F439140

General Info

Members Datasets Scaffolds Average Seq Length
417 237 834 142

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0028771|Ga0495632_0028771_1576_2079
Length 167
Sequence VPHRRTKNKSEKPFKQFSRMNYIYALPHLNATLNSISALLLITGYVYIRRGNIAAHRKCMLAAVITSTVFLACYVLYHSLLVYYLGQGPTRFRGVGWVRPLYFTILVTHTILAVVITPFVLVTLRRALRERFDKHRRIARWTFPAWLYVSVTGVVVYLMLYQIYPAR

Samples

Sample ID Description Type Environment
1 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 3.6
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 24.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495632_0028771 3300046519 Bacteria 2899
2 JGI24737J22298_10028557 3300001990 Bacteria 1753
3 JGI24743J22301_10000093 3300001991 Bacteria 8658
4 JGI24751J29686_10000635 3300002459 Bacteria 9014
5 Ga0065715_10002672 3300005293 Unclassified 4564
6 Ga0065707_10083430 3300005295 Bacteria 9217
7 Ga0065707_10179035 3300005295 Unclassified 1430
8 Ga0070658_10091494 3300005327 Unclassified 2507
9 Ga0070658_10465575 3300005327 Unclassified 1090
10 Ga0070658_10944038 3300005327 Bacteria 750
11 Ga0070676_10005283 3300005328 Bacteria 6866
12 Ga0070683_100001910 3300005329 Bacteria 16302
13 Ga0070683_100030127 3300005329 Bacteria 4921
14 Ga0070690_100003363 3300005330 Bacteria 8732
15 Ga0070670_100001939 3300005331 Bacteria 16933
16 Ga0070677_10000806 3300005333 Bacteria 10385
17 Ga0068869_100052848 3300005334 Unclassified 2951
18 Ga0070666_10008180 3300005335 Bacteria 6481
19 Ga0070680_100601405 3300005336 Bacteria 944
20 Ga0070682_100003286 3300005337 Bacteria 8968
21 Ga0068868_100037793 3300005338 Unclassified 3744
22 Ga0068868_100128486 3300005338 Bacteria 2072
23 Ga0070660_100004941 3300005339 Bacteria 9222
24 Ga0070660_101354666 3300005339 Bacteria 604
25 Ga0070689_100001082 3300005340 Bacteria 17081
26 Ga0070661_100009221 3300005344 Bacteria 6822
27 Ga0070692_10046515 3300005345 Unclassified 2243
28 Ga0070668_100004887 3300005347 Bacteria 9936
29 Ga0070669_100001365 3300005353 Bacteria 17595
30 Ga0070675_100219209 3300005354 Bacteria 1656
31 Ga0070674_100001337 3300005356 Bacteria 13002
32 Ga0070673_100009008 3300005364 Bacteria 6679
33 Ga0070688_100000289 3300005365 Bacteria 25802
34 Ga0070659_100002441 3300005366 Bacteria 13204
35 Ga0070659_100536358 3300005366 Unclassified 1000
36 Ga0070667_100156413 3300005367 Unclassified 2005
37 Ga0070667_100649496 3300005367 Bacteria 974
38 Ga0070709_10707649 3300005434 Bacteria 784
39 Ga0070713_100826269 3300005436 Bacteria 889
40 Ga0070701_10290057 3300005438 Bacteria 1002
41 Ga0070711_100675976 3300005439 Unclassified 867
42 Ga0070711_100683084 3300005439 Bacteria 863
43 Ga0070705_100130183 3300005440 Bacteria 1640
44 Ga0070705_100773388 3300005440 Unclassified 761
45 Ga0070705_101174897 3300005440 Bacteria 631
46 Ga0070694_100099479 3300005444 Bacteria 2055
47 Ga0070694_100100391 3300005444 Bacteria 2047
48 Ga0070708_100043028 3300005445 Bacteria 3968
49 Ga0070708_100372179 3300005445 Unclassified 1347
50 Ga0070708_101843159 3300005445 Unclassified 561
51 Ga0070663_100010379 3300005455 Bacteria 5805
52 Ga0070678_100002783 3300005456 Bacteria 9666
53 Ga0070678_100041704 3300005456 Bacteria 3256
54 Ga0070681_10042983 3300005458 Bacteria 4527
55 Ga0068867_100000749 3300005459 Bacteria 21787
56 Ga0068867_101003325 3300005459 Unclassified 757
57 Ga0070685_10001601 3300005466 Bacteria 11932
58 Ga0070706_100046889 3300005467 Bacteria 3989
59 Ga0070706_100120796 3300005467 Bacteria 2442
60 Ga0070706_100237808 3300005467 Bacteria 1701
61 Ga0070707_100020387 3300005468 Bacteria 6252
62 Ga0070707_101411574 3300005468 Bacteria 663
63 Ga0070707_101513535 3300005468 Bacteria 638
64 Ga0070698_100039220 3300005471 Bacteria 4876
65 Ga0070698_100067386 3300005471 Bacteria 3600
66 Ga0070698_100069430 3300005471 Unclassified 3537
67 Ga0070698_100242382 3300005471 Bacteria 1736
68 Ga0070698_100742663 3300005471 Bacteria 924
69 Ga0070698_100814774 3300005471 Unclassified 878
70 Ga0070699_100000005 3300005518 Bacteria 384287
71 Ga0070699_100005764 3300005518 Bacteria 10838
