F439149

General Info

Members Datasets Scaffolds Average Seq Length
417 330 834 932

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0085368|Ga0496109_0085368_57_2615
Length 824
Sequence MGHALNNTLQDILCRFERMRGKDVLWQPGTDHAGIATQMVVAFLKRVWEWKAESGGTIVNQLKRLGASCDWSRERFTMDEGLSRAVLKVFVELHRAGLIYKDKRLVNWDPKLLTAISDLEVIQVETKGHLWHLRYPIEGTTFNPDDRSTFIVVATTRPETMLGDVAVAVHPDDERYKALVGNNAILPLVGRKIPIIADEYSDPEKGSGAVKITPAHDFNDFEVGKRHNLPQINIFSTEAKLQLKDNAEFVAGVPASADLSATLSMNGIDRFAARKAILARLEEKGLVDKIEPQSHVVPHGDRSNVVIEPYLTDQWYVNAKELAKPAIAAVRSGKTKFIPKNWEKTYFDWMENIQPWCISRQLWWGHQIPAWYGPDSKVFVALTEAEAQXDADKHYGKKTKLSRDEDVLDTWFSSALWPFSTLGWPDATPELKRFYPTSTLVTGFDIIFFWVARMMMMGLHFMKEIPFHDVYIHALVRDASGAKMSKSKGNVIDPLALIDEYGADALRFTLAAMAAQGRDIKLSTQRVEGYRNFATKLWNAARFAEMNGCASAASFDPKSAKETLNRWIAHETAKAAAEITEAIEAYRFNDAATAVYRFVWNIYCDWYLELAKPLLIGPDGAAKSETQAMVAWARDEILKLLQPFMPFITEELWAVTGKHDALLALDAWPSYMGLSDDKAEAEIGWVIDLVTAIRSVRAEMNITAAIPLVLAGASAETKARAERWSEFIKRLARVSDISSAAAPPQGSVQLVVRGETAALPLKGVIDIAAERARLGKEMQKADADIARVDAKLNNPNFMARAPEEVVVARKAKIAEALERLKGAV

