F439098
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 417 | 246 | 834 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0091512|Ga0373937_0091512_451_1308 |
| Length | 285 |
| Sequence | MFLYHNLLRITTWSTYLEAKMNTMIKDNEAIHKMKVAGKLTAMVLDMIGEHVKAGVSTETLDAICHDYIVNELQGIPAPLNYRGFPKSVCTSVNHVVCHGIPGPKVLKNGDIINIDVSVIKDEYHGDSSKMFYVGEPSIRAKRLVEVTQECLYKGILEVKPGSTLKAIARVIEAHAKASGMTVVHEYCGHGIGTRFHEEPQVLHYVDPFSPDLTLEPGMTFTIEPMINAGKRDIKLLPDQWTVVTKDHSLSAQWEHTLLVTPTGVEVLTLRDEETQLKALLGYTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 43 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 44 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 91 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 99 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 100 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 102 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 111 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 112 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 113 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 114 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 115 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 116 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 117 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 118 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 119 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 120 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 121 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 122 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 123 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 124 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 125 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 179 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 180 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 181 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 184 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 185 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 186 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 187 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 188 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 189 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 195 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 201 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 202 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 203 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 204 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 205 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 206 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 207 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 208 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 209 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 210 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 211 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 212 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 213 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 214 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 215 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 216 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 217 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 218 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 219 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 220 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 221 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 222 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 223 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 224 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 225 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 226 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 227 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 228 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 229 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 230 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 231 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 232 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 233 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 234 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 235 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 236 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 237 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 238 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 239 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 240 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 241 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 242 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 243 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 244 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 245 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 246 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.21 |
| Metatranscriptomes | 0 |
| Isolates | 10.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.24 |
| Endosphere | 9.59 |
| Nodule | 2.16 |
| Rhizoplane | 2.64 |
| Rhizosphere | 73.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0091512 | 3300036401 | Bacteria | 2819 |
| 2 | MRS2a_Contig_163 | 2124908027 | Bacteria | 31412 |
| 3 | SwRhRL2b_contig_1021101 | 2162886007 | Bacteria | 892 |
| 4 | SwRhRL2b_contig_667037 | 2162886007 | Bacteria | 1195 |
| 5 | MBSR1b_contig_14367964 | 2162886012 | Bacteria | 1355 |