72 Ga0070699_100087717 3300005518 Bacteria 2717
73 Ga0070699_100532296 3300005518 Unclassified 1069
74 Ga0070699_100601759 3300005518 Unclassified 1002
75 Ga0070684_100001382 3300005535 Bacteria 17441
76 Ga0070684_100747236 3300005535 Bacteria 913
77 Ga0070697_100154262 3300005536 Unclassified 1938
78 Ga0070697_100516863 3300005536 Bacteria 1045
79 Ga0070697_100763668 3300005536 Bacteria 854
80 Ga0068853_100014023 3300005539 Bacteria 6558
81 Ga0068853_100028987 3300005539 Unclassified 4661
82 Ga0070672_100002640 3300005543 Bacteria 11462
83 Ga0070672_100985549 3300005543 Unclassified 746
84 Ga0070686_100002027 3300005544 Bacteria 11243
85 Ga0070696_100017804 3300005546 Bacteria 4796
86 Ga0070696_100130649 3300005546 Bacteria 1827
87 Ga0070696_100797079 3300005546 Unclassified 777
88 Ga0070693_100324015 3300005547 Bacteria 1046
89 Ga0070704_100004687 3300005549 Bacteria 7908
90 Ga0070704_100043629 3300005549 Bacteria 3110
91 Ga0070704_100215274 3300005549 Unclassified 1559
92 Ga0070704_100935635 3300005549 Unclassified 781
93 Ga0068855_100037048 3300005563 Bacteria 5803
94 Ga0068855_101589040 3300005563 Unclassified 669
95 Ga0070664_100006830 3300005564 Bacteria 9204
96 Ga0068857_100002750 3300005577 Bacteria 14452
97 Ga0068854_100607727 3300005578 Bacteria 934
98 Ga0068856_100018327 3300005614 Bacteria 6786
99 Ga0068856_100032928 3300005614 Bacteria 5076
100 Ga0068856_100884837 3300005614 Bacteria 912
101 Ga0070702_100006493 3300005615 Bacteria 5541
102 Ga0070702_100141906 3300005615 Bacteria 1531
103 Ga0068852_100005202 3300005616 Bacteria 9279
104 Ga0068852_100008847 3300005616 Bacteria 7449
105 Ga0068852_100464785 3300005616 Bacteria 1255
106 Ga0068852_100625698 3300005616 Bacteria 1082
107 Ga0068859_100000090 3300005617 Bacteria 83289
108 Ga0068859_100032315 3300005617 Bacteria 5257
109 Ga0068859_100048053 3300005617 Bacteria 4287
110 Ga0068859_100712607 3300005617 Bacteria 1094
111 Ga0068864_100003567 3300005618 Bacteria 12861
112 Ga0068864_100606263 3300005618 Unclassified 1063
113 Ga0068864_100830013 3300005618 Bacteria 910
114 Ga0068866_10001464 3300005718 Bacteria 10084
115 Ga0068866_10144924 3300005718 Unclassified 1368
116 Ga0068861_100002752 3300005719 Bacteria 11529
117 Ga0068861_101630039 3300005719 Unclassified 636
118 Ga0068851_10321684 3300005834 Bacteria 894
119 Ga0068870_10000606 3300005840 Bacteria 13652
120 Ga0068870_10030968 3300005840 Bacteria 2708
121 Ga0068870_10934605 3300005840 Bacteria 615
122 Ga0068863_100010061 3300005841 Bacteria 9204
123 Ga0068858_100006021 3300005842 Bacteria 11828
124 Ga0068860_100000720 3300005843 Bacteria 37733
125 Ga0068860_100047365 3300005843 Unclassified 4098
126 Ga0068862_100012134 3300005844 Bacteria 7121
127 Ga0068862_100083873 3300005844 Bacteria 2768
128 Ga0068862_100257644 3300005844 Bacteria 1591
129 Ga0081455_10067799 3300005937 Bacteria 2972
130 Ga0081455_10131109 3300005937 Bacteria 1960
131 Ga0081538_10021706 3300005981 Bacteria 4674
132 Ga0081538_10022115 3300005981 Bacteria 4619
133 Ga0081538_10225085 3300005981 Unclassified 739
134 Ga0070717_10000046 3300006028 Bacteria 106495
135 Ga0097621_100273544 3300006237 Bacteria 1485
136 Ga0068871_100014030 3300006358 Bacteria 5960
137 Ga0075428_101723894 3300006844 Unclassified 653
138 Ga0075430_100377366 3300006846 Unclassified 1170
139 Ga0075430_100513229 3300006846 Bacteria 989
140 Ga0075430_100851968 3300006846 Bacteria 751
141 Ga0075431_100004647 3300006847 Bacteria 13486
142 Ga0075431_100104451 3300006847 Bacteria 2924
143 Ga0075431_101163865 3300006847 Unclassified 735
144 Ga0075433_10001353 3300006852 Bacteria 17979
145 Ga0075433_10042230 3300006852 Bacteria 3955
146 Ga0075433_10109158 3300006852 Bacteria 2455
147 Ga0075433_10430028 3300006852 Bacteria 1164
148 Ga0075433_10439546 3300006852 Unclassified 1150
149 Ga0075434_100000240 3300006871 Bacteria 38105
150 Ga0075434_100546332 3300006871 Bacteria 1178
151 Ga0075434_100637599 3300006871 Unclassified 1084
152 Ga0075434_101422969 3300006871 Bacteria 703
153 Ga0075434_101985243 3300006871 Bacteria 587