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
33 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
34 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
35 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
36 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
39 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
67 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
68 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
69 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
184 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
185 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
195 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
198 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
203 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
204 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
205 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
206 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
207 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
208 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
209 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
210 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
211 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
212 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
213 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
214 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
215 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
216 2643221651 Afipia sp. Root123D2 Isolate Unclassified
217 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
218 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
219 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
220 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
221 2791355199
222 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
223 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
224 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
225 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
226 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
227 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
228 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
229 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
230 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
231 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
232 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
233 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
234 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
235 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
236 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
237 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
238 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
239 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
240 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
241 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
242 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
243 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
244 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
245 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
246 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
247 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
248 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
249 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
250 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
251 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
252 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
253 2904699407
254 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
255 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
256 2906610324
257 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
258 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
259 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
260 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
261 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
262 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
263 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
264 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
265 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
266 2922425934
267 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
268 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
269 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
270 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
271 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
272 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
273 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
274 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
275 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
276 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
277 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
278 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
279 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
280 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
281 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
282 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
283 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
284 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
285 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
286 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
287 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
288 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
289 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
290 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
291 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
292 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
293 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
294 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
295 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
296 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
297 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
298 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
299 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
300 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
301 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
302 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
303 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
304 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
305 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
306 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
307 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
308 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
309 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
310 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
311 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
312 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
313 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
314 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
315 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
316 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
317 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
318 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
319 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
320 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
321 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
322 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
323 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
324 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
325 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
326 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
327 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
328 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
329 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
330 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.73
Metatranscriptomes 0
Isolates 30.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.55
Nodule 24.22
Rhizoplane 4.32
Rhizosphere 46.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0085368 3300048912 Bacteria 2913
2 JGI24739J22299_10001456 3300001989 Bacteria 8919
3 JGI25406J46586_10000004 3300003203 Bacteria 149772
4 JGI25153J46596_10002221 3300003215 Bacteria 11332
5 Ga0065165_1001490 3300005262 Bacteria 24866
6 Ga0065165_1002488 3300005262 Bacteria 15477
7 Ga0070709_10008179 3300005434 Bacteria 5742
8 Ga0070709_10008826 3300005434 Bacteria 5548
9 Ga0070679_100007374 3300005530 Bacteria 10276
10 Ga0068853_100012248 3300005539 Bacteria 6974
11 Ga0070665_100026259 3300005548 Bacteria 5865
12 Ga0068855_100015464 3300005563 Bacteria 9187
13 Ga0068855_100049475 3300005563 Bacteria 4957
14 Ga0068857_100012156 3300005577 Bacteria 7488
15 Ga0068856_100002027 3300005614 Bacteria 21093
16 Ga0068852_100012928 3300005616 Bacteria 6366
17 Ga0068851_10002699 3300005834 Bacteria 7820
18 Ga0068860_100001232 3300005843 Bacteria 27931
19 Ga0081455_10002977 3300005937 Bacteria 19799
20 Ga0081540_1000327 3300005983 Bacteria 49238
21 Ga0081540_1011166 3300005983 Bacteria 6028
22 Ga0081539_10000080 3300005985 Bacteria 222745
23 Ga0081539_10000258 3300005985 Bacteria 122213
24 Ga0081539_10019292 3300005985 Bacteria 4675
25 Ga0070717_10006504 3300006028 Bacteria 8597
26 Ga0070717_10010592 3300006028 Bacteria 6967
27 Ga0070715_10000080 3300006163 Bacteria 26555
28 Ga0070716_100004057 3300006173 Bacteria 6951
29 Ga0075369_10007255 3300006186 Bacteria 4215
30 Ga0068871_100002901 3300006358 Bacteria 11760
31 Ga0099824_1004033 3300006942 Bacteria 21256
32 Ga0105240_10010226 3300009093 Bacteria 13205
33 Ga0105240_10038000 3300009093 Bacteria 6181
34 Ga0105241_10020097 3300009174 Bacteria 4933
35 Ga0105248_10034936 3300009177 Bacteria 5625
36 Ga0105237_10003658 3300009545 Bacteria 18135
37 Ga0105238_10019670 3300009551 Bacteria 6875
38 Ga0105239_10009651 3300010375 Bacteria 10852
39 Ga0157375_10028609 3300013308 Bacteria 5228
40 Ga0214544_1000002 3300021320 Bacteria 753857
41 Ga0214542_1000153 3300021321 Bacteria 101854
42 Ga0214545_1000018 3300021324 Bacteria 172019
43 Ga0214543_1000001 3300021327 Bacteria 776921
44 Ga0209563_100449 3300025230 Bacteria 14243
45 Ga0209677_100573 3300025253 Bacteria 20260