| 6 | JGI25162J39368_1000010 | 3300002737 | Bacteria | 389629 |
| 7 | JGI25162J39368_1000893 | 3300002737 | Bacteria | 19438 |
| 8 | JGI25163J39215_1000005 | 3300002771 | Bacteria | 128851 |
| 9 | JGI25164J39214_1000003 | 3300002772 | Bacteria | 389390 |
| 10 | JGI25152J39213_1000607 | 3300002773 | Bacteria | 19288 |
| 11 | rootL2_10073820 | 3300003322 | Bacteria | 3511 |
| 12 | Ga0055538_1000009 | 3300003751 | Bacteria | 389629 |
| 13 | Ga0055539_1000013 | 3300003752 | Bacteria | 389629 |
| 14 | Ga0055533_1000017 | 3300003756 | Bacteria | 389629 |
| 15 | Ga0055532_1001248 | 3300003758 | Bacteria | 7458 |
| 16 | Ga0055525_1000019 | 3300003759 | Bacteria | 389629 |
| 17 | Ga0055536_1000037 | 3300003781 | Bacteria | 138437 |
| 18 | Ga0055530_10000674 | 3300003791 | Bacteria | 29086 |
| 19 | Ga0055540_1000025 | 3300003792 | Bacteria | 197801 |
| 20 | Ga0055531_10000301 | 3300003794 | Bacteria | 49074 |
| 21 | Ga0055541_1000010 | 3300003841 | Bacteria | 389629 |
| 22 | Ga0058692_1000110 | 3300003856 | Bacteria | 54130 |
| 23 | Ga0058692_1000411 | 3300003856 | Bacteria | 19901 |
| 24 | Ga0065703_1019097 | 3300005272 | Bacteria | 4002 |
| 25 | Ga0065714_10000081 | 3300005288 | Bacteria | 12068 |
| 26 | Ga0065714_10076528 | 3300005288 | Bacteria | 2781 |
| 27 | Ga0065704_10000634 | 3300005289 | Bacteria | 55231 |
| 28 | Ga0065704_10005427 | 3300005289 | Bacteria | 3798 |
| 29 | Ga0065704_10185361 | 3300005289 | Bacteria | 1194 |
| 30 | Ga0065712_10003209 | 3300005290 | Bacteria | 8346 |
| 31 | Ga0065715_10114620 | 3300005293 | Bacteria | 2444 |
| 32 | Ga0065707_10150707 | 3300005295 | Bacteria | 1661 |
| 33 | Ga0065707_10260304 | 3300005295 | Bacteria | 1099 |
| 34 | Ga0070689_100057213 | 3300005340 | Bacteria | 3026 |
| 35 | Ga0070687_100344673 | 3300005343 | Bacteria | 960 |
| 36 | Ga0070669_100016153 | 3300005353 | Bacteria | 5325 |
| 37 | Ga0070688_100072990 | 3300005365 | Bacteria | 2200 |
| 38 | Ga0070667_100277851 | 3300005367 | Bacteria | 1503 |
| 39 | Ga0070706_100563899 | 3300005467 | Bacteria | 1059 |
| 40 | Ga0068857_100244065 | 3300005577 | Bacteria | 1645 |
| 41 | Ga0068859_100077581 | 3300005617 | Bacteria | 3363 |
| 42 | Ga0068859_100128144 | 3300005617 | Bacteria | 2608 |
| 43 | Ga0068863_100026287 | 3300005841 | Bacteria | 5553 |
| 44 | Ga0068863_100183501 | 3300005841 | Bacteria | 2009 |
| 45 | Ga0068862_100093172 | 3300005844 | Bacteria | 2627 |
| 46 | Ga0068862_100230327 | 3300005844 | Bacteria | 1681 |
| 47 | Ga0075432_10053293 | 3300006058 | Bacteria | 1430 |
| 48 | Ga0075362_10058002 | 3300006177 | Bacteria | 1746 |
| 49 | Ga0075367_10028727 | 3300006178 | Bacteria | 3175 |
| 50 | Ga0075436_100189665 | 3300006914 | Bacteria | 1454 |
| 51 | Ga0097620_100077576 | 3300006931 | Bacteria | 3363 |
| 52 | Ga0097620_100128142 | 3300006931 | Bacteria | 2608 |
| 53 | Ga0099823_1022967 | 3300006944 | Bacteria | 5742 |
| 54 | Ga0099823_1067284 | 3300006944 | Bacteria | 1681 |
| 55 | Ga0079104_1000734 | 3300006946 | Bacteria | 29048 |
| 56 | Ga0079104_1008724 | 3300006946 | Bacteria | 3507 |
| 57 | Ga0105251_10000262 | 3300009011 | Bacteria | 52352 |
| 58 | Ga0105251_10007265 | 3300009011 | Bacteria | 6865 |
| 59 | Ga0105251_10013215 | 3300009011 | Bacteria | 4628 |
| 60 | Ga0105251_10043837 | 3300009011 | Bacteria | 2164 |
| 61 | Ga0105251_10060938 | 3300009011 | Bacteria | 1775 |
| 62 | Ga0105251_10081380 | 3300009011 | Bacteria | 1496 |
| 63 | Ga0105251_10089943 | 3300009011 | Bacteria | 1411 |
| 64 | Ga0105244_10000039 | 3300009036 | Bacteria | 158304 |
| 65 | Ga0105244_10000826 | 3300009036 | Bacteria | 26183 |
| 66 | Ga0105244_10001374 | 3300009036 | Bacteria | 19782 |
| 67 | Ga0105244_10004422 | 3300009036 | Bacteria | 9670 |
| 68 | Ga0105244_10015538 | 3300009036 | Bacteria | 4362 |
| 69 | Ga0105244_10034245 | 3300009036 | Bacteria | 2676 |
| 70 | Ga0105244_10052073 | 3300009036 | Bacteria | 2085 |
| 71 | Ga0105244_10095602 | 3300009036 | Bacteria | 1458 |
| 72 | Ga0105244_10130289 | 3300009036 | Bacteria | 1214 |
| 73 | Ga0105250_10000363 | 3300009092 | Bacteria | 34077 |
| 74 | Ga0105250_10002959 | 3300009092 | Bacteria | 8270 |
| 75 | Ga0105250_10060560 | 3300009092 | Bacteria | 1521 |
| 76 | Ga0105250_10088074 | 3300009092 | Bacteria | 1261 |
| 77 | Ga0105250_10109433 | 3300009092 | Bacteria | 1131 |
| 78 | Ga0111539_10624979 | 3300009094 | Bacteria | 1254 |
| 79 | Ga0105247_10000018 | 3300009101 | Bacteria | 259335 |
| 80 | Ga0105243_10067248 | 3300009148 | Bacteria | 2884 |
| 81 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 82 | Ga0105248_10066802 | 3300009177 | Bacteria | 4037 |
| 83 | Ga0105249_10576278 | 3300009553 | Bacteria | 1178 |
| 84 | Ga0105239_10006132 | 3300010375 | Bacteria | 13989 |
| 85 | Ga0105246_10252502 | 3300011119 | Bacteria | 1400 |
| 86 | Ga0157373_10051228 | 3300013100 | Bacteria | 2941 |
| 87 | Ga0157373_10095140 | 3300013100 | Bacteria | 2097 |
| 88 | Ga0157371_10000252 | 3300013102 | Bacteria | 74966 |
| 89 | Ga0157370_10038426 | 3300013104 | Bacteria | 4630 |
| 90 | Ga0157370_10070850 | 3300013104 | Bacteria | 3290 |
| 91 | Ga0157369_10038528 | 3300013105 | Bacteria | 5226 |
| 92 | Ga0157372_10034560 | 3300013307 | Bacteria | 5558 |
| 93 | Ga0157372_10053417 | 3300013307 | Bacteria | 4503 |
| 94 | Ga0163163_10000197 | 3300014325 | Bacteria | 62158 |
| 95 | Ga0182008_10001389 | 3300014497 | Bacteria | 16370 |
| 96 | Ga0182008_10050116 | 3300014497 | Bacteria | 2072 |
| 97 | Ga0182008_10052792 | 3300014497 | Bacteria | 2014 |
| 98 | Ga0182006_1000047 | 3300015261 | Bacteria | 187006 |
| 99 | Ga0182006_1042010 | 3300015261 | Bacteria | 1793 |