154 Ga0068865_100011689 3300006881 Bacteria 5500
155 Ga0075436_100002277 3300006914 Bacteria 13249
156 Ga0097620_100000090 3300006931 Bacteria 83289
157 Ga0097620_100032313 3300006931 Bacteria 5257
158 Ga0097620_100048051 3300006931 Bacteria 4287
159 Ga0097620_100712656 3300006931 Bacteria 1094
160 Ga0075435_100000373 3300007076 Bacteria 27413
161 Ga0075435_100260026 3300007076 Bacteria 1479
162 Ga0075435_100489237 3300007076 Unclassified 1063
163 Ga0105240_10005108 3300009093 Bacteria 19644
164 Ga0105240_10009252 3300009093 Bacteria 13971
165 Ga0105240_10169510 3300009093 Bacteria 2587
166 Ga0105245_10002797 3300009098 Bacteria 15694
167 Ga0105245_10031738 3300009098 Bacteria 4676
168 Ga0105245_11563895 3300009098 Unclassified 711
169 Ga0105247_10001769 3300009101 Bacteria 15200
170 Ga0105247_10136318 3300009101 Bacteria 1604
171 Ga0114129_10014595 3300009147 Bacteria 11193
172 Ga0114129_10577136 3300009147 Bacteria 1460
173 Ga0114129_10859040 3300009147 Bacteria 1153
174 Ga0114129_11429024 3300009147 Bacteria 853
175 Ga0114129_11871161 3300009147 Bacteria 728
176 Ga0105243_10320765 3300009148 Unclassified 1412
177 Ga0105243_10387986 3300009148 Bacteria 1294
178 Ga0105241_10696317 3300009174 Bacteria 927
179 Ga0105242_10005432 3300009176 Bacteria 9856
180 Ga0105242_10018876 3300009176 Bacteria 5400
181 Ga0105242_10411258 3300009176 Bacteria 1265
182 Ga0105242_11688244 3300009176 Bacteria 669
183 Ga0105248_10240930 3300009177 Unclassified 2036
184 Ga0105237_10238445 3300009545 Bacteria 1820
185 Ga0105237_12631476 3300009545 Unclassified 514
186 Ga0105238_10032427 3300009551 Bacteria 5316
187 Ga0105238_10216467 3300009551 Unclassified 1891
188 Ga0105238_10565699 3300009551 Bacteria 1142
189 Ga0105238_12045190 3300009551 Unclassified 607
190 Ga0105249_10032008 3300009553 Bacteria 4757
191 Ga0105249_10713887 3300009553 Unclassified 1063
192 Ga0105249_11049251 3300009553 Bacteria 884
193 Ga0105249_11062389 3300009553 Unclassified 879
194 Ga0105239_10004431 3300010375 Bacteria 16792
195 Ga0105239_10071240 3300010375 Bacteria 3819
196 Ga0105246_10002416 3300011119 Bacteria 11268
197 Ga0157314_1021681 3300012500 Unclassified 660
198 Ga0157370_10091578 3300013104 Bacteria 2854
199 Ga0157369_10032642 3300013105 Bacteria 5724
200 Ga0157369_10036757 3300013105 Bacteria 5364
201 Ga0157369_10172935 3300013105 Unclassified 2275
202 Ga0157369_11186379 3300013105 Unclassified 779
203 Ga0157369_11663925 3300013105 Bacteria 649
204 Ga0157374_10003656 3300013296 Bacteria 12937
205 Ga0163162_10088799 3300013306 Unclassified 3170
206 Ga0163162_10302205 3300013306 Bacteria 1732
207 Ga0157372_10021173 3300013307 Bacteria 7024
208 Ga0157372_10229417 3300013307 Bacteria 2152
209 Ga0157372_10602021 3300013307 Bacteria 1281
210 Ga0157372_12018867 3300013307 Unclassified 663
211 Ga0157375_10003505 3300013308 Bacteria 13607
212 Ga0163163_10000958 3300014325 Bacteria 24503
213 Ga0157380_10001453 3300014326 Bacteria 15501
214 Ga0157380_10025039 3300014326 Unclassified 4522
215 Ga0157377_10000467 3300014745 Bacteria 17434
216 Ga0157377_11079183 3300014745 Unclassified 614
217 Ga0157379_10008982 3300014968 Bacteria 8712
218 Ga0157379_10030890 3300014968 Unclassified 4771
219 Ga0157376_10006340 3300014969 Bacteria 8355
220 Ga0157376_10221815 3300014969 Bacteria 1751
221 Ga0163161_10038216 3300017792 Unclassified 3443
222 Ga0213876_10008805 3300021384 Bacteria 5449
223 Ga0213876_10115937 3300021384 Bacteria 1421
224 Ga0207697_10002916 3300025315 Bacteria 8654
225 Ga0207682_10001948 3300025893 Bacteria 9380
226 Ga0207682_10003786 3300025893 Bacteria 6496
227 Ga0207710_10003898 3300025900 Bacteria 6589
228 Ga0207688_10000372 3300025901 Bacteria 20907
229 Ga0207680_10010107 3300025903 Unclassified 4709
230 Ga0207647_10008793 3300025904 Bacteria 7209
231 Ga0207647_10037448 3300025904 Bacteria 3076
232 Ga0207645_10000051 3300025907 Bacteria 84255
233 Ga0207645_10858618 3300025907 Unclassified 617
234 Ga0207643_10000079 3300025908 Bacteria 63366
235 Ga0207705_10030843 3300025909 Unclassified 3826