46 Ga0209233_1003693 3300025261 Bacteria 5351
47 Ga0209455_1001664 3300025272 Bacteria 9603
48 Ga0209564_1001404 3300025295 Bacteria 24956
49 Ga0209758_1000021 3300025297 Bacteria 697691
50 Ga0209758_1000211 3300025297 Bacteria 127721
51 Ga0209758_1000388 3300025297 Bacteria 76021
52 Ga0209758_1012802 3300025297 Bacteria 4647
53 Ga0209256_1008185 3300025299 Bacteria 4912
54 Ga0207426_1000143 3300025302 Bacteria 192948
55 Ga0209257_1000455 3300025304 Bacteria 75945
56 Ga0207656_10006847 3300025321 Bacteria 4125
57 Ga0207647_10002995 3300025904 Bacteria 12710
58 Ga0207699_10003182 3300025906 Bacteria 7812
59 Ga0207699_10003833 3300025906 Bacteria 7178
60 Ga0207654_10001647 3300025911 Bacteria 11680
61 Ga0207707_10000837 3300025912 Bacteria 30250
62 Ga0207707_10042596 3300025912 Bacteria 3961
63 Ga0207695_10000015 3300025913 Bacteria 803205
64 Ga0207693_10001000 3300025915 Bacteria 25410
65 Ga0207663_10003891 3300025916 Bacteria 7377
66 Ga0207657_10009975 3300025919 Bacteria 9507
67 Ga0207652_10009399 3300025921 Bacteria 7862
68 Ga0207694_10000504 3300025924 Bacteria 35370
69 Ga0207700_10007764 3300025928 Bacteria 6592
70 Ga0207665_10002330 3300025939 Bacteria 12823
71 Ga0207711_10006086 3300025941 Bacteria 10190
72 Ga0207661_10001777 3300025944 Bacteria 14749
73 Ga0207667_10046149 3300025949 Bacteria 4613
74 Ga0207639_10025290 3300026041 Bacteria 4304
75 Ga0207678_10011635 3300026067 Bacteria 7728
76 Ga0207702_10000093 3300026078 Bacteria 103678
77 Ga0207702_10000187 3300026078 Bacteria 74357
78 Ga0207674_10002601 3300026116 Bacteria 22677
79 Ga0207674_10016881 3300026116 Bacteria 7976
80 Ga0207698_10006680 3300026142 Bacteria 7209
81 Ga0209389_1000128 3300027296 Bacteria 67169
82 Ga0209389_1000227 3300027296 Bacteria 38173
83 Ga0209589_1000003 3300027357 Bacteria 629130
84 Ga0209589_1000180 3300027357 Bacteria 72900
85 Ga0209489_100003 3300027361 Bacteria 663105
86 Ga0209489_100031 3300027361 Bacteria 184074
87 Ga0209489_102410 3300027361 Bacteria 38173
88 Ga0209700_100003 3300027363 Bacteria 663105
89 Ga0209700_100010 3300027363 Bacteria 395269
90 Ga0268266_10001532 3300028379 Bacteria 27026
91 Ga0268266_10002347 3300028379 Bacteria 20466
92 Ga0268264_10000043 3300028381 Bacteria 371761
93 Ga0265336_10000257 3300028666 Bacteria 37828
94 Ga0265338_10000423 3300028800 Bacteria 75580
95 Ga0307511_10032868 3300030521 Bacteria 4594
96 Ga0265332_10003120 3300031238 Bacteria 8073
97 Ga0307508_10000001 3300031616 Bacteria 553635
98 Ga0265314_10011947 3300031711 Bacteria 7123
99 Ga0307516_10004624 3300031730 Bacteria 16887
100 Ga0307516_10014110 3300031730 Bacteria 8470
101 Ga0307510_10055650 3300033180 Bacteria 4129
102 Ga0315911_1000001 3300033442 Bacteria 1088602
103 Ga0373934_0001518 3300035086 Bacteria 8514
104 Ga0373953_0001286 3300035117 Bacteria 7191
105 Ga0373953_0005596 3300035117 Bacteria 4089
106 Ga0373956_0001625 3300035119 Bacteria 9247
107 Ga0373956_0001763 3300035119 Bacteria 8916
108 Ga0373957_0002470 3300035120 Bacteria 5286
109 Ga0373955_0001701 3300035172 Bacteria 9410
110 Ga0373931_0011526 3300035691 Bacteria 4272
111 Ga0373933_0000007 3300035724 Bacteria 123599
112 Ga0373933_0000670 3300035724 Bacteria 21197
113 Ga0373933_0004769 3300035724 Bacteria 7410
114 Ga0373937_0082681 3300036401 Bacteria 2971
115 Ga0373925_0004305 3300037068 Bacteria 10781
116 Ga0395900_0004826 3300037418 Bacteria 14204
117 Ga0395898_0010078 3300037466 Bacteria 9891
118 Ga0395901_0009643 3300038443 Bacteria 9795
119 Ga0395901_0037403 3300038443 Bacteria 5020
120 Ga0395901_0064825 3300038443 Bacteria 3803
121 Ga0466972_0001649 3300044658 Bacteria 10914
122 Ga0466966_0001170 3300044684 Bacteria 16864
123 Ga0466961_0000375 3300044693 Bacteria 28794
124 Ga0466957_0028554 3300044842 Bacteria 3323
125 Ga0495592_0001624 3300046454 Bacteria 15756
126 Ga0495603_0001300 3300046455 Bacteria 14524
127 Ga0495629_0000155 3300046459 Bacteria 60057
128 Ga0495629_0004468 3300046459 Bacteria 10484
129 Ga0495629_0025588 3300046459 Bacteria 4193
130 Ga0495641_0004153 3300046461 Bacteria 10411
131 Ga0495651_0000968 3300046462 Bacteria 22245
132 Ga0495651_0015261 3300046462 Bacteria 5938
133 Ga0495651_0032983 3300046462 Bacteria 4039
134 Ga0495582_0000125 3300046473 Bacteria 40813
135 Ga0495639_0000021 3300046475 Bacteria 73256
136 Ga0495662_0001709 3300046476 Bacteria 10970
137 Ga0495662_0012966 3300046476 Bacteria 4061
138 Ga0495594_0000042 3300046499 Bacteria 55641
139 Ga0495594_0011729 3300046499 Bacteria 4555
140 Ga0495606_0007511 3300046507 Bacteria 9727
141 Ga0495608_0005780 3300046511 Bacteria 8811
142 Ga0495608_0023041 3300046511 Bacteria 4269
143 Ga0495648_0001765 3300046524 Bacteria 20891
144 Ga0495666_0018162 3300046526 Bacteria 3503
145 Ga0495652_0002926 3300046529 Bacteria 17188
146 Ga0495652_0039527 3300046529 Bacteria 4079
147 Ga0495665_0000062 3300046531 Bacteria 44027
148 Ga0495665_0019043 3300046531 Bacteria 3690
149 Ga0495640_0014662 3300046533 Bacteria 5920
150 Ga0495640_0014728 3300046533 Bacteria 5907
151 Ga0495587_0002553 3300046536 Bacteria 12163
152 Ga0495587_0032629 3300046536 Bacteria 3147
153 Ga0495645_0014877 3300046543 Bacteria 5527
154 Ga0495667_0000733 3300046559 Bacteria 21034