| 100 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 101 | Ga0163161_10047275 | 3300017792 | Bacteria | 3108 |
| 102 | Ga0209760_100008 | 3300025207 | Bacteria | 211332 |
| 103 | Ga0209784_100012 | 3300025224 | Bacteria | 535823 |
| 104 | Ga0209566_100010 | 3300025225 | Bacteria | 535823 |
| 105 | Ga0209674_100023 | 3300025226 | Bacteria | 535823 |
| 106 | Ga0209563_100027 | 3300025230 | Bacteria | 535823 |
| 107 | Ga0207427_100017 | 3300025231 | Bacteria | 535823 |
| 108 | Ga0209437_100029 | 3300025233 | Bacteria | 535823 |
| 109 | Ga0209437_100117 | 3300025233 | Bacteria | 209271 |
| 110 | Ga0209677_100014 | 3300025253 | Bacteria | 535823 |
| 111 | Ga0209233_1001710 | 3300025261 | Bacteria | 8487 |
| 112 | Ga0209565_1042813 | 3300025263 | Bacteria | 838 |
| 113 | Ga0209675_1012906 | 3300025291 | Bacteria | 2654 |
| 114 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 115 | Ga0209676_1000803 | 3300025292 | Bacteria | 41332 |
| 116 | Ga0209676_1019300 | 3300025292 | Bacteria | 2348 |
| 117 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 118 | Ga0209050_1000148 | 3300025298 | Bacteria | 164093 |
| 119 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 120 | Ga0209051_1014695 | 3300025303 | Bacteria | 3639 |
| 121 | Ga0209257_1000056 | 3300025304 | Bacteria | 403132 |
| 122 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 123 | Ga0207696_1000144 | 3300025711 | Bacteria | 122345 |
| 124 | Ga0207696_1000488 | 3300025711 | Bacteria | 33415 |
| 125 | Ga0207696_1003166 | 3300025711 | Bacteria | 7635 |
| 126 | Ga0207696_1039253 | 3300025711 | Bacteria | 1394 |
| 127 | Ga0207696_1064682 | 3300025711 | Bacteria | 1024 |
| 128 | Ga0207655_1000011 | 3300025728 | Bacteria | 643321 |
| 129 | Ga0207655_1000030 | 3300025728 | Bacteria | 413221 |
| 130 | Ga0207655_1000090 | 3300025728 | Bacteria | 203398 |
| 131 | Ga0207655_1000183 | 3300025728 | Bacteria | 112295 |
| 132 | Ga0207655_1000501 | 3300025728 | Bacteria | 50226 |
| 133 | Ga0207655_1000786 | 3300025728 | Bacteria | 34726 |
| 134 | Ga0207655_1008146 | 3300025728 | Bacteria | 6699 |
| 135 | Ga0207655_1008755 | 3300025728 | Bacteria | 6373 |
| 136 | Ga0207655_1023928 | 3300025728 | Bacteria | 3011 |
| 137 | Ga0207655_1077289 | 3300025728 | Bacteria | 1214 |
| 138 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 139 | Ga0207713_1000026 | 3300025735 | Bacteria | 319032 |
| 140 | Ga0207713_1000459 | 3300025735 | Bacteria | 42687 |
| 141 | Ga0207713_1000551 | 3300025735 | Bacteria | 37432 |
| 142 | Ga0207713_1000698 | 3300025735 | Bacteria | 31417 |
| 143 | Ga0207713_1005272 | 3300025735 | Bacteria | 8137 |
| 144 | Ga0207713_1007651 | 3300025735 | Bacteria | 6324 |
| 145 | Ga0207713_1037535 | 3300025735 | Bacteria | 2065 |
| 146 | Ga0207710_10000049 | 3300025900 | Bacteria | 186492 |
| 147 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 148 | Ga0207662_10084362 | 3300025918 | Bacteria | 1943 |
| 149 | Ga0207709_10039717 | 3300025935 | Bacteria | 2813 |
| 150 | Ga0207711_10040887 | 3300025941 | Bacteria | 3946 |
| 151 | Ga0207712_10023211 | 3300025961 | Bacteria | 4092 |
| 152 | Ga0207641_10044681 | 3300026088 | Bacteria | 3726 |
| 153 | Ga0207674_10182188 | 3300026116 | Bacteria | 2052 |
| 154 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 155 | Ga0209281_1011282 | 3300027111 | Bacteria | 2006 |
| 156 | Ga0209389_1000031 | 3300027296 | Bacteria | 138036 |
| 157 | Ga0209389_1077353 | 3300027296 | Bacteria | 1677 |
| 158 | Ga0209371_1000017 | 3300027312 | Bacteria | 625776 |
| 159 | Ga0209371_1000033 | 3300027312 | Bacteria | 381084 |
| 160 | Ga0209371_1000265 | 3300027312 | Bacteria | 61290 |
| 161 | Ga0209371_1001738 | 3300027312 | Bacteria | 13726 |
| 162 | Ga0207428_10096153 | 3300027907 | Bacteria | 2294 |
| 163 | Ga0268265_10037074 | 3300028380 | Bacteria | 3575 |
| 164 | Ga0268265_10169920 | 3300028380 | Bacteria | 1862 |
| 165 | Ga0265334_10000014 | 3300028573 | Bacteria | 154345 |
| 166 | Ga0265324_10000205 | 3300029957 | Bacteria | 45035 |
| 167 | Ga0268256_1000091 | 3300030500 | Bacteria | 148069 |
| 168 | Ga0268256_1000276 | 3300030500 | Bacteria | 53239 |
| 169 | Ga0268256_1001121 | 3300030500 | Bacteria | 17424 |
| 170 | Ga0265325_10086477 | 3300031241 | Bacteria | 1551 |
| 171 | Ga0265327_10000471 | 3300031251 | Bacteria | 71254 |
| 172 | Ga0265316_10303790 | 3300031344 | Bacteria | 1162 |
| 173 | Ga0316575_10014678 | 3300031665 | Bacteria | 2945 |
| 174 | Ga0265314_10000740 | 3300031711 | Bacteria | 39277 |
| 175 | Ga0316574_0053339 | 3300035398 | Bacteria | 2524 |
| 176 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 177 | Ga0373937_0312681 | 3300036401 | Bacteria | 1486 |
| 178 | Ga0316582_0001889 | 3300036647 | Bacteria | 9523 |
| 179 | Ga0395899_0000992 | 3300037312 | Bacteria | 26097 |
| 180 | Ga0395900_0008351 | 3300037418 | Bacteria | 10657 |
| 181 | Ga0395905_0000148 | 3300037471 | Bacteria | 116301 |
| 182 | Ga0395905_0000382 | 3300037471 | Bacteria | 63066 |
| 183 | Ga0395905_0011410 | 3300037471 | Bacteria | 8585 |
| 184 | Ga0395905_0271571 | 3300037471 | Bacteria | 1581 |
| 185 | Ga0395905_0311945 | 3300037471 | Bacteria | 1461 |
| 186 | Ga0395905_0495659 | 3300037471 | Bacteria | 1121 |
| 187 | Ga0395901_0004739 | 3300038443 | Bacteria | 13727 |
| 188 | Ga0395901_0024783 | 3300038443 | Bacteria | 6159 |
| 189 | Ga0439438_002381 | 3300041405 | Bacteria | 8017 |
| 190 | Ga0439439_0060599 | 3300041406 | Bacteria | 1004 |
| 191 | Ga0439447_000475 | 3300041407 | Bacteria | 14959 |