236 Ga0207705_10037952 3300025909 Bacteria 3448
237 Ga0207705_10347620 3300025909 Unclassified 1142
238 Ga0207705_10756481 3300025909 Bacteria 755
239 Ga0207684_10036859 3300025910 Bacteria 4151
240 Ga0207684_10175649 3300025910 Bacteria 1847
241 Ga0207654_10023432 3300025911 Bacteria 3307
242 Ga0207654_10307250 3300025911 Bacteria 1080
243 Ga0207695_10004195 3300025913 Bacteria 19804
244 Ga0207695_10020950 3300025913 Bacteria 7471
245 Ga0207695_10021211 3300025913 Bacteria 7418
246 Ga0207671_11359476 3300025914 Unclassified 552
247 Ga0207663_10466593 3300025916 Unclassified 976
248 Ga0207660_10646033 3300025917 Bacteria 862
249 Ga0207662_10023390 3300025918 Unclassified 3550
250 Ga0207657_10000292 3300025919 Bacteria 53366
251 Ga0207657_10002229 3300025919 Bacteria 21012
252 Ga0207649_10000242 3300025920 Bacteria 44166
253 Ga0207649_11233377 3300025920 Bacteria 591
254 Ga0207646_11071076 3300025922 Bacteria 710
255 Ga0207646_11220769 3300025922 Bacteria 659
256 Ga0207694_10038645 3300025924 Bacteria 3670
257 Ga0207694_11345945 3300025924 Unclassified 604
258 Ga0207650_10000090 3300025925 Bacteria 118973
259 Ga0207659_10002035 3300025926 Bacteria 11997
260 Ga0207687_10359574 3300025927 Bacteria 1188
261 Ga0207700_10452465 3300025928 Bacteria 1132
262 Ga0207644_10002582 3300025931 Bacteria 11652
263 Ga0207690_10003087 3300025932 Bacteria 10034
264 Ga0207686_10088930 3300025934 Bacteria 2034
265 Ga0207686_10530508 3300025934 Unclassified 917
266 Ga0207686_10595580 3300025934 Unclassified 869
267 Ga0207709_10392988 3300025935 Unclassified 1058
268 Ga0207670_10001693 3300025936 Bacteria 11493
269 Ga0207670_10787392 3300025936 Bacteria 792
270 Ga0207669_10005518 3300025937 Bacteria 5684
271 Ga0207704_10069171 3300025938 Bacteria 2229
272 Ga0207665_10344182 3300025939 Bacteria 1124
273 Ga0207691_10001343 3300025940 Bacteria 24540
274 Ga0207691_10862457 3300025940 Unclassified 759
275 Ga0207711_10002838 3300025941 Bacteria 15224
276 Ga0207689_10000304 3300025942 Bacteria 45071
277 Ga0207661_10000583 3300025944 Bacteria 23334
278 Ga0207679_10000184 3300025945 Bacteria 51157
279 Ga0207667_10025313 3300025949 Bacteria 6498
280 Ga0207667_10170718 3300025949 Bacteria 2235
281 Ga0207667_11414631 3300025949 Unclassified 669
282 Ga0207651_10002456 3300025960 Bacteria 8859
283 Ga0207712_10079479 3300025961 Bacteria 2383
284 Ga0207712_11135576 3300025961 Bacteria 696
285 Ga0207668_10298592 3300025972 Bacteria 1328
286 Ga0207668_10834386 3300025972 Bacteria 817
287 Ga0207640_10411095 3300025981 Bacteria 1105
288 Ga0207658_10001983 3300025986 Bacteria 15269
289 Ga0207658_10143478 3300025986 Unclassified 1936
290 Ga0207677_10006393 3300026023 Bacteria 6462
291 Ga0207703_10005260 3300026035 Bacteria 10438
292 Ga0207703_10333366 3300026035 Bacteria 1392
293 Ga0207703_11261491 3300026035 Unclassified 710
294 Ga0207639_10000006 3300026041 Bacteria 544415
295 Ga0207678_10000204 3300026067 Bacteria 52306
296 Ga0207708_10058740 3300026075 Bacteria 2934
297 Ga0207702_10048664 3300026078 Unclassified 3576
298 Ga0207702_10094741 3300026078 Bacteria 2621
299 Ga0207702_10812908 3300026078 Bacteria 924
300 Ga0207641_10000894 3300026088 Bacteria 31042
301 Ga0207641_10015672 3300026088 Bacteria 6211
302 Ga0207648_10000757 3300026089 Bacteria 36296
303 Ga0207648_10686069 3300026089 Bacteria 948
304 Ga0207676_10000113 3300026095 Bacteria 73022
305 Ga0207676_11833772 3300026095 Unclassified 605
306 Ga0207674_10000076 3300026116 Bacteria 104404
307 Ga0207674_12111170 3300026116 Unclassified 527
308 Ga0207675_100008819 3300026118 Bacteria 9464
309 Ga0207683_10001129 3300026121 Bacteria 24286
310 Ga0207683_10042953 3300026121 Bacteria 3948
311 Ga0207698_10243007 3300026142 Bacteria 1642
312 Ga0268266_10004231 3300028379 Bacteria 13821
313 Ga0268266_10005373 3300028379 Bacteria 11969
314 Ga0268265_10002144 3300028380 Bacteria 15280
315 Ga0268265_10181645 3300028380 Bacteria 1808
316 Ga0268265_11060526 3300028380 Bacteria 803
317 Ga0268264_10005619 3300028381 Bacteria 10622
318 Ga0268264_10016388 3300028381 Bacteria 6066