155 Ga0495667_0009805 3300046559 Bacteria 6486
156 Ga0495667_0014736 3300046559 Bacteria 5283
157 Ga0495667_0036457 3300046559 Bacteria 3283
158 Ga0495656_0005551 3300046615 Bacteria 4358
159 Ga0495634_0004943 3300046642 Bacteria 10306
160 Ga0495635_0000461 3300046663 Bacteria 25739
161 Ga0495635_0013366 3300046663 Bacteria 5745
162 Ga0495635_0013760 3300046663 Bacteria 5661
163 Ga0495635_0058464 3300046663 Bacteria 2653
164 Ga0495657_0004962 3300046675 Bacteria 10578
165 Ga0495599_0032924 3300046678 Bacteria 3255
166 Ga0495623_0003534 3300046679 Bacteria 10342
167 Ga0495623_0011303 3300046679 Bacteria 5776
168 Ga0495646_0002074 3300046680 Bacteria 12144
169 Ga0495624_0000320 3300046690 Bacteria 38290
170 Ga0495600_0003587 3300046809 Bacteria 9140
171 Ga0495581_0000107 3300047315 Bacteria 34689
172 Ga0495581_0013809 3300047315 Bacteria 4681
173 Ga0495604_0006726 3300047317 Bacteria 9113
174 Ga0495604_0017854 3300047317 Bacteria 5675
175 Ga0495604_0024101 3300047317 Bacteria 4857
176 Ga0495674_0017694 3300047319 Bacteria 6635
177 Ga0495674_0038621 3300047319 Bacteria 4284
178 Ga0495680_0011606 3300047322 Bacteria 7785
179 Ga0495675_0001635 3300047444 Bacteria 13459
180 Ga0495684_0001818 3300047471 Bacteria 17157
181 Ga0495686_0027233 3300047472 Bacteria 3734
182 Ga0495593_0000013 3300047673 Bacteria 82874
183 Ga0495593_0009197 3300047673 Bacteria 5729
184 Ga0495602_0010994 3300048088 Bacteria 9375
185 Ga0495602_0025585 3300048088 Bacteria 5710
186 Ga0495602_0048290 3300048088 Bacteria 3826
187 Ga0496100_0003458 3300048903 Bacteria 8239
188 Ga0496101_0014515 3300048904 Bacteria 5296
189 Ga0496103_0023741 3300048906 Bacteria 3698
190 Ga0496104_0006959 3300048907 Bacteria 9971
191 Ga0496104_0039127 3300048907 Bacteria 4439
192 Ga0496105_0013347 3300048908 Bacteria 6519
193 Ga0496106_0000438 3300048909 Bacteria 29679
194 Ga0496108_0000878 3300048911 Bacteria 23435
195 Ga0496108_0051480 3300048911 Bacteria 3450
196 Ga0496109_0003651 3300048912 Bacteria 12862
197 Ga0496110_0010585 3300048913 Bacteria 7510
198 Ga0496112_0037874 3300048915 Bacteria 4709
199 Ga0496112_0086486 3300048915 Bacteria 3102
200 Ga0496114_0017795 3300048917 Bacteria 5743
201 Ga0496115_0061878 3300048918 Bacteria 3019
202 Ga0496116_0003305 3300048919 Bacteria 16036
203 Ga0496117_0016282 3300048920 Bacteria 6282
204 Ga0496118_0002745 3300048921 Bacteria 23133
205 Ga0496119_0015903 3300048922 Bacteria 5760
206 Ga0496121_0000271 3300048924 Bacteria 108693
207 Ga0496121_0000328 3300048924 Bacteria 99421
208 Ga0496121_0002799 3300048924 Bacteria 25841
209 Ga0496121_0004098 3300048924 Bacteria 20000
210 Ga0496121_0044725 3300048924 Bacteria 3814
211 Ga0496123_0024336 3300048926 Bacteria 4605
212 Ga0496124_0000378 3300048927 Bacteria 81220
213 Ga0496125_0000193 3300048928 Bacteria 130315
214 Ga0496125_0002441 3300048928 Bacteria 24144
215 Ga0496125_0020859 3300048928 Bacteria 6133
216 Ga0496126_0006455 3300048929 Bacteria 13067
217 Ga0496126_0009209 3300048929 Bacteria 10531
218 Ga0501031_0007439 3300049568 Bacteria 7136
219 Ga0501032_0000054 3300049569 Bacteria 100621
220 Ga0501032_0009286 3300049569 Bacteria 7126
221 Ga0501033_0000557 3300049570 Bacteria 34720
222 Ga0501033_0001269 3300049570 Bacteria 22559
223 Ga0501033_0003261 3300049570 Bacteria 13432
224 Ga0501034_0000177 3300049571 Bacteria 118966
225 Ga0501036_0000025 3300049572 Bacteria 106029
226 Ga0501036_0046599 3300049572 Bacteria 3671
227 Ga0501037_0000122 3300049573 Bacteria 72764
228 Ga0501037_0001356 3300049573 Bacteria 17972
229 Ga0501038_0000029 3300049574 Bacteria 132861
230 Ga0501038_0000628 3300049574 Bacteria 31365
231 Ga0501039_0009206 3300049575 Bacteria 7525
232 Ga0501039_0050445 3300049575 Bacteria 3219
233 Ga0501043_0000176 3300049579 Bacteria 57036
234 Ga0501043_0003504 3300049579 Bacteria 12906
235 Ga0501046_0000530 3300049580 Bacteria 37764
236 Ga0501047_0001757 3300049581 Bacteria 20992
237 Ga0501047_0014473 3300049581 Bacteria 7503
238 Ga0501048_0000277 3300049582 Bacteria 34591
239 Ga0501048_0012274 3300049582 Bacteria 6376
240 Ga0501067_0000125 3300049583 Bacteria 42216
241 Ga0501067_0000477 3300049583 Bacteria 21826
242 Ga0501068_0007227 3300049584 Bacteria 6147
243 Ga0501069_0002368 3300049585 Bacteria 9556
244 Ga0501073_0000295 3300049589 Bacteria 32831
245 Ga0501074_0001162 3300049590 Bacteria 17250
246 Ga0501079_0005237 3300049741 Bacteria 9638
247 Ga0501079_0011075 3300049741 Bacteria 6878
248 Ga0501080_0001903 3300049742 Bacteria 17983
249 Ga0501080_0016124 3300049742 Bacteria 6897
250 Ga0501080_0079874 3300049742 Bacteria 3040
251 Ga0501083_0000652 3300049744 Bacteria 22473
252 Ga0501035_0015085 3300049822 Bacteria 7129
253 Ga0501044_0000888 3300049823 Bacteria 36065
254 Ga0501044_0010347 3300049823 Bacteria 10126
255 Ga0501044_0057194 3300049823 Bacteria 4002
256 nmdc:mga0yw44_13240_c1 3300050492 Bacteria 4335
257 nmdc:mga07m45_997_c1 3300050496 Bacteria 12502
258 nmdc:mga05p37_47694_c1 3300050507 Bacteria 5267
259 Ga0495595_0017765 3300053084 Bacteria 3064
260 Ga0495619_0003788 3300053085 Bacteria 9724
261 Ga0500643_000085 3300053087 Bacteria 98026
262 Ga0500566_0000012 3300053094 Bacteria 117873