| 192 | Ga0439466_0000127 | 3300041411 | Bacteria | 29566 |
| 193 | Ga0439441_002458 | 3300042001 | Bacteria | 2614 |
| 194 | Ga0439432_000437 | 3300042006 | Bacteria | 15500 |
| 195 | Ga0439449_0022142 | 3300042007 | Bacteria | 2378 |
| 196 | Ga0439451_001062 | 3300042009 | Bacteria | 5351 |
| 197 | Ga0439452_016746 | 3300042010 | Bacteria | 1984 |
| 198 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 199 | Ga0450909_000028 | 3300042185 | Bacteria | 11174 |
| 200 | Ga0439434_0000001 | 3300042435 | Bacteria | 86314 |
| 201 | Ga0450901_001068 | 3300042533 | Bacteria | 3180 |
| 202 | Ga0439440_0006387 | 3300042993 | Bacteria | 2369 |
| 203 | Ga0466961_0017663 | 3300044693 | Bacteria | 4583 |
| 204 | Ga0495617_002511 | 3300046452 | Bacteria | 7264 |
| 205 | Ga0495617_009243 | 3300046452 | Bacteria | 3384 |
| 206 | Ga0495627_000028 | 3300046453 | Bacteria | 234737 |
| 207 | Ga0495627_007667 | 3300046453 | Bacteria | 4119 |
| 208 | Ga0495627_009686 | 3300046453 | Bacteria | 3536 |
| 209 | Ga0495603_0020661 | 3300046455 | Bacteria | 3988 |
| 210 | Ga0495591_000278 | 3300046458 | Bacteria | 47734 |
| 211 | Ga0495591_000489 | 3300046458 | Bacteria | 31345 |
| 212 | Ga0495591_003441 | 3300046458 | Bacteria | 8177 |
| 213 | Ga0495591_022781 | 3300046458 | Bacteria | 2018 |
| 214 | Ga0495638_0062725 | 3300046460 | Bacteria | 2293 |
| 215 | Ga0495638_0155651 | 3300046460 | Bacteria | 1322 |
| 216 | Ga0495650_0000052 | 3300046471 | Bacteria | 318176 |
| 217 | Ga0495650_0003829 | 3300046471 | Bacteria | 10688 |
| 218 | Ga0495650_0022298 | 3300046471 | Bacteria | 3040 |
| 219 | Ga0495605_0003170 | 3300046474 | Bacteria | 9885 |
| 220 | Ga0495605_0105235 | 3300046474 | Bacteria | 1292 |
| 221 | Ga0495639_0048998 | 3300046475 | Bacteria | 1917 |
| 222 | Ga0495584_0001788 | 3300046491 | Bacteria | 12501 |
| 223 | Ga0495585_0005306 | 3300046492 | Bacteria | 8136 |
| 224 | Ga0495594_0004492 | 3300046499 | Bacteria | 7173 |
| 225 | Ga0495596_0000105 | 3300046500 | Bacteria | 59665 |
| 226 | Ga0495607_0000812 | 3300046501 | Bacteria | 29512 |
| 227 | Ga0495607_0001096 | 3300046501 | Bacteria | 24697 |
| 228 | Ga0495607_0004786 | 3300046501 | Bacteria | 9883 |
| 229 | Ga0495607_0008073 | 3300046501 | Bacteria | 7225 |
| 230 | Ga0495583_0000518 | 3300046506 | Bacteria | 54833 |
| 231 | Ga0495583_0009055 | 3300046506 | Bacteria | 5997 |
| 232 | Ga0495606_0000238 | 3300046507 | Bacteria | 96877 |
| 233 | Ga0495606_0037354 | 3300046507 | Bacteria | 3299 |
| 234 | Ga0495608_0232467 | 3300046511 | Bacteria | 1154 |
| 235 | Ga0495610_0007437 | 3300046512 | Bacteria | 7286 |
| 236 | Ga0495610_0011746 | 3300046512 | Bacteria | 5322 |
| 237 | Ga0495610_0062607 | 3300046512 | Bacteria | 1764 |
| 238 | Ga0495610_0085343 | 3300046512 | Bacteria | 1441 |
| 239 | Ga0495616_0006414 | 3300046513 | Bacteria | 7112 |
| 240 | Ga0495616_0057950 | 3300046513 | Bacteria | 1908 |
| 241 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 242 | Ga0495620_0001333 | 3300046515 | Bacteria | 14988 |
| 243 | Ga0495632_0000186 | 3300046519 | Bacteria | 63352 |
| 244 | Ga0495632_0006295 | 3300046519 | Bacteria | 7665 |
| 245 | Ga0495632_0041656 | 3300046519 | Bacteria | 2306 |
| 246 | Ga0495632_0130717 | 3300046519 | Bacteria | 1168 |
| 247 | Ga0495637_0000079 | 3300046520 | Bacteria | 74961 |
| 248 | Ga0495637_0000168 | 3300046520 | Bacteria | 50579 |
| 249 | Ga0495637_0016527 | 3300046520 | Bacteria | 3448 |
| 250 | Ga0495643_0000319 | 3300046522 | Bacteria | 66471 |
| 251 | Ga0495643_0000847 | 3300046522 | Bacteria | 33152 |
| 252 | Ga0495644_0001134 | 3300046523 | Bacteria | 10925 |
| 253 | Ga0495644_0004683 | 3300046523 | Bacteria | 5374 |
| 254 | Ga0495644_0032223 | 3300046523 | Bacteria | 1980 |
| 255 | Ga0495648_0000869 | 3300046524 | Bacteria | 31890 |
| 256 | Ga0495648_0010454 | 3300046524 | Bacteria | 7066 |
| 257 | Ga0495648_0044481 | 3300046524 | Bacteria | 2771 |
| 258 | Ga0495648_0092426 | 3300046524 | Bacteria | 1689 |
| 259 | Ga0495642_0001429 | 3300046528 | Bacteria | 10696 |
| 260 | Ga0495654_0002037 | 3300046530 | Bacteria | 13265 |
| 261 | Ga0495654_0005494 | 3300046530 | Bacteria | 7344 |
| 262 | Ga0495654_0074943 | 3300046530 | Bacteria | 1597 |
| 263 | Ga0495609_0000211 | 3300046538 | Bacteria | 58163 |
| 264 | Ga0495621_0026045 | 3300046539 | Bacteria | 1969 |
| 265 | Ga0495597_0004162 | 3300046542 | Bacteria | 8025 |
| 266 | Ga0495597_0014427 | 3300046542 | Bacteria | 3764 |
| 267 | Ga0495597_0041828 | 3300046542 | Bacteria | 2045 |
| 268 | Ga0495597_0071833 | 3300046542 | Bacteria | 1489 |
| 269 | Ga0495622_0000950 | 3300046557 | Bacteria | 15527 |
| 270 | Ga0495622_0001653 | 3300046557 | Bacteria | 11021 |
| 271 | Ga0495656_0022259 | 3300046615 | Bacteria | 2480 |
| 272 | Ga0495668_0000379 | 3300046616 | Bacteria | 58955 |
| 273 | Ga0495634_0127426 | 3300046642 | Bacteria | 1626 |
| 274 | Ga0495625_0010604 | 3300046660 | Bacteria | 7603 |
| 275 | Ga0495625_0057932 | 3300046660 | Bacteria | 2753 |
| 276 | Ga0495625_0121762 | 3300046660 | Bacteria | 1774 |
| 277 | Ga0495659_0010559 | 3300046664 | Bacteria | 2966 |
| 278 | Ga0495661_0044355 | 3300046665 | Bacteria | 2726 |
| 279 | Ga0495661_0106629 | 3300046665 | Bacteria | 1567 |
| 280 | Ga0495661_0159001 | 3300046665 | Bacteria | 1214 |
| 281 | Ga0495588_0021450 | 3300046674 | Bacteria | 3182 |
| 282 | Ga0495670_0005984 | 3300046691 | Bacteria | 5955 |
| 283 | Ga0495670_0009663 | 3300046691 | Bacteria | 4740 |
| 284 | Ga0495670_0198707 | 3300046691 | Bacteria | 1061 |
| 285 | Ga0495671_0005830 | 3300046692 | Bacteria | 7174 |
