0182008_10033229
550 Ga0157379_10101558
551 Ga0157376_10004339
552 Ga0157376_10006036
553 Ga0157376_10193398
554 Ga0163161_10017969
555 Ga0209148_1000126
556 Ga0209455_1000280
557 Ga0207426_1011124
558 Ga0209257_1009068
559 Ga0207653_10001259
560 Ga0207710_10054064
561 Ga0207688_10004824
562 Ga0207688_10036471
563 Ga0207647_10038481
564 Ga0207645_10019593
565 Ga0207643_10004725
566 Ga0207707_10020723
567 Ga0207695_10097653
568 Ga0207695_10158178
569 Ga0207671_10037058
570 Ga0207693_10000506
571 Ga0207693_10006657
572 Ga0207662_10024247
573 Ga0207662_10068595
574 Ga0207657_10069118
575 Ga0207657_10138846
576 Ga0207649_10011065
577 Ga0207659_10064711
578 Ga0207687_10054920
579 Ga0207700_10000668
580 Ga0207700_10198894
581 Ga0207664_10049138
582 Ga0207644_10117902
583 Ga0207690_10064475
584 Ga0207686_10020021
585 Ga0207709_10019586
586 Ga0207665_10000528
587 Ga0207691_10133163
588 Ga0207689_10004639
589 Ga0207661_10040474
590 Ga0207661_10252615
591 Ga0207679_10085986
592 Ga0207679_10274248
593 Ga0207667_10032767
594 Ga0207667_10066481
595 Ga0207667_10125852
596 Ga0207651_10205666
597 Ga0207712_10106389
598 Ga0207712_10113966
599 Ga0207640_10130997
600 Ga0207658_10076186
601 Ga0207677_10182161
602 Ga0207703_10014882
603 Ga0207703_10110928
604 Ga0207678_10014421
605 Ga0207678_10019037
606 Ga0207678_10027062
607 Ga0207678_10050995
608 Ga0207708_10001591
609 Ga0207708_10122945
610 Ga0207708_10136432
611 Ga0207702_10047168
612 Ga0207641_10035297
613 Ga0207676_10006374
614 Ga0207676_10098232
615 Ga0207676_10313028
616 Ga0207674_10003284
617 Ga0207674_10027181
618 Ga0207674_10043181
619 Ga0207674_10045301
620 Ga0207675_100004418
621 Ga0207675_100028105
622 Ga0207683_10071808
623 Ga0207683_10179642
624 Ga0207698_10085992
625 Ga0209371_1011418
626 Ga0268266_10004230
627 Ga0268266_10020555
628 Ga0268266_10039798
629 Ga0268266_10053625
630 Ga0268265_10004866
631 Ga0268264_10039467
632 Ga0268264_10065649
633 Ga0268264_10081487
634 Ga0265334_10019245
635 Ga0307515_10001591
636 Ga0268256_1012384
637 Ga0265325_10000672
638 Ga0265340_10011848
639 Ga0265340_10039855
640 Ga0307509_10004304
641 Ga0307509_10120368
642 Ga0265313_10000525
643 Ga0265313_10014920
644 Ga0265313_10031750
645 Ga0265342_10000563
646 Ga0307507_10035807
647 Ga0373934_0000114
648 Ga0373934_0014724
649 Ga0373949_0000122
650 Ga0373952_0005064
651 Ga0373923_0013020
652 Ga0373936_0057971
653 Ga0373953_0013857
654 Ga0373954_0003348
655 Ga0373954_0017992
656 Ga0373956_0000137
657 Ga0373956_0017988
658 Ga0373957_0022779
659 Ga0373943_0005080
660 Ga0373955_0001129
661 Ga0373955_0003660
662 Ga0373955_0033592
663 Ga0373962_0000472
664 Ga0373931_0011209
665 Ga0373935_0008187
666 Ga0373935_0011756
667 Ga0373935_0075054
668 Ga0373927_0117424
669 Ga0373933_0011385
670 Ga0373933_0014049
671 Ga0373933_0015913
672 Ga0373947_0003215
673 Ga0373947_0153341
674 Ga0373937_0001819
675 Ga0373937_0004563
676 Ga0373937_0011092
677 Ga0373937_0019022
678 Ga0373937_0090334
679 Ga0316584_0093205
680 Ga0373925_0012467
681 Ga0373925_0015077
682 Ga0395899_0002058
683 Ga0395899_0057935
684 Ga0395900_0004809
685 Ga0395900_0012284
686 Ga0395900_0016562
687 Ga0395900_0030182
688 Ga0395900_0254336
689 Ga0395898_0010168
690 Ga0395898_0046489
691 Ga0395898_0070656
692 Ga0395901_0001024
693 Ga0395901_0017632
694 Ga0395901_0042119
695 Ga0395901_0060773
696 Ga0400483_040781
697 Ga0400483_097712
698 Ga0400483_106809
699 Ga0400483_247662
700 Ga0436365_1431883
701 Ga0436362_0871875
702 Ga0439435_0007741
703 Ga0466963_0132249
704 Ga0466957_0043998
705 Ga0466959_0033121
706 Ga0466967_0029467
707 Ga0466967_0358372
708 Ga0495592_0059568
709 Ga0495592_0080914
710 Ga0495603_0024475
711 Ga0495629_0000332
712 Ga0495641_0020545
713 Ga0495651_0000330
714 Ga0495651_0063725
715 Ga0495653_0235286
716 Ga0495639_0098011
717 Ga0495664_0008098
718 Ga0495585_0133557
719 Ga0495608_0002474
720 Ga0495628_0103750
721 Ga0495648_0021424
722 Ga0495640_0030314
723 Ga0495622_0062343
724 Ga0495667_0008010
725 Ga0495667_0011516
726 Ga0495668_0043934
727 Ga0495588_0008659
728 Ga0495588_0016573
729 Ga0495599_0003893
730 Ga0495646_0034392
731 Ga0495658_0000341
732 Ga0495581_0023338
733 Ga0495581_0029564
734 Ga0495581_0164627
735 Ga0495604_0004810
736 Ga0495674_0108946
737 Ga0495674_0149378
738 Ga0495676_0010302
739 Ga0495680_0040353
740 Ga0495680_0061239
741 Ga0495680_0124618
742 Ga0495675_0006272
743 Ga0495593_0033412
744 Ga0495602_0000398
745 Ga0495602_0129285
746 Ga0495602_0159320
747 Ga0495614_0014342
748 Ga0496100_0028018
749 Ga0496100_0050176
750 Ga0496101_0060754
751 Ga0496102_0005872
752 Ga0496102_0010593
753 Ga0496103_0014906
754 Ga0496104_0118031
755 Ga0496104_0154495
756 Ga0496106_0001185
757 Ga0496106_0027169
758 Ga0496106_0028927
759 Ga0496107_0012882
760 Ga0496107_0176429
761 Ga0496108_0026485
762 Ga0496108_0027941
763 Ga0496108_0102629
764 Ga0496109_0035494
765 Ga0496109_0054676
766 Ga0496109_0065264
767 Ga0496109_0081292
768 Ga0496109_0213742
769 Ga0496111_0003543
770 Ga0496111_0081812
771 Ga0496112_0006403
772 Ga0496112_0071647
773 Ga0496112_0184747
774 Ga0496114_0009690
775 Ga0496114_0026718
776 Ga0496115_0055622
777 Ga0496116_0000563
778 Ga0496117_0114765
779 Ga0496126_0138302
780 Ga0501034_0000734
781 Ga0501036_0178008
782 Ga0501041_0177969
783 Ga0501047_0044120
784 Ga0501068_0015615
785 Ga0501072_0045059
786 Ga0501072_0269901
787 Ga0501074_0155201
788 Ga0501076_0175094
789 Ga0501079_0179861
790 Ga0501035_0375297
791 Ga0501044_0101270
792 Ga0501045_0075659
793 nmdc:mga03683_553_c1
794 nmdc:mga03683_74864_c1
795 nmdc:mga00v17_21400_c1
796 nmdc:mga0yw44_66617_c1
797 nmdc:mga0k408_44929_c1
798 nmdc:mga06z11_4611_c1
799 nmdc:mga07m45_36339_c1
800 nmdc:mga07m45_66616_c1
801 nmdc:mga07m45_79275_c1
802 nmdc:mga05p37_226935_c1
803 nmdc:mga0qj67_306055_c1
804 nmdc:mga0n895_37599_c1
805 nmdc:mga0n895_39922_c1
806 nmdc:mga0rr50_18510_c1
807 nmdc:mga0sz30_3496_c1
808 Ga0495601_0000712
809 Ga0495601_0016300
810 Ga0495612_0000609
811 Ga0495595_0006141
812 Ga0495595_0011010
813 Ga0495619_0000591
814 Ga0495619_0031777
815 Ga0500651_0042585
816 Ga0500641_0010749
817 Ga0500641_0063761
818 Ga0500568_0034121
819 Ga0500603_019370
820 Ga0500616_0000769
821 Ga0500639_091242
822 Ga0501084_0192233
823 Ga0530510_0047049
824 2513721327
825 2514042699
826 2524442603
827 2858950571
828 2902407442
829 2929201477
830 2937972682
831 2997603180
832 8006990080
833 8055916634
834 8056676796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