263 Ga0500556_0000004 3300053104 Bacteria 666287
264 Ga0500557_000002 3300053105 Bacteria 234207
265 Ga0500572_000840 3300053111 Bacteria 9611
266 Ga0500595_000283 3300053119 Bacteria 33654
267 Ga0500595_004178 3300053119 Bacteria 6539
268 Ga0500595_007119 3300053119 Bacteria 4674
269 Ga0500642_0000010 3300053130 Bacteria 272552
270 Ga0500642_0000144 3300053130 Bacteria 31539
271 Ga0500652_000075 3300053131 Bacteria 44277
272 Ga0500559_0000525 3300053136 Bacteria 26742
273 Ga0500559_0000912 3300053136 Bacteria 18812
274 Ga0500559_0004537 3300053136 Bacteria 6568
275 Ga0500568_0000442 3300053139 Bacteria 31123
276 Ga0500604_0000648 3300053151 Bacteria 9555
277 Ga0500616_0000014 3300053153 Bacteria 637918
278 Ga0500616_0000045 3300053153 Bacteria 339292
279 Ga0500622_0002129 3300053156 Bacteria 14744
280 Ga0500630_008293 3300053159 Bacteria 5088
281 Ga0500639_000095 3300053163 Bacteria 41536
282 Ga0500636_0000356 3300053177 Bacteria 25066
283 Ga0500636_0000607 3300053177 Bacteria 19450
284 Ga0500637_0000213 3300053178 Bacteria 21729
285 Ga0500601_000629 3300053737 Bacteria 4979
286 Ga0501084_0001741 3300054114 Bacteria 17282
287 Ga0500661_000869 3300055283 Bacteria 5643
288 Ga0501082_0000608 3300060353 Bacteria 31518
289 2507508964 2507262055 Bacteria 8048963
290 2508691242 2508501042 Bacteria 8719808
291 2509152766 2508501128 Bacteria 8613869
292 2513624331 2513237092 Bacteria 8341956
293 2513641968 2513237094 Bacteria 8789602
294 2513675571 2513237098 Bacteria 9902361
295 2513692248 2513237101 Bacteria 7952346
296 2513717915 2513237104 Bacteria 10034502
297 2513858074 2513237137 Bacteria 9558895
298 2513894339 2513237141 Bacteria 8496279
299 2513915505 2513237145 Bacteria 8979722
300 2517892835 2517572143 Bacteria 9484767
301 2524541081 2524023228 Bacteria 10118060
302 2603859213 2602042107 Bacteria 6226103
303 2644288572 2643221651 Bacteria 4798932
304 2671117527 2667528175 Bacteria 7532676
305 2723845382 2721755755 Bacteria 8322773
306 2728751675 2728368998 Bacteria 8720350
307 2793068200 2791355197 Bacteria 8420563
308 2793083417
309 2824604769 2824600985 Bacteria 8488197
310 2824615192 2824609381 Bacteria 8672835
311 2824655902 2824653114 Bacteria 8493680
312 2824712140 2824704595 Bacteria 9667483
313 2824762600 2824753945 Bacteria 9787441
314 2824773014 2824763712 Bacteria 9792355
315 2842039348 2842038055 Bacteria 8002051
316 2842047706 2842045827 Bacteria 8006841
317 2844318816 2844315083 Bacteria 8138177
318 2847935872 2847930680 Bacteria 9342022
319 2857514001 2857509624 Bacteria 7472071
320 2857527741 2857524615 Bacteria 6615449
321 2874608706 2874604998 Bacteria 7834745
322 2874627398 2874620515 Bacteria 8290088
323 2876767249 2876761206 Bacteria 10111113
324 2876809175 2876808645 Bacteria 8824342
325 2879111410 2879110137 Bacteria 8907982
326 2881371696 2881364244 Bacteria 7710352
327 2881666451 2881665667 Bacteria 8175609
328 2885372211 2885366525 Bacteria 8326213
329 2885381229 2885374607 Bacteria 8927485
330 2885389192 2885383462 Bacteria 9473874
331 2885418841 2885409591 Bacteria 9235467
332 2888424211 2888419890 Bacteria 7857137
333 2889040136 2889033259 Bacteria 9099371
334 2893071508 2893066018 Bacteria 6158120
335 2903732625 2903727486 Bacteria 8281579
336 2903750530 2903748898 Bacteria 9972761
337 2903769174 2903768456 Bacteria 9749579
338 2904671084 2904666416 Bacteria 8226587
339 2904696146 2904690495 Bacteria 9412302
340 2904702967
341 2904720835 2904711408 Bacteria 9771557
342 2906610302 2906602504 Bacteria 8295279
343 2906618175
344 2906629997 2906626472 Bacteria 8826946
345 2906639372 2906635258 Bacteria 8601019
346 2906646792 2906643746 Bacteria 8722424
347 2906664252 2906660503 Bacteria 8595048
348 2908743234 2908739725 Bacteria 8628932
349 2908760780 2908756301 Bacteria 8864324
350 2919079490 2919073203 Bacteria 6531949
351 2922365054 2922361189 Bacteria 7436256
352 2922390714 2922386360 Bacteria 7017218
353 2922429887
354 2932788473 2932784394 Bacteria 9704911
355 2932800547 2932794094 Bacteria 7915132
356 2932803093 2932801729 Bacteria 7987968
357 2932816302 2932809354 Bacteria 9135765
358 2932831556 2932828146 Bacteria 9745859
359 2935622397 2935616580 Bacteria 9032984
360 2935633533 2935630451 Bacteria 8169952
361 2935645174 2935638405 Bacteria 10015038
362 2935671797 2935665750 Bacteria 9571747
363 2935678800 2935675223 Bacteria 9928132
364 2935696253 2935694250 Bacteria 9291695
365 2935706999 2935703347 Bacteria 10242284
366 2935775057 2935769743 Bacteria 7878163
367 2935782690 2935777560 Bacteria 8077691
368 2935791726 2935785616 Bacteria 7962367
369 2935800042 2935793552 Bacteria 8012592
370 2935807654 2935801545 Bacteria 9301974
371 2935817078 2935810662 Bacteria 9401221
372 2935834641 2935827899 Bacteria 10038562
373 2935840324 2935837841 Bacteria 9454360
374 2935860535 2935855204 Bacteria 9035059
375 2935865427 2935864058 Bacteria 9784707
376 2935878023 2935873716 Bacteria 9632195
377 2935885432 2935883170 Bacteria 7964738
378 2935959955 2935959822 Bacteria 7869783
379 2935988483 2935984226 Bacteria 8302647
380 2935996028 2935992306 Bacteria 9802711
381 2936009502 2936002035 Bacteria 9362176
382 2936043457 2936037263 Bacteria 9446081