| 286 | Ga0495671_0040098 | 3300046692 | Bacteria | 2362 |
| 287 | Ga0495671_0056755 | 3300046692 | Bacteria | 1938 |
| 288 | Ga0495649_0031644 | 3300046694 | Bacteria | 2916 |
| 289 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 290 | Ga0495660_0000006 | 3300046810 | Bacteria | 571713 |
| 291 | Ga0495660_0001337 | 3300046810 | Bacteria | 16979 |
| 292 | Ga0495660_0006140 | 3300046810 | Bacteria | 7132 |
| 293 | Ga0495660_0007880 | 3300046810 | Bacteria | 6255 |
| 294 | Ga0495660_0008972 | 3300046810 | Bacteria | 5842 |
| 295 | Ga0495660_0025741 | 3300046810 | Bacteria | 3339 |
| 296 | Ga0495672_0003101 | 3300047320 | Bacteria | 14516 |
| 297 | Ga0495672_0045407 | 3300047320 | Bacteria | 2628 |
| 298 | Ga0495683_0000006 | 3300047323 | Bacteria | 272409 |
| 299 | Ga0495683_0004073 | 3300047323 | Bacteria | 8373 |
| 300 | Ga0495683_0010515 | 3300047323 | Bacteria | 4885 |
| 301 | Ga0495683_0011994 | 3300047323 | Bacteria | 4554 |
| 302 | Ga0495679_003203 | 3300047446 | Bacteria | 7960 |
| 303 | Ga0495673_0000429 | 3300047469 | Bacteria | 47646 |
| 304 | Ga0495673_0012195 | 3300047469 | Bacteria | 4573 |
| 305 | Ga0495673_0031708 | 3300047469 | Bacteria | 2472 |
| 306 | Ga0495673_0032001 | 3300047469 | Bacteria | 2457 |
| 307 | Ga0495673_0040817 | 3300047469 | Bacteria | 2092 |
| 308 | Ga0495673_0041288 | 3300047469 | Bacteria | 2077 |
| 309 | Ga0495681_0000628 | 3300047470 | Bacteria | 26907 |
| 310 | Ga0495681_0012310 | 3300047470 | Bacteria | 5035 |
| 311 | Ga0495681_0023969 | 3300047470 | Bacteria | 3226 |
| 312 | Ga0495681_0081043 | 3300047470 | Bacteria | 1449 |
| 313 | Ga0495686_0023469 | 3300047472 | Bacteria | 4067 |
| 314 | Ga0495686_0109329 | 3300047472 | Bacteria | 1659 |
| 315 | Ga0495593_0071543 | 3300047673 | Bacteria | 1801 |
| 316 | Ga0495626_0000112 | 3300048091 | Bacteria | 105221 |
| 317 | Ga0495626_0000302 | 3300048091 | Bacteria | 52509 |
| 318 | Ga0496100_0395904 | 3300048903 | Bacteria | 1051 |
| 319 | Ga0496104_0031273 | 3300048907 | Bacteria | 4949 |
| 320 | Ga0496104_0287270 | 3300048907 | Bacteria | 1557 |
| 321 | Ga0496110_0139045 | 3300048913 | Bacteria | 2195 |
| 322 | Ga0496110_0520920 | 3300048913 | Bacteria | 1081 |
| 323 | Ga0496114_0022202 | 3300048917 | Bacteria | 5170 |
| 324 | Ga0496114_0090444 | 3300048917 | Bacteria | 2598 |
| 325 | Ga0496116_0000020 | 3300048919 | Bacteria | 501307 |
| 326 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 327 | Ga0496117_0001008 | 3300048920 | Bacteria | 43122 |
| 328 | Ga0496117_0004528 | 3300048920 | Bacteria | 15243 |
| 329 | Ga0496117_0055276 | 3300048920 | Bacteria | 2774 |
| 330 | Ga0496117_0069704 | 3300048920 | Bacteria | 2366 |
| 331 | Ga0496118_0000048 | 3300048921 | Bacteria | 253404 |
| 332 | Ga0496118_0007922 | 3300048921 | Bacteria | 11117 |
| 333 | Ga0496118_0017181 | 3300048921 | Bacteria | 6599 |
| 334 | Ga0496118_0068804 | 3300048921 | Bacteria | 2568 |
| 335 | Ga0496118_0140518 | 3300048921 | Bacteria | 1531 |
| 336 | Ga0496118_0197286 | 3300048921 | Bacteria | 1196 |
| 337 | Ga0496119_0000444 | 3300048922 | Bacteria | 56759 |
| 338 | Ga0496119_0004637 | 3300048922 | Bacteria | 13561 |
| 339 | Ga0496120_0000084 | 3300048923 | Bacteria | 156678 |
| 340 | Ga0496120_0000114 | 3300048923 | Bacteria | 136671 |
| 341 | Ga0496120_0000427 | 3300048923 | Bacteria | 66859 |
| 342 | Ga0496120_0001654 | 3300048923 | Bacteria | 25753 |
| 343 | Ga0496120_0036800 | 3300048923 | Bacteria | 2908 |
| 344 | Ga0496122_0000010 | 3300048925 | Bacteria | 547417 |
| 345 | Ga0496122_0001805 | 3300048925 | Bacteria | 32793 |
| 346 | Ga0496123_0000025 | 3300048926 | Bacteria | 323956 |
| 347 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 348 | Ga0496124_0000042 | 3300048927 | Bacteria | 301126 |
| 349 | Ga0496124_0002470 | 3300048927 | Bacteria | 24168 |
| 350 | Ga0496124_0005746 | 3300048927 | Bacteria | 13807 |
| 351 | Ga0496124_0108248 | 3300048927 | Bacteria | 2241 |
| 352 | Ga0496124_0321980 | 3300048927 | Bacteria | 1106 |
| 353 | Ga0496125_0000900 | 3300048928 | Bacteria | 46994 |
| 354 | Ga0496125_0003996 | 3300048928 | Bacteria | 17343 |
| 355 | Ga0496125_0025869 | 3300048928 | Bacteria | 5363 |
| 356 | Ga0496126_0000743 | 3300048929 | Bacteria | 59032 |
| 357 | Ga0496126_0474474 | 3300048929 | Bacteria | 1003 |
| 358 | Ga0495678_047627 | 3300049459 | Bacteria | 1677 |
| 359 | Ga0495682_0012611 | 3300049460 | Bacteria | 3237 |
| 360 | Ga0495682_0020529 | 3300049460 | Bacteria | 2479 |
| 361 | Ga0501036_0034729 | 3300049572 | Bacteria | 4266 |
| 362 | Ga0501047_0004504 | 3300049581 | Bacteria | 13108 |
| 363 | Ga0501080_0164724 | 3300049742 | Bacteria | 2046 |
| 364 | Ga0501080_0180383 | 3300049742 | Bacteria | 1943 |
| 365 | Ga0501241_000050 | 3300049758 | Bacteria | 32501 |
| 366 | Ga0501035_0096716 | 3300049822 | Bacteria | 2594 |
| 367 | Ga0501044_0012817 | 3300049823 | Bacteria | 9078 |
| 368 | nmdc:mga06r32_104372_c1 | 3300050510 | Bacteria | 2783 |
| 369 | nmdc:mga08y16_95113_c1 | 3300050511 | Bacteria | 3103 |
| 370 | nmdc:mga08x19_118094_c1 | 3300050514 | Bacteria | 1775 |
| 371 | Ga0500659_0003591 | 3300053135 | Bacteria | 9032 |
| 372 | Ga0500616_0041857 | 3300053153 | Bacteria | 2456 |
| 373 | 2506577392 | 2506520007 | Bacteria | 5442880 |
| 374 | 2506582530 | 2506520008 | Bacteria | 5443009 |
| 375 | 2508851340 | 2508501071 | Bacteria | 5454741 |
| 376 | 2511291530 | 2511231010 | Bacteria | 6373152 |
| 377 | 2548848558 | 2547132512 | Bacteria | 3416496 |
| 378 | 2555244793 | 2554235231 | Bacteria | 5215788 |
| 379 | 2585827187 | 2585427591 | Bacteria | 5482980 |