290

438

0.97

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

58

169

0.92

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

305

422

0.92

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

173

275

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5af7-assembly1.cif.gz_B 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimigardefordensis dpn7t: crystal structure and function of a desulfinase with an acyl-coa dehydrogenase fold. native crystal structure 0.981 3 391
5af7-assembly1.cif.gz_B 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimigardefordensis dpn7t: crystal structure and function of a desulfinase with an acyl-coa dehydrogenase fold. native crystal structure 0.9735 3 391
2vig-assembly2.cif.gz_H crystal structure of human short-chain acyl coa dehydrogenase 0.9654 4 381
2vig-assembly1.cif.gz_D crystal structure of human short-chain acyl coa dehydrogenase 0.9635 4 381
2vig-assembly2.cif.gz_F crystal structure of human short-chain acyl coa dehydrogenase 0.9613 4 381
ID Description Score Start End Superfamily
5lnxH03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9686 242 380 1.20.140.10
af_Q9VDT1_256_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9679 238 381 1.20.140.10
1jqiA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9675 242 380 1.20.140.10
1jqiB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9672 242 380 1.20.140.10
5jscD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9659 242 380 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A4Q2LBN0-F1-model_v4 deleted 0.9796 43 274
AF-A0A4Q2LBN0-F1-model_v4 deleted 0.9673 43 274
AF-A0A846NM62-F1-model_v4 Acyl-CoA dehydrogenase 0.9653 1 384 GO:0003995
GO:0050660
AF-A0A835GJ81-F1-model_v4 Uncharacterized protein 0.9638 1 381 GO:0003995
GO:0005739
GO:0033539
GO:0046359
GO:0050660
AF-A0A2E3PX44-F1-model_v4 Acyl-CoA dehydrogenase 0.9628 253 381 GO:0003995

Map