383 2941510424 2941507105 Bacteria 8166816
384 2941517839 2941515067 Bacteria 8166720
385 2941525855 2941523033 Bacteria 8169134
386 2941538341 2941531003 Bacteria 7653939
387 2941541545 2941538514 Bacteria 9402094
388 3005479768 3005474847 Bacteria 9259049
389 3005487083 3005483717 Bacteria 7877331
390 3005598963 3005594810 Bacteria 8716512
391 3005714541 3005710791 Bacteria 7622528
392 3005722056 3005718088 Bacteria 8283608
393 8006927490 8006926726 Bacteria 6749210
394 8006940896 8006933436 Bacteria 10410654
395 8006973070 8006964411 Bacteria 8966052
396 8006980911 8006973647 Bacteria 10679141
397 8006993612 8006984368 Bacteria 9651211
398 8007000505 8006994254 Bacteria 8309700
399 8016529958 8016522445 Bacteria 8156687
400 8016548402 8016539877 Bacteria 8155419
401 8016573534 8016566248 Bacteria 8158151
402 8016577661 8016575299 Bacteria 8154085
403 8016599925 8016595262 Bacteria 8149947
404 8016614080 8016613128 Bacteria 8794220
405 8017062812 8017057580 Bacteria 10023680
406 8019554069 8019547302 Bacteria 7996444
407 8019557249 8019555841 Bacteria 9642137
408 8019568053 8019565922 Bacteria 9639779
409 8019582249 8019576017 Bacteria 10049540
410 8019589944 8019586578 Bacteria 10212056
411 8019601329 8019597564 Bacteria 10041141
412 8019658076 8019648815 Bacteria 10014479
413 8019689677 8019687851 Bacteria 8712826
414 8056674147 8056673599 Bacteria 7871253
415 8056688142 8056681323 Bacteria 8472857
416 8056693756 8056689827 Bacteria 6712655
417 8056973199 8056967851 Bacteria 9038162
418 Ga0496109_0085368
419 JGI24739J22299_10001456
420 JGI25406J46586_10000004
421 JGI25153J46596_10002221
422 Ga0065165_1001490
423 Ga0065165_1002488
424 Ga0070709_10008179
425 Ga0070709_10008826
426 Ga0070679_100007374
427 Ga0068853_100012248
428 Ga0070665_100026259
429 Ga0068855_100015464
430 Ga0068855_100049475
431 Ga0068857_100012156
432 Ga0068856_100002027
433 Ga0068852_100012928
434 Ga0068851_10002699
435 Ga0068860_100001232
436 Ga0081455_10002977
437 Ga0081540_1000327
438 Ga0081540_1011166
439 Ga0081539_10000080
440 Ga0081539_10000258
441 Ga0081539_10019292
442 Ga0070717_10006504
443 Ga0070717_10010592
444 Ga0070715_10000080
445 Ga0070716_100004057
446 Ga0075369_10007255
447 Ga0068871_100002901
448 Ga0099824_1004033
449 Ga0105240_10010226
450 Ga0105240_10038000
451 Ga0105241_10020097
452 Ga0105248_10034936
453 Ga0105237_10003658
454 Ga0105238_10019670
455 Ga0105239_10009651
456 Ga0157375_10028609
457 Ga0214544_1000002
458 Ga0214542_1000153
459 Ga0214545_1000018
460 Ga0214543_1000001
461 Ga0209563_100449
462 Ga0209677_100573
463 Ga0209233_1003693
464 Ga0209455_1001664
465 Ga0209564_1001404
466 Ga0209758_1000021
467 Ga0209758_1000211
468 Ga0209758_1000388
469 Ga0209758_1012802
470 Ga0209256_1008185
471 Ga0207426_1000143
472 Ga0209257_1000455
473 Ga0207656_10006847
474 Ga0207647_10002995
475 Ga0207699_10003182
476 Ga0207699_10003833
477 Ga0207654_10001647
478 Ga0207707_10000837
479 Ga0207707_10042596
480 Ga0207695_10000015
481 Ga0207693_10001000
482 Ga0207663_10003891
483 Ga0207657_10009975
484 Ga0207652_10009399
485 Ga0207694_10000504
486 Ga0207700_10007764
487 Ga0207665_10002330
488 Ga0207711_10006086
489 Ga0207661_10001777
490 Ga0207667_10046149
491 Ga0207639_10025290
492 Ga0207678_10011635
493 Ga0207702_10000093
494 Ga0207702_10000187
495 Ga0207674_10002601
496 Ga0207674_10016881
497 Ga0207698_10006680
498 Ga0209389_1000128
499 Ga0209389_1000227
500 Ga0209589_1000003
501 Ga0209589_1000180
502 Ga0209489_100003
503 Ga0209489_100031
504 Ga0209489_102410
505 Ga0209700_100003
506 Ga0209700_100010
507 Ga0268266_10001532
508 Ga0268266_10002347
509 Ga0268264_10000043
510 Ga0265336_10000257
511 Ga0265338_10000423
512 Ga0307511_10032868
513 Ga0265332_10003120
514 Ga0307508_10000001
515 Ga0265314_10011947
516 Ga0307516_10004624
517 Ga0307516_10014110
518 Ga0307510_10055650
519 Ga0315911_1000001
520 Ga0373934_0001518
521 Ga0373953_0001286
522 Ga0373953_0005596
523 Ga0373956_0001625
524 Ga0373956_0001763
525 Ga0373957_0002470
526 Ga0373955_0001701
527 Ga0373931_0011526
528 Ga0373933_0000007
529 Ga0373933_0000670
530 Ga0373933_0004769
531 Ga0373937_0082681
532 Ga0373925_0004305
533 Ga0395900_0004826
534 Ga0395898_0010078
535 Ga0395901_0009643
536 Ga0395901_0037403
537 Ga0395901_0064825
538 Ga0466972_0001649
539 Ga0466966_0001170
540 Ga0466961_0000375
541 Ga0466957_0028554
542 Ga0495592_0001624
543 Ga0495603_0001300
544 Ga0495629_0000155
545 Ga0495629_0004468
546 Ga0495629_0025588
547 Ga0495641_0004153
548 Ga0495651_0000968
549 Ga0495651_0015261
550 Ga0495651_0032983
551 Ga0495582_0000125
552 Ga0495639_0000021
553 Ga0495662_0001709
554 Ga0495662_0012966
555 Ga0495594_0000042
556 Ga0495594_0011729
557 Ga0495606_0007511
558 Ga0495608_0005780
559 Ga0495608_0023041
560 Ga0495648_0001765
561 Ga0495666_0018162
562 Ga0495652_0002926
563 Ga0495652_0039527
564 Ga0495665_0000062
565 Ga0495665_0019043
566 Ga0495640_0014662
567 Ga0495640_0014728
568 Ga0495587_0002553
569 Ga0495587_0032629
570 Ga0495645_0014877
571 Ga0495667_0000733
572 Ga0495667_0009805
573 Ga0495667_0014736
574 Ga0495667_0036457
575 Ga0495656_0005551
576 Ga0495634_0004943
577 Ga0495635_0000461
578 Ga0495635_0013366
579 Ga0495635_0013760