319 Ga0268264_11524166 3300028381 Bacteria 679
320 Ga0265323_10000215 3300028653 Bacteria 34197
321 Ga0265322_10077476 3300028654 Unclassified 943
322 Ga0265338_10007475 3300028800 Bacteria 13541
323 Ga0265316_10066714 3300031344 Bacteria 2784
324 Ga0307406_10066860 3300031901 Bacteria 2341
325 Ga0373926_0052316 3300035083 Bacteria 1475
326 Ga0373926_0211557 3300035083 Bacteria 747
327 Ga0373929_0000007 3300035085 Bacteria 315743
328 Ga0373944_0003208 3300035089 Unclassified 4201
329 Ga0373936_0009904 3300035113 Unclassified 3597
330 Ga0373957_0266778 3300035120 Unclassified 722
331 Ga0373943_0000486 3300035170 Bacteria 16946
332 Ga0373946_0065747 3300035171 Bacteria 1553
333 Ga0373924_0000846 3300035410 Bacteria 9604
334 Ga0373935_0008799 3300035692 Bacteria 6046
335 Ga0373935_1234439 3300035692 Unclassified 557
336 Ga0373927_0035270 3300035695 Unclassified 3253
337 Ga0373927_0073071 3300035695 Unclassified 2220
338 Ga0373947_0151175 3300035725 Bacteria 1495
339 Ga0373947_0533422 3300035725 Bacteria 798
340 Ga0373937_0019781 3300036401 Bacteria 6030
341 Ga0373925_0256188 3300037068 Bacteria 1404
342 Ga0373925_0325443 3300037068 Unclassified 1244
343 Ga0373925_0502426 3300037068 Bacteria 995
344 Ga0395905_1367919 3300037471 Unclassified 612
345 Ga0436365_0461394 3300039437 Bacteria 8652
346 Ga0436365_1458880 3300039437 Unclassified 2202
347 Ga0436365_1875521 3300039437 Bacteria 777
348 Ga0436361_0825192 3300039447 Bacteria 967
349 Ga0436363_1665823 3300039450 Unclassified 722
350 Ga0451845_0957276 3300041501 Bacteria 561
351 Ga0439462_0179837 3300042015 Bacteria 599
352 Ga0439434_0121650 3300042435 Bacteria 852
353 Ga0451577_0434567 3300042876 Bacteria 1192
354 Ga0451577_1537573 3300042876 Unclassified 588
355 Ga0453683_0006603 3300044673 Bacteria 7946
356 Ga0466963_1240419 3300044694 Unclassified 524
357 Ga0495580_0279402 3300046472 Bacteria 1139
358 Ga0495639_0056561 3300046475 Bacteria 1791
359 Ga0495639_0448896 3300046475 Unclassified 655
360 Ga0495630_0079283 3300046517 Unclassified 2477
361 Ga0495665_0114191 3300046531 Unclassified 1415
362 Ga0495667_0084061 3300046559 Unclassified 2067
363 Ga0495667_0535746 3300046559 Bacteria 732
364 Ga0495635_0532496 3300046663 Unclassified 771
365 Ga0495588_0254972 3300046674 Unclassified 925
366 Ga0495658_0054459 3300046683 Unclassified 2276
367 Ga0495624_0022830 3300046690 Unclassified 4130
368 Ga0495581_0187597 3300047315 Bacteria 1209
369 Ga0496100_1566170 3300048903 Unclassified 521
370 Ga0496102_0489843 3300048905 Bacteria 1151
371 Ga0496102_1138750 3300048905 Bacteria 700
372 Ga0496104_0036653 3300048907 Unclassified 4585
373 Ga0496105_0139926 3300048908 Bacteria 1993
374 Ga0496108_0002118 3300048911 Bacteria 15901
375 Ga0496109_0000008 3300048912 Bacteria 245809
376 Ga0496111_0205494 3300048914 Bacteria 1463
377 Ga0496111_0223504 3300048914 Bacteria 1399
378 Ga0496112_0000334 3300048915 Bacteria 30562
379 Ga0496112_0005467 3300048915 Bacteria 10996
380 Ga0496112_0520643 3300048915 Bacteria 1124
381 Ga0496113_0000238 3300048916 Bacteria 25957
382 Ga0496113_0005618 3300048916 Bacteria 7846
383 Ga0496114_0306933 3300048917 Bacteria 1401
384 Ga0501042_0616099 3300049578 Bacteria 789
385 Ga0501046_0509977 3300049580 Bacteria 861
386 Ga0501069_0843734 3300049585 Bacteria 556
387 Ga0501206_083822 3300049653 Unclassified 557
388 Ga0501235_200884 3300049669 Bacteria 540
389 nmdc:mga05p37_144772_c1 3300050507 Bacteria 2910
390 nmdc:mga05p37_20759_c2 3300050507 Bacteria 5921
391 nmdc:mga05p37_976691_c1 3300050507 Bacteria 903
392 nmdc:mga0qj67_1392504_c1 3300050509 Bacteria 541
393 nmdc:mga0qj67_345265_c1 3300050509 Unclassified 1204
394 nmdc:mga06r32_16240_c1 3300050510 Bacteria 6781
395 nmdc:mga06r32_227787_c1 3300050510 Bacteria 1852
396 nmdc:mga08y16_627279_c1 3300050511 Bacteria 1081
397 nmdc:mga0n895_1244945_c1 3300050512 Unclassified 717
398 nmdc:mga0n895_393897_c1 3300050512 Unclassified 1401
399 nmdc:mga0n895_5487_c1 3300050512 Bacteria 10607
400 nmdc:mga0n895_688165_c1 3300050512 Bacteria 1019