| 380 | 2585833242 | 2585427592 | Bacteria | 5370892 |
| 381 | 2601796912 | 2600255318 | Bacteria | 6383414 |
| 382 | 2606076362 | 2603880185 | Bacteria | 6379190 |
| 383 | 2606131273 | 2603880199 | Bacteria | 6377649 |
| 384 | 2624481198 | 2623620443 | Bacteria | 6427864 |
| 385 | 2656278309 | 2654587920 | Bacteria | 5475511 |
| 386 | 2671107676 | 2667528173 | Bacteria | 5375747 |
| 387 | 2689443869 | 2687453601 | Bacteria | 5546041 |
| 388 | 2715755699 | 2713897149 | Bacteria | 6506249 |
| 389 | 2772437906 | 2772190666 | Bacteria | 5117644 |
| 390 | 2793405680 | 2791355275 | Bacteria | 4429597 |
| 391 | 2807179067 | 2806310673 | Bacteria | 4801221 |
| 392 | 2847090816 | 2847085930 | Bacteria | 5070450 |
| 393 | 2869553255 | 2869551831 | Bacteria | 5474685 |
| 394 | 2878033147 | 2878029506 | Bacteria | 6418441 |
| 395 | 2881928337 | 2881927736 | Bacteria | 3993927 |
| 396 | 2884090335 | 2884086401 | Bacteria | 5005459 |
| 397 | 2888367905 | 2888366609 | Bacteria | 5155009 |
| 398 | 2888374439 | 2888373701 | Bacteria | 5098052 |
| 399 | 2904476669 | 2904474040 | Bacteria | 5504324 |
| 400 | 2919067129 | 2919063839 | Bacteria | 6302690 |
| 401 | 2919152838 | 2919150387 | Bacteria | 5500879 |
| 402 | 2919159958 | 2919155634 | Bacteria | 4860545 |
| 403 | 2919691601 | 2919688452 | Bacteria | 4595932 |
| 404 | 2927146799 | 2927143783 | Bacteria | 5504251 |
| 405 | 2932408584 | 2932406140 | Bacteria | 5134491 |
| 406 | 2937969638 | 2937967321 | Bacteria | 5094075 |
| 407 | 2939578976 | 2939577877 | Bacteria | 5132791 |
| 408 | 2939603683 | 2939602548 | Bacteria | 4950493 |
| 409 | 3000380387 | 3000376612 | Bacteria | 4705565 |
| 410 | 3007806455 | 3007803356 | Bacteria | 5931491 |
| 411 | 3007876380 | 3007872151 | Bacteria | 5268868 |
| 412 | 640936897 | 640753048 | Bacteria | 5495657 |
| 413 | 8004594890 | 8004592986 | Bacteria | 5122074 |
| 414 | 8015399437 | 8015394850 | Bacteria | 5064660 |
| 415 | 8052495888 | 8052494512 | Bacteria | 5765634 |
| 416 | 8056117638 | 8056115690 | Bacteria | 5527654 |
| 417 | 8056138806 | 8056137416 | Bacteria | 6147080 |
| 418 | Ga0373937_0091512 | |||
| 419 | MRS2a_Contig_163 | |||
| 420 | SwRhRL2b_contig_1021101 | |||
| 421 | SwRhRL2b_contig_667037 | |||
| 422 | MBSR1b_contig_14367964 | |||
| 423 | JGI25162J39368_1000010 | |||
| 424 | JGI25162J39368_1000893 | |||
| 425 | JGI25163J39215_1000005 | |||
| 426 | JGI25164J39214_1000003 | |||
| 427 | JGI25152J39213_1000607 | |||
| 428 | rootL2_10073820 | |||
| 429 | Ga0055538_1000009 | |||
| 430 | Ga0055539_1000013 | |||
| 431 | Ga0055533_1000017 | |||
| 432 | Ga0055532_1001248 | |||
| 433 | Ga0055525_1000019 | |||
| 434 | Ga0055536_1000037 | |||
| 435 | Ga0055530_10000674 | |||
| 436 | Ga0055540_1000025 | |||
| 437 | Ga0055531_10000301 | |||
| 438 | Ga0055541_1000010 | |||
| 439 | Ga0058692_1000110 | |||
| 440 | Ga0058692_1000411 | |||
| 441 | Ga0065703_1019097 | |||
| 442 | Ga0065714_10000081 | |||
| 443 | Ga0065714_10076528 | |||
| 444 | Ga0065704_10000634 | |||
| 445 | Ga0065704_10005427 | |||
| 446 | Ga0065704_10185361 | |||
| 447 | Ga0065712_10003209 | |||
| 448 | Ga0065715_10114620 | |||
| 449 | Ga0065707_10150707 | |||
| 450 | Ga0065707_10260304 | |||
| 451 | Ga0070689_100057213 | |||
| 452 | Ga0070687_100344673 | |||
| 453 | Ga0070669_100016153 | |||
| 454 | Ga0070688_100072990 | |||
| 455 | Ga0070667_100277851 | |||
| 456 | Ga0070706_100563899 | |||
| 457 | Ga0068857_100244065 | |||
| 458 | Ga0068859_100077581 | |||
| 459 | Ga0068859_100128144 | |||
| 460 | Ga0068863_100026287 | |||
| 461 | Ga0068863_100183501 | |||
| 462 | Ga0068862_100093172 | |||
| 463 | Ga0068862_100230327 | |||
| 464 | Ga0075432_10053293 | |||
| 465 | Ga0075362_10058002 | |||
| 466 | Ga0075367_10028727 | |||
| 467 | Ga0075436_100189665 | |||
| 468 | Ga0097620_100077576 | |||
| 469 | Ga0097620_100128142 | |||
| 470 | Ga0099823_1022967 | |||
| 471 | Ga0099823_1067284 | |||
| 472 | Ga0079104_1000734 | |||
| 473 | Ga0079104_1008724 | |||
| 474 | Ga0105251_10000262 | |||
| 475 | Ga0105251_10007265 | |||
| 476 | Ga0105251_10013215 | |||
| 477 | Ga0105251_10043837 | |||
| 478 | Ga0105251_10060938 | |||
| 479 | Ga0105251_10081380 | |||
| 480 | Ga0105251_10089943 | |||
| 481 | Ga0105244_10000039 | |||
| 482 | Ga0105244_10000826 | |||
| 483 | Ga0105244_10001374 | |||
| 484 | Ga0105244_10004422 | |||
| 485 | Ga0105244_10015538 | |||
| 486 | Ga0105244_10034245 | |||
| 487 | Ga0105244_10052073 | |||
| 488 | Ga0105244_10095602 | |||
| 489 | Ga0105244_10130289 | |||
| 490 | Ga0105250_10000363 | |||
| 491 | Ga0105250_10002959 | |||
| 492 | Ga0105250_10060560 | |||
| 493 | Ga0105250_10088074 | |||
| 494 | Ga0105250_10109433 | |||
| 495 | Ga0111539_10624979 | |||
| 496 | Ga0105247_10000018 | |||
| 497 | Ga0105243_10067248 | |||
| 498 | Ga0105241_10000004 | |||
| 499 | Ga0105248_10066802 | |||
| 500 | Ga0105249_10576278 | |||
| 501 | Ga0105239_10006132 | |||
| 502 | Ga0105246_10252502 | |||
| 503 | Ga0157373_10051228 | |||
| 504 | Ga0157373_10095140 | |||
| 505 | Ga0157371_10000252 | |||
| 506 | Ga0157370_10038426 | |||
| 507 | Ga0157370_10070850 | |||
| 508 | Ga0157369_10038528 | |||
| 509 | Ga0157372_10034560 | |||
| 510 | Ga0157372_10053417 | |||
| 511 | Ga0163163_10000197 | |||
| 512 | Ga0182008_10001389 | |||
| 513 | Ga0182008_10050116 | |||
| 514 | Ga0182008_10052792 | |||
| 515 | Ga0182006_1000047 | |||
| 516 | Ga0182006_1042010 | |||
| 517 | Ga0163161_10000001 | |||
| 518 | Ga0163161_10047275 | |||
| 519 | Ga0209760_100008 | |||
| 520 | Ga0209784_100012 | |||
| 521 | Ga0209566_100010 | |||