580 Ga0495635_0058464
581 Ga0495657_0004962
582 Ga0495599_0032924
583 Ga0495623_0003534
584 Ga0495623_0011303
585 Ga0495646_0002074
586 Ga0495624_0000320
587 Ga0495600_0003587
588 Ga0495581_0000107
589 Ga0495581_0013809
590 Ga0495604_0006726
591 Ga0495604_0017854
592 Ga0495604_0024101
593 Ga0495674_0017694
594 Ga0495674_0038621
595 Ga0495680_0011606
596 Ga0495675_0001635
597 Ga0495684_0001818
598 Ga0495686_0027233
599 Ga0495593_0000013
600 Ga0495593_0009197
601 Ga0495602_0010994
602 Ga0495602_0025585
603 Ga0495602_0048290
604 Ga0496100_0003458
605 Ga0496101_0014515
606 Ga0496103_0023741
607 Ga0496104_0006959
608 Ga0496104_0039127
609 Ga0496105_0013347
610 Ga0496106_0000438
611 Ga0496108_0000878
612 Ga0496108_0051480
613 Ga0496109_0003651
614 Ga0496110_0010585
615 Ga0496112_0037874
616 Ga0496112_0086486
617 Ga0496114_0017795
618 Ga0496115_0061878
619 Ga0496116_0003305
620 Ga0496117_0016282
621 Ga0496118_0002745
622 Ga0496119_0015903
623 Ga0496121_0000271
624 Ga0496121_0000328
625 Ga0496121_0002799
626 Ga0496121_0004098
627 Ga0496121_0044725
628 Ga0496123_0024336
629 Ga0496124_0000378
630 Ga0496125_0000193
631 Ga0496125_0002441
632 Ga0496125_0020859
633 Ga0496126_0006455
634 Ga0496126_0009209
635 Ga0501031_0007439
636 Ga0501032_0000054
637 Ga0501032_0009286
638 Ga0501033_0000557
639 Ga0501033_0001269
640 Ga0501033_0003261
641 Ga0501034_0000177
642 Ga0501036_0000025
643 Ga0501036_0046599
644 Ga0501037_0000122
645 Ga0501037_0001356
646 Ga0501038_0000029
647 Ga0501038_0000628
648 Ga0501039_0009206
649 Ga0501039_0050445
650 Ga0501043_0000176
651 Ga0501043_0003504
652 Ga0501046_0000530
653 Ga0501047_0001757
654 Ga0501047_0014473
655 Ga0501048_0000277
656 Ga0501048_0012274
657 Ga0501067_0000125
658 Ga0501067_0000477
659 Ga0501068_0007227
660 Ga0501069_0002368
661 Ga0501073_0000295
662 Ga0501074_0001162
663 Ga0501079_0005237
664 Ga0501079_0011075
665 Ga0501080_0001903
666 Ga0501080_0016124
667 Ga0501080_0079874
668 Ga0501083_0000652
669 Ga0501035_0015085
670 Ga0501044_0000888
671 Ga0501044_0010347
672 Ga0501044_0057194
673 nmdc:mga0yw44_13240_c1
674 nmdc:mga07m45_997_c1
675 nmdc:mga05p37_47694_c1
676 Ga0495595_0017765
677 Ga0495619_0003788
678 Ga0500643_000085
679 Ga0500566_0000012
680 Ga0500556_0000004
681 Ga0500557_000002
682 Ga0500572_000840
683 Ga0500595_000283
684 Ga0500595_004178
685 Ga0500595_007119
686 Ga0500642_0000010
687 Ga0500642_0000144
688 Ga0500652_000075
689 Ga0500559_0000525
690 Ga0500559_0000912
691 Ga0500559_0004537
692 Ga0500568_0000442
693 Ga0500604_0000648
694 Ga0500616_0000014
695 Ga0500616_0000045
696 Ga0500622_0002129
697 Ga0500630_008293
698 Ga0500639_000095
699 Ga0500636_0000356
700 Ga0500636_0000607
701 Ga0500637_0000213
702 Ga0500601_000629
703 Ga0501084_0001741
704 Ga0500661_000869
705 Ga0501082_0000608
706 2507508964
707 2508691242
708 2509152766
709 2513624331
710 2513641968
711 2513675571
712 2513692248
713 2513717915
714 2513858074
715 2513894339
716 2513915505
717 2517892835
718 2524541081
719 2603859213
720 2644288572
721 2671117527
722 2723845382
723 2728751675
724 2793068200
725 2793083417
726 2824604769
727 2824615192
728 2824655902
729 2824712140
730 2824762600
731 2824773014
732 2842039348
733 2842047706
734 2844318816
735 2847935872
736 2857514001
737 2857527741
738 2874608706
739 2874627398
740 2876767249
741 2876809175
742 2879111410
743 2881371696
744 2881666451
745 2885372211
746 2885381229
747 2885389192
748 2885418841
749 2888424211
750 2889040136
751 2893071508
752 2903732625
753 2903750530
754 2903769174
755 2904671084
756 2904696146
757 2904702967
758 2904720835
759 2906610302
760 2906618175
761 2906629997
762 2906639372
763 2906646792
764 2906664252
765 2908743234
766 2908760780
767 2919079490
768 2922365054
769 2922390714
770 2922429887
771 2932788473
772 2932800547
773 2932803093
774 2932816302
775 2932831556
776 2935622397
777 2935633533
778 2935645174
779 2935671797
780 2935678800
781 2935696253
782 2935706999
783 2935775057
784 2935782690
785 2935791726
786 2935800042
787 2935807654
788 2935817078
789 2935834641
790 2935840324
791 2935860535
792 2935865427
793 2935878023
794 2935885432
795 2935959955
796 2935988483
797 2935996028
798 2936009502
799 2936043457
800 2941510424
801 2941517839
802 2941525855
803 2941538341
804 2941541545
805 3005479768
806 3005487083
807 3005598963
808 3005714541
809 3005722056
810 8006927490
811 8006940896
812 8006973070
813 8006980911
814 8006993612
815 8007000505
816 8016529958
817 8016548402
818 8016573534
819 8016577661
820 8016599925
821 8016614080
822 8017062812
823 8019554069
824 8019557249
825 8019568053
826 8019582249
827 8019589944
828 8019601329
829 8019658076
830 8019689677
831 8056674147
832 8056688142
833 8056693756
834 8056973199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

1

523

0.96

PF10458

Val_tRNA-synt_C

Valyl tRNA synthetase tRNA binding arm

766

822

0.96

PF08264

Anticodon_1

Anticodon-binding domain of tRNA ligase

565

711

0.9

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

1

126

0.79

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

426

541

0.77

PF13603

tRNA-synt_1_2

Leucyl-tRNA synthetase, editing domain

172

282

0.74

Map