401 nmdc:mga0rr50_1078112_c1 3300050513 Unclassified 684
402 nmdc:mga0rr50_849_c1 3300050513 Bacteria 16428
403 nmdc:mga0rr50_897606_c1 3300050513 Bacteria 756
404 nmdc:mga0a205_149392_c1 3300050515 Bacteria 2237
405 nmdc:mga0a205_381059_c1 3300050515 Unclassified 1276
406 nmdc:mga0a205_434404_c1 3300050515 Unclassified 1174
407 nmdc:mga0a205_6597_c1 3300050515 Bacteria 10498
408 nmdc:mga0a205_66511_c1 3300050515 Bacteria 3482
409 Ga0495655_0000940 3300053083 Bacteria 4517
410 Ga0495619_0071569 3300053085 Unclassified 2321
411 Ga0500555_000003 3300053103 Bacteria 392994
412 Ga0500555_000418 3300053103 Bacteria 17735
413 Ga0500616_0001685 3300053153 Bacteria 20354
414 Ga0500616_0049723 3300053153 Bacteria 2217
415 Ga0500645_000251 3300053730 Bacteria 39552
416 Ga0501084_1294840 3300054114 Bacteria 611
417 Ga0530510_1130632 3300061734 Bacteria 600
418 Ga0495632_0028771
419 JGI24737J22298_10028557
420 JGI24743J22301_10000093
421 JGI24751J29686_10000635
422 Ga0065715_10002672
423 Ga0065707_10083430
424 Ga0065707_10179035
425 Ga0070658_10091494
426 Ga0070658_10465575
427 Ga0070658_10944038
428 Ga0070676_10005283
429 Ga0070683_100001910
430 Ga0070683_100030127
431 Ga0070690_100003363
432 Ga0070670_100001939
433 Ga0070677_10000806
434 Ga0068869_100052848
435 Ga0070666_10008180
436 Ga0070680_100601405
437 Ga0070682_100003286
438 Ga0068868_100037793
439 Ga0068868_100128486
440 Ga0070660_100004941
441 Ga0070660_101354666
442 Ga0070689_100001082
443 Ga0070661_100009221
444 Ga0070692_10046515
445 Ga0070668_100004887
446 Ga0070669_100001365
447 Ga0070675_100219209
448 Ga0070674_100001337
449 Ga0070673_100009008
450 Ga0070688_100000289
451 Ga0070659_100002441
452 Ga0070659_100536358
453 Ga0070667_100156413
454 Ga0070667_100649496
455 Ga0070709_10707649
456 Ga0070713_100826269
457 Ga0070701_10290057
458 Ga0070711_100675976
459 Ga0070711_100683084
460 Ga0070705_100130183
461 Ga0070705_100773388
462 Ga0070705_101174897
463 Ga0070694_100099479
464 Ga0070694_100100391
465 Ga0070708_100043028
466 Ga0070708_100372179
467 Ga0070708_101843159
468 Ga0070663_100010379
469 Ga0070678_100002783
470 Ga0070678_100041704
471 Ga0070681_10042983
472 Ga0068867_100000749
473 Ga0068867_101003325
474 Ga0070685_10001601
475 Ga0070706_100046889
476 Ga0070706_100120796
477 Ga0070706_100237808
478 Ga0070707_100020387
479 Ga0070707_101411574
480 Ga0070707_101513535
481 Ga0070698_100039220
482 Ga0070698_100067386
483 Ga0070698_100069430
484 Ga0070698_100242382
485 Ga0070698_100742663
486 Ga0070698_100814774
487 Ga0070699_100000005
488 Ga0070699_100005764
489 Ga0070699_100087717
490 Ga0070699_100532296
491 Ga0070699_100601759
492 Ga0070684_100001382
493 Ga0070684_100747236
494 Ga0070697_100154262
495 Ga0070697_100516863
496 Ga0070697_100763668
497 Ga0068853_100014023
498 Ga0068853_100028987
499 Ga0070672_100002640
500 Ga0070672_100985549
501 Ga0070686_100002027
502 Ga0070696_100017804
503 Ga0070696_100130649
504 Ga0070696_100797079
505 Ga0070693_100324015
506 Ga0070704_100004687
507 Ga0070704_100043629
508 Ga0070704_100215274
509 Ga0070704_100935635
510 Ga0068855_100037048
511 Ga0068855_101589040
512 Ga0070664_100006830
513 Ga0068857_100002750
514 Ga0068854_100607727
515 Ga0068856_100018327
516 Ga0068856_100032928
517 Ga0068856_100884837
518 Ga0070702_100006493
519 Ga0070702_100141906
520 Ga0068852_100005202
521 Ga0068852_100008847
522 Ga0068852_100464785
523 Ga0068852_100625698
524 Ga0068859_100000090
525 Ga0068859_100032315
526 Ga0068859_100048053
527 Ga0068859_100712607
528 Ga0068864_100003567
529 Ga0068864_100606263
530 Ga0068864_100830013
531 Ga0068866_10001464
532 Ga0068866_10144924
533 Ga0068861_100002752
534 Ga0068861_101630039
535 Ga0068851_10321684
536 Ga0068870_10000606
537 Ga0068870_10030968
538 Ga0068870_10934605
539 Ga0068863_100010061
540 Ga0068858_100006021
541 Ga0068860_100000720
542 Ga0068860_100047365
543 Ga0068862_100012134
544 Ga0068862_100083873
545 Ga0068862_100257644
546 Ga0081455_10067799
547 Ga0081455_10131109
548 Ga0081538_10021706
549 Ga0081538_10022115
550 Ga0081538_10225085