| 522 | Ga0209674_100023 | |||
| 523 | Ga0209563_100027 | |||
| 524 | Ga0207427_100017 | |||
| 525 | Ga0209437_100029 | |||
| 526 | Ga0209437_100117 | |||
| 527 | Ga0209677_100014 | |||
| 528 | Ga0209233_1001710 | |||
| 529 | Ga0209565_1042813 | |||
| 530 | Ga0209675_1012906 | |||
| 531 | Ga0209676_1000002 | |||
| 532 | Ga0209676_1000803 | |||
| 533 | Ga0209676_1019300 | |||
| 534 | Ga0209050_1000006 | |||
| 535 | Ga0209050_1000148 | |||
| 536 | Ga0209051_1000001 | |||
| 537 | Ga0209051_1014695 | |||
| 538 | Ga0209257_1000056 | |||
| 539 | Ga0207696_1000001 | |||
| 540 | Ga0207696_1000144 | |||
| 541 | Ga0207696_1000488 | |||
| 542 | Ga0207696_1003166 | |||
| 543 | Ga0207696_1039253 | |||
| 544 | Ga0207696_1064682 | |||
| 545 | Ga0207655_1000011 | |||
| 546 | Ga0207655_1000030 | |||
| 547 | Ga0207655_1000090 | |||
| 548 | Ga0207655_1000183 | |||
| 549 | Ga0207655_1000501 | |||
| 550 | Ga0207655_1000786 | |||
| 551 | Ga0207655_1008146 | |||
| 552 | Ga0207655_1008755 | |||
| 553 | Ga0207655_1023928 | |||
| 554 | Ga0207655_1077289 | |||
| 555 | Ga0207713_1000024 | |||
| 556 | Ga0207713_1000026 | |||
| 557 | Ga0207713_1000459 | |||
| 558 | Ga0207713_1000551 | |||
| 559 | Ga0207713_1000698 | |||
| 560 | Ga0207713_1005272 | |||
| 561 | Ga0207713_1007651 | |||
| 562 | Ga0207713_1037535 | |||
| 563 | Ga0207710_10000049 | |||
| 564 | Ga0207654_10000006 | |||
| 565 | Ga0207662_10084362 | |||
| 566 | Ga0207709_10039717 | |||
| 567 | Ga0207711_10040887 | |||
| 568 | Ga0207712_10023211 | |||
| 569 | Ga0207641_10044681 | |||
| 570 | Ga0207674_10182188 | |||
| 571 | Ga0209281_1000008 | |||
| 572 | Ga0209281_1011282 | |||
| 573 | Ga0209389_1000031 | |||
| 574 | Ga0209389_1077353 | |||
| 575 | Ga0209371_1000017 | |||
| 576 | Ga0209371_1000033 | |||
| 577 | Ga0209371_1000265 | |||
| 578 | Ga0209371_1001738 | |||
| 579 | Ga0207428_10096153 | |||
| 580 | Ga0268265_10037074 | |||
| 581 | Ga0268265_10169920 | |||
| 582 | Ga0265334_10000014 | |||
| 583 | Ga0265324_10000205 | |||
| 584 | Ga0268256_1000091 | |||
| 585 | Ga0268256_1000276 | |||
| 586 | Ga0268256_1001121 | |||
| 587 | Ga0265325_10086477 | |||
| 588 | Ga0265327_10000471 | |||
| 589 | Ga0265316_10303790 | |||
| 590 | Ga0316575_10014678 | |||
| 591 | Ga0265314_10000740 | |||
| 592 | Ga0316574_0053339 | |||
| 593 | Ga0373927_0000003 | |||
| 594 | Ga0373937_0312681 | |||
| 595 | Ga0316582_0001889 | |||
| 596 | Ga0395899_0000992 | |||
| 597 | Ga0395900_0008351 | |||
| 598 | Ga0395905_0000148 | |||
| 599 | Ga0395905_0000382 | |||
| 600 | Ga0395905_0011410 | |||
| 601 | Ga0395905_0271571 | |||
| 602 | Ga0395905_0311945 | |||
| 603 | Ga0395905_0495659 | |||
| 604 | Ga0395901_0004739 | |||
| 605 | Ga0395901_0024783 | |||
| 606 | Ga0439438_002381 | |||
| 607 | Ga0439439_0060599 | |||
| 608 | Ga0439447_000475 | |||
| 609 | Ga0439466_0000127 | |||
| 610 | Ga0439441_002458 | |||
| 611 | Ga0439432_000437 | |||
| 612 | Ga0439449_0022142 | |||
| 613 | Ga0439451_001062 | |||
| 614 | Ga0439452_016746 | |||
| 615 | Ga0450907_000001 | |||
| 616 | Ga0450909_000028 | |||
| 617 | Ga0439434_0000001 | |||
| 618 | Ga0450901_001068 | |||
| 619 | Ga0439440_0006387 | |||
| 620 | Ga0466961_0017663 | |||
| 621 | Ga0495617_002511 | |||
| 622 | Ga0495617_009243 | |||
| 623 | Ga0495627_000028 | |||
| 624 | Ga0495627_007667 | |||
| 625 | Ga0495627_009686 | |||
| 626 | Ga0495603_0020661 | |||
| 627 | Ga0495591_000278 | |||
| 628 | Ga0495591_000489 | |||
| 629 | Ga0495591_003441 | |||
| 630 | Ga0495591_022781 | |||
| 631 | Ga0495638_0062725 | |||
| 632 | Ga0495638_0155651 | |||
| 633 | Ga0495650_0000052 | |||
| 634 | Ga0495650_0003829 | |||
| 635 | Ga0495650_0022298 | |||
| 636 | Ga0495605_0003170 | |||
| 637 | Ga0495605_0105235 | |||
| 638 | Ga0495639_0048998 | |||
| 639 | Ga0495584_0001788 | |||
| 640 | Ga0495585_0005306 | |||
| 641 | Ga0495594_0004492 | |||
| 642 | Ga0495596_0000105 | |||
| 643 | Ga0495607_0000812 | |||
| 644 | Ga0495607_0001096 | |||
| 645 | Ga0495607_0004786 | |||
| 646 | Ga0495607_0008073 | |||
| 647 | Ga0495583_0000518 | |||
| 648 | Ga0495583_0009055 | |||
| 649 | Ga0495606_0000238 | |||
| 650 | Ga0495606_0037354 | |||
| 651 | Ga0495608_0232467 | |||
| 652 | Ga0495610_0007437 | |||
| 653 | Ga0495610_0011746 | |||
| 654 | Ga0495610_0062607 | |||
| 655 | Ga0495610_0085343 | |||
| 656 | Ga0495616_0006414 | |||
| 657 | Ga0495616_0057950 | |||
| 658 | Ga0495620_0000003 | |||
| 659 | Ga0495620_0001333 | |||
| 660 | Ga0495632_0000186 | |||
| 661 | Ga0495632_0006295 | |||
| 662 | Ga0495632_0041656 | |||
| 663 | Ga0495632_0130717 | |||
| 664 | Ga0495637_0000079 | |||
| 665 | Ga0495637_0000168 | |||
| 666 | Ga0495637_0016527 | |||
| 667 | Ga0495643_0000319 | |||
| 668 | Ga0495643_0000847 | |||
| 669 | Ga0495644_0001134 | |||
| 670 | Ga0495644_0004683 | |||
| 671 | Ga0495644_0032223 | |||
| 672 | Ga0495648_0000869 | |||
| 673 | Ga0495648_0010454 | |||
| 674 | Ga0495648_0044481 | |||
| 675 | Ga0495648_0092426 | |||
| 676 | Ga0495642_0001429 | |||
| 677 | Ga0495654_0002037 | |||
| 678 | Ga0495654_0005494 | |||
| 679 | Ga0495654_0074943 | |||
| 680 | Ga0495609_0000211 | |||
| 681 | Ga0495621_0026045 | |||
| 682 | Ga0495597_0004162 | |||
| 683 | Ga0495597_0014427 | |||
| 684 | Ga0495597_0041828 | |||
| 685 | Ga0495597_0071833 | |||
| 686 | Ga0495622_0000950 | |||
| 687 | Ga0495622_0001653 | |||
| 688 | Ga0495656_0022259 | |||
| 689 | Ga0495668_0000379 | |||
| 690 | Ga0495634_0127426 | |||
| 691 | Ga0495625_0010604 | |||
| 692 | Ga0495625_0057932 | |||
| 693 | Ga0495625_0121762 | |||
| 694 | Ga0495659_0010559 | |||
| 695 | Ga0495661_0044355 | |||