551 Ga0070717_10000046
552 Ga0097621_100273544
553 Ga0068871_100014030
554 Ga0075428_101723894
555 Ga0075430_100377366
556 Ga0075430_100513229
557 Ga0075430_100851968
558 Ga0075431_100004647
559 Ga0075431_100104451
560 Ga0075431_101163865
561 Ga0075433_10001353
562 Ga0075433_10042230
563 Ga0075433_10109158
564 Ga0075433_10430028
565 Ga0075433_10439546
566 Ga0075434_100000240
567 Ga0075434_100546332
568 Ga0075434_100637599
569 Ga0075434_101422969
570 Ga0075434_101985243
571 Ga0068865_100011689
572 Ga0075436_100002277
573 Ga0097620_100000090
574 Ga0097620_100032313
575 Ga0097620_100048051
576 Ga0097620_100712656
577 Ga0075435_100000373
578 Ga0075435_100260026
579 Ga0075435_100489237
580 Ga0105240_10005108
581 Ga0105240_10009252
582 Ga0105240_10169510
583 Ga0105245_10002797
584 Ga0105245_10031738
585 Ga0105245_11563895
586 Ga0105247_10001769
587 Ga0105247_10136318
588 Ga0114129_10014595
589 Ga0114129_10577136
590 Ga0114129_10859040
591 Ga0114129_11429024
592 Ga0114129_11871161
593 Ga0105243_10320765
594 Ga0105243_10387986
595 Ga0105241_10696317
596 Ga0105242_10005432
597 Ga0105242_10018876
598 Ga0105242_10411258
599 Ga0105242_11688244
600 Ga0105248_10240930
601 Ga0105237_10238445
602 Ga0105237_12631476
603 Ga0105238_10032427
604 Ga0105238_10216467
605 Ga0105238_10565699
606 Ga0105238_12045190
607 Ga0105249_10032008
608 Ga0105249_10713887
609 Ga0105249_11049251
610 Ga0105249_11062389
611 Ga0105239_10004431
612 Ga0105239_10071240
613 Ga0105246_10002416
614 Ga0157314_1021681
615 Ga0157370_10091578
616 Ga0157369_10032642
617 Ga0157369_10036757
618 Ga0157369_10172935
619 Ga0157369_11186379
620 Ga0157369_11663925
621 Ga0157374_10003656
622 Ga0163162_10088799
623 Ga0163162_10302205
624 Ga0157372_10021173
625 Ga0157372_10229417
626 Ga0157372_10602021
627 Ga0157372_12018867
628 Ga0157375_10003505
629 Ga0163163_10000958
630 Ga0157380_10001453
631 Ga0157380_10025039
632 Ga0157377_10000467
633 Ga0157377_11079183
634 Ga0157379_10008982
635 Ga0157379_10030890
636 Ga0157376_10006340
637 Ga0157376_10221815
638 Ga0163161_10038216
639 Ga0213876_10008805
640 Ga0213876_10115937
641 Ga0207697_10002916
642 Ga0207682_10001948
643 Ga0207682_10003786
644 Ga0207710_10003898
645 Ga0207688_10000372
646 Ga0207680_10010107
647 Ga0207647_10008793
648 Ga0207647_10037448
649 Ga0207645_10000051
650 Ga0207645_10858618
651 Ga0207643_10000079
652 Ga0207705_10030843
653 Ga0207705_10037952
654 Ga0207705_10347620
655 Ga0207705_10756481
656 Ga0207684_10036859
657 Ga0207684_10175649
658 Ga0207654_10023432
659 Ga0207654_10307250
660 Ga0207695_10004195
661 Ga0207695_10020950
662 Ga0207695_10021211
663 Ga0207671_11359476
664 Ga0207663_10466593
665 Ga0207660_10646033
666 Ga0207662_10023390
667 Ga0207657_10000292
668 Ga0207657_10002229
669 Ga0207649_10000242
670 Ga0207649_11233377
671 Ga0207646_11071076
672 Ga0207646_11220769
673 Ga0207694_10038645
674 Ga0207694_11345945
675 Ga0207650_10000090
676 Ga0207659_10002035
677 Ga0207687_10359574
678 Ga0207700_10452465
679 Ga0207644_10002582
680 Ga0207690_10003087
681 Ga0207686_10088930
682 Ga0207686_10530508
683 Ga0207686_10595580
684 Ga0207709_10392988
685 Ga0207670_10001693
686 Ga0207670_10787392
687 Ga0207669_10005518
688 Ga0207704_10069171
689 Ga0207665_10344182
690 Ga0207691_10001343
691 Ga0207691_10862457
692 Ga0207711_10002838
693 Ga0207689_10000304
694 Ga0207661_10000583
695 Ga0207679_10000184
696 Ga0207667_10025313
697 Ga0207667_10170718
698 Ga0207667_11414631
699 Ga0207651_10002456
700 Ga0207712_10079479
701 Ga0207712_11135576
702 Ga0207668_10298592
703 Ga0207668_10834386
704 Ga0207640_10411095
705 Ga0207658_10001983
706 Ga0207658_10143478
707 Ga0207677_10006393
708 Ga0207703_10005260
709 Ga0207703_10333366
710 Ga0207703_11261491
711 Ga0207639_10000006
712 Ga0207678_10000204
713 Ga0207708_10058740
714 Ga0207702_10048664
715 Ga0207702_10094741
716 Ga0207702_10812908
717 Ga0207641_10000894
718 Ga0207641_10015672
719 Ga0207648_10000757
720 Ga0207648_10686069
721 Ga0207676_10000113
722 Ga0207676_11833772
723 Ga0207674_10000076
724 Ga0207674_12111170
725 Ga0207675_100008819
726 Ga0207683_10001129
727 Ga0207683_10042953
728 Ga0207698_10243007
729 Ga0268266_10004231
730 Ga0268266_10005373
731 Ga0268265_10002144
732 Ga0268265_10181645
733 Ga0268265_11060526
734 Ga0268264_10005619
735 Ga0268264_10016388
736 Ga0268264_11524166
737 Ga0265323_10000215
738 Ga0265322_10077476
739 Ga0265338_10007475
740 Ga0265316_10066714
741 Ga0307406_10066860
742 Ga0373926_0052316
743 Ga0373926_0211557
744 Ga0373929_0000007
745 Ga0373944_0003208
746 Ga0373936_0009904
747 Ga0373957_0266778
748 Ga0373943_0000486
749 Ga0373946_0065747
750 Ga0373924_0000846
751 Ga0373935_0008799
752 Ga0373935_1234439
753 Ga0373927_0035270
754 Ga0373927_0073071
755 Ga0373947_0151175
756 Ga0373947_0533422
757 Ga0373937_0019781
758 Ga0373925_0256188
759 Ga0373925_0325443
760 Ga0373925_0502426
761 Ga0395905_1367919
762 Ga0436365_0461394
763 Ga0436365_1458880
764 Ga0436365_1875521
765 Ga0436361_0825192
766 Ga0436363_1665823
767 Ga0451845_0957276
768 Ga0439462_0179837
769 Ga0439434_0121650
770 Ga0451577_0434567
771 Ga0451577_1537573
772 Ga0453683_0006603
773 Ga0466963_1240419
774 Ga0495580_0279402
775 Ga0495639_0056561
776 Ga0495639_0448896
777 Ga0495630_0079283
778 Ga0495665_0114191
779 Ga0495667_0084061
780 Ga0495667_0535746
781 Ga0495635_0532496
782 Ga0495588_0254972
783 Ga0495658_0054459
784 Ga0495624_0022830
785 Ga0495581_0187597
786 Ga0496100_1566170
787 Ga0496102_0489843
788 Ga0496102_1138750
789 Ga0496104_0036653
790 Ga0496105_0139926
791 Ga0496108_0002118
792 Ga0496109_0000008
793 Ga0496111_0205494
794 Ga0496111_0223504
795 Ga0496112_0000334
796 Ga0496112_0005467
797 Ga0496112_0520643
798 Ga0496113_0000238
799 Ga0496113_0005618
800 Ga0496114_0306933
801 Ga0501042_0616099
802 Ga0501046_0509977
803 Ga0501069_0843734
804 Ga0501206_083822
805 Ga0501235_200884
806 nmdc:mga05p37_144772_c1
807 nmdc:mga05p37_20759_c2
808 nmdc:mga05p37_976691_c1
809 nmdc:mga0qj67_1392504_c1
810 nmdc:mga0qj67_345265_c1
811 nmdc:mga06r32_16240_c1
812 nmdc:mga06r32_227787_c1
813 nmdc:mga08y16_627279_c1
814 nmdc:mga0n895_1244945_c1
815 nmdc:mga0n895_393897_c1
816 nmdc:mga0n895_5487_c1
817 nmdc:mga0n895_688165_c1
818 nmdc:mga0rr50_1078112_c1
819 nmdc:mga0rr50_849_c1
820 nmdc:mga0rr50_897606_c1
821 nmdc:mga0a205_149392_c1
822 nmdc:mga0a205_381059_c1
823 nmdc:mga0a205_434404_c1
824 nmdc:mga0a205_6597_c1
825 nmdc:mga0a205_66511_c1
826 Ga0495655_0000940
827 Ga0495619_0071569
828 Ga0500555_000003
829 Ga0500555_000418
830 Ga0500616_0001685
831 Ga0500616_0049723
832 Ga0500645_000251
833 Ga0501084_1294840
834 Ga0530510_1130632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04238

DUF420

Protein of unknown function (DUF420)

26

160

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k1s-assembly1.cif.gz_A crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis 0.8338 1 71
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.7886 2 137
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.7523 4 137
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.7319 4 137
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.7266 2 140
ID Description Score Start End Superfamily
af_Q9M363_194_379_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7171 1 142 1.20.120.1770
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.706 1 145 1.20.120.80
af_A0A1D6NFR3_201_388_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7039 6 138 1.20.120.1770
af_Q0WRW8_184_365_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7011 1 138 1.20.120.1770
af_A0A5K1K958_64_247_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6976 4 141 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A3D4HJL6-F1-model_v4 DUF420 domain-containing protein 0.9969 6 145 GO:0016020
AF-A0A7V9TYQ8-F1-model_v4 DUF420 domain-containing protein 0.9925 3 145 GO:0004129
GO:0016020
GO:0022904
AF-A0A523D1N7-F1-model_v4 DUF420 domain-containing protein 0.9914 1 142 GO:0016020
AF-A0A7C4UW82-F1-model_v4 DUF420 domain-containing protein 0.9909 2 144 GO:0016020
AF-A0A521X1G5-F1-model_v4 DUF420 domain-containing protein 0.99 3 142 GO:0016020

Map