| 696 | Ga0495661_0106629 | |||
| 697 | Ga0495661_0159001 | |||
| 698 | Ga0495588_0021450 | |||
| 699 | Ga0495670_0005984 | |||
| 700 | Ga0495670_0009663 | |||
| 701 | Ga0495670_0198707 | |||
| 702 | Ga0495671_0005830 | |||
| 703 | Ga0495671_0040098 | |||
| 704 | Ga0495671_0056755 | |||
| 705 | Ga0495649_0031644 | |||
| 706 | Ga0495589_0000002 | |||
| 707 | Ga0495660_0000006 | |||
| 708 | Ga0495660_0001337 | |||
| 709 | Ga0495660_0006140 | |||
| 710 | Ga0495660_0007880 | |||
| 711 | Ga0495660_0008972 | |||
| 712 | Ga0495660_0025741 | |||
| 713 | Ga0495672_0003101 | |||
| 714 | Ga0495672_0045407 | |||
| 715 | Ga0495683_0000006 | |||
| 716 | Ga0495683_0004073 | |||
| 717 | Ga0495683_0010515 | |||
| 718 | Ga0495683_0011994 | |||
| 719 | Ga0495679_003203 | |||
| 720 | Ga0495673_0000429 | |||
| 721 | Ga0495673_0012195 | |||
| 722 | Ga0495673_0031708 | |||
| 723 | Ga0495673_0032001 | |||
| 724 | Ga0495673_0040817 | |||
| 725 | Ga0495673_0041288 | |||
| 726 | Ga0495681_0000628 | |||
| 727 | Ga0495681_0012310 | |||
| 728 | Ga0495681_0023969 | |||
| 729 | Ga0495681_0081043 | |||
| 730 | Ga0495686_0023469 | |||
| 731 | Ga0495686_0109329 | |||
| 732 | Ga0495593_0071543 | |||
| 733 | Ga0495626_0000112 | |||
| 734 | Ga0495626_0000302 | |||
| 735 | Ga0496100_0395904 | |||
| 736 | Ga0496104_0031273 | |||
| 737 | Ga0496104_0287270 | |||
| 738 | Ga0496110_0139045 | |||
| 739 | Ga0496110_0520920 | |||
| 740 | Ga0496114_0022202 | |||
| 741 | Ga0496114_0090444 | |||
| 742 | Ga0496116_0000020 | |||
| 743 | Ga0496116_0000023 | |||
| 744 | Ga0496117_0001008 | |||
| 745 | Ga0496117_0004528 | |||
| 746 | Ga0496117_0055276 | |||
| 747 | Ga0496117_0069704 | |||
| 748 | Ga0496118_0000048 | |||
| 749 | Ga0496118_0007922 | |||
| 750 | Ga0496118_0017181 | |||
| 751 | Ga0496118_0068804 | |||
| 752 | Ga0496118_0140518 | |||
| 753 | Ga0496118_0197286 | |||
| 754 | Ga0496119_0000444 | |||
| 755 | Ga0496119_0004637 | |||
| 756 | Ga0496120_0000084 | |||
| 757 | Ga0496120_0000114 | |||
| 758 | Ga0496120_0000427 | |||
| 759 | Ga0496120_0001654 | |||
| 760 | Ga0496120_0036800 | |||
| 761 | Ga0496122_0000010 | |||
| 762 | Ga0496122_0001805 | |||
| 763 | Ga0496123_0000025 | |||
| 764 | Ga0496124_0000017 | |||
| 765 | Ga0496124_0000042 | |||
| 766 | Ga0496124_0002470 | |||
| 767 | Ga0496124_0005746 | |||
| 768 | Ga0496124_0108248 | |||
| 769 | Ga0496124_0321980 | |||
| 770 | Ga0496125_0000900 | |||
| 771 | Ga0496125_0003996 | |||
| 772 | Ga0496125_0025869 | |||
| 773 | Ga0496126_0000743 | |||
| 774 | Ga0496126_0474474 | |||
| 775 | Ga0495678_047627 | |||
| 776 | Ga0495682_0012611 | |||
| 777 | Ga0495682_0020529 | |||
| 778 | Ga0501036_0034729 | |||
| 779 | Ga0501047_0004504 | |||
| 780 | Ga0501080_0164724 | |||
| 781 | Ga0501080_0180383 | |||
| 782 | Ga0501241_000050 | |||
| 783 | Ga0501035_0096716 | |||
| 784 | Ga0501044_0012817 | |||
| 785 | nmdc:mga06r32_104372_c1 | |||
| 786 | nmdc:mga08y16_95113_c1 | |||
| 787 | nmdc:mga08x19_118094_c1 | |||
| 788 | Ga0500659_0003591 | |||
| 789 | Ga0500616_0041857 | |||
| 790 | 2506577392 | |||
| 791 | 2506582530 | |||
| 792 | 2508851340 | |||
| 793 | 2511291530 | |||
| 794 | 2548848558 | |||
| 795 | 2555244793 | |||
| 796 | 2585827187 | |||
| 797 | 2585833242 | |||
| 798 | 2601796912 | |||
| 799 | 2606076362 | |||
| 800 | 2606131273 | |||
| 801 | 2624481198 | |||
| 802 | 2656278309 | |||
| 803 | 2671107676 | |||
| 804 | 2689443869 | |||
| 805 | 2715755699 | |||
| 806 | 2772437906 | |||
| 807 | 2793405680 | |||
| 808 | 2807179067 | |||
| 809 | 2847090816 | |||
| 810 | 2869553255 | |||
| 811 | 2878033147 | |||
| 812 | 2881928337 | |||
| 813 | 2884090335 | |||
| 814 | 2888367905 | |||
| 815 | 2888374439 | |||
| 816 | 2904476669 | |||
| 817 | 2919067129 | |||
| 818 | 2919152838 | |||
| 819 | 2919159958 | |||
| 820 | 2919691601 | |||
| 821 | 2927146799 | |||
| 822 | 2932408584 | |||
| 823 | 2937969638 | |||
| 824 | 2939578976 | |||
| 825 | 2939603683 | |||
| 826 | 3000380387 | |||
| 827 | 3007806455 | |||
| 828 | 3007876380 | |||
| 829 | 640936897 | |||
| 830 | 8004594890 | |||
| 831 | 8015399437 | |||
| 832 | 8052495888 | |||
| 833 | 8056117638 | |||
| 834 | 8056138806 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9892 | 5 | 251 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9873 | 4 | 260 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9812 | 5 | 251 |
| 5yoh-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine | 0.9788 | 7 | 251 |
| 5yxf-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine | 0.9787 | 7 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1J6Q1_1_201_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9876 | 51 | 251 | 3.90.230.10 |
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9872 | 4 | 260 | 3.90.230.10 |
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9839 | 17 | 126 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9813 | 4 | 252 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9806 | 7 | 251 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6F1R4-F1-model_v4 | deleted | 1.001 | 39 | 251 |
|
| AF-A0A3C0LYD4-F1-model_v4 | deleted | 1 | 106 | 206 |
|
| AF-A0A534CML8-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9997 | 4 | 253 |
GO:0004239
GO:0006508 GO:0008773 GO:0008893 GO:0046872 GO:0070006 |
| AF-A0A3M3I911-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9985 | 42 | 206 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A258LEB9-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9982 | 59 | 253 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |