F439162

General Info

Members Datasets Scaffolds Average Seq Length
417 201 834 139

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0006512|Ga0501034_0006512_1621_2079
Length 152
Sequence MTAQPAQQTTQRQTSQRTLVLVKPDGVRRGLTGEVIRRIEAKGYTLVALELRTATRDLLAQHYAEHEGKPFYEPLVEFMLSGPVVAMVVEGERVIEGFRSLAGATDPTTAAPGTIRGDLGRDWGLAVQQNLVHGSDAPESAEREIGIWFPQL

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
174 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
183 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
184 2739367653 Kocuria sp. OV113 Isolate Unclassified
185 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
186 2857727296 Kocuria sp. R-72562 Isolate Unclassified
187 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
188 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
189 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
190 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
191 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
192 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
193 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
194 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
195 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
196 2920879853 Kocuria salina CV6 Isolate Unclassified
197 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
198 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
199 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
200 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
201 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0.48
Isolates 4.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 6.24
Rhizosphere 85.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0006512 3300049571 Bacteria 12557
2 Ga0070658_10064255 3300005327 Bacteria 2994
3 Ga0070658_10072716 3300005327 Bacteria 2818
4 Ga0070658_11029916 3300005327 Bacteria 716
5 Ga0070683_100001571 3300005329 Bacteria 17647
6 Ga0070683_100005532 3300005329 Bacteria 10558
7 Ga0070683_100176358 3300005329 Bacteria 2029
8 Ga0070683_101152559 3300005329 Bacteria 745
9 Ga0070680_100101608 3300005336 Bacteria 2387
10 Ga0070682_100562973 3300005337 Bacteria 894
11 Ga0070682_100619828 3300005337 Bacteria 857
12 Ga0068868_100746457 3300005338 Bacteria 879
13 Ga0068868_101319497 3300005338 Bacteria 671
14 Ga0070660_100013192 3300005339 Bacteria 5921
15 Ga0070660_100256620 3300005339 Bacteria 1427
16 Ga0070691_10112856 3300005341 Bacteria 1361
17 Ga0070687_100871883 3300005343 Bacteria 643
18 Ga0070661_100113071 3300005344 Bacteria 2029
19 Ga0070659_100022910 3300005366 Bacteria 4774
20 Ga0070659_100599034 3300005366 Bacteria 947
21 Ga0070713_100014022 3300005436 Bacteria 5934
22 Ga0070663_100109938 3300005455 Bacteria 2070
23 Ga0070685_10121095 3300005466 Bacteria 1625
24 Ga0070679_100021615 3300005530 Bacteria 6284
25 Ga0070679_100381086 3300005530 Bacteria 1357
26 Ga0070684_100010384 3300005535 Bacteria 7374
27 Ga0070684_100103227 3300005535 Bacteria 2550
28 Ga0070684_100148432 3300005535 Bacteria 2123
29 Ga0070684_100240762 3300005535 Bacteria 1653
30 Ga0070684_101147509 3300005535 Bacteria 731
31 Ga0070665_100000868 3300005548 Bacteria 39125
32 Ga0070665_102650349 3300005548 Bacteria 502
33 Ga0068855_100624669 3300005563 Bacteria 1160
34 Ga0070664_100020111 3300005564 Bacteria 5497
35 Ga0068857_100006537 3300005577 Bacteria 10004
36 Ga0068857_100021943 3300005577 Bacteria 5619
37 Ga0068856_100008211 3300005614 Bacteria 10175
38 Ga0068864_100352100 3300005618 Bacteria 1390
39 Ga0068861_100508164 3300005719 Bacteria 1091
40 Ga0068858_100026761 3300005842 Bacteria 5357
41 Ga0068860_100096684 3300005843 Bacteria 2815
42 Ga0070717_10236814 3300006028 Bacteria 1608
43 Ga0068865_100114501 3300006881 Bacteria 1995
44 Ga0105240_10025605 3300009093 Bacteria 7748
45 Ga0105245_10015414 3300009098 Bacteria 6663
46 Ga0105243_10455138 3300009148 Bacteria 1202
47 Ga0105243_11345745 3300009148 Bacteria 733
48 Ga0105243_12757784 3300009148 Bacteria 532
49 Ga0105241_10003419 3300009174 Bacteria 11818
50 Ga0105248_10051721 3300009177 Bacteria 4609
51 Ga0105237_10116286 3300009545 Bacteria 2668
52 Ga0105249_10056409 3300009553 Bacteria 3596
53 Ga0105239_10001318 3300010375 Bacteria 33415
54 Ga0105246_10043913 3300011119 Bacteria 3035
55 Ga0157371_10203067 3300013102 Bacteria 1421
56 Ga0157371_10393522 3300013102 Bacteria 1013
57 Ga0157370_11226931 3300013104 Bacteria 676
58 Ga0157369_10045989 3300013105 Bacteria 4745
59 Ga0157369_10519564 3300013105 Bacteria 1231
60 Ga0157369_11662863 3300013105 Bacteria 649
61 Ga0157374_10796877 3300013296 Bacteria 960
62 Ga0163162_10042785 3300013306 Bacteria 4534
63 Ga0157372_10022652 3300013307 Bacteria 6800
64 Ga0157375_10338694 3300013308 Bacteria 1669
65 Ga0157375_10486217 3300013308 Bacteria 1399
66 Ga0157375_12137567 3300013308 Bacteria 666
67 Ga0163163_10135111 3300014325 Bacteria 2507
68 Ga0157380_11552252 3300014326 Bacteria 716
69 Ga0157377_10305759 3300014745 Bacteria 1051
70 Ga0157379_10012714 3300014968 Bacteria 7358
71 Ga0157376_10485516 3300014969 Bacteria 1211
72 Ga0206353_10938905 3300020082 Bacteria 1215
73 Ga0206353_11793161 3300020082 Bacteria 548
74 Ga0209148_1000624 3300025254 Bacteria 31386
75 Ga0207647_10026041 3300025904 Bacteria 3832
76 Ga0207647_10049583 3300025904 Bacteria 2603
77 Ga0207705_10013455 3300025909 Bacteria 5902
78 Ga0207705_11159009 3300025909 Bacteria 594
79 Ga0207654_10000001 3300025911 Bacteria 1816198
80 Ga0207695_10043223 3300025913 Bacteria 4803
81 Ga0207671_10413113 3300025914 Bacteria 1073
82 Ga0207663_10658311 3300025916 Bacteria 827
83 Ga0207660_10075115 3300025917 Bacteria 2468
84 Ga0207662_11002852 3300025918 Bacteria 593
85 Ga0207657_10030976 3300025919 Bacteria 4849
86 Ga0207657_10288532 3300025919 Bacteria 1302
87 Ga0207649_10861087 3300025920 Bacteria 709
88 Ga0207652_10163245 3300025921 Bacteria 1997
89 Ga0207652_10367852 3300025921 Bacteria 1298
90 Ga0207694_10838991 3300025924 Bacteria 777
91 Ga0207687_10026634 3300025927 Bacteria 3873
92 Ga0207687_10647948 3300025927 Bacteria 893
93 Ga0207690_10104710 3300025932 Bacteria 2027
94 Ga0207709_10243020 3300025935 Bacteria 1311
95 Ga0207709_10651036 3300025935 Bacteria 839
96 Ga0207704_11870518 3300025938 Bacteria 516
97 Ga0207711_10039720 3300025941 Bacteria 4003
98 Ga0207689_10098954 3300025942 Bacteria 2396
99 Ga0207661_10020025 3300025944 Bacteria 4996
100 Ga0207661_10020279 3300025944 Bacteria 4965
101 Ga0207661_10129395 3300025944 Bacteria 2160
102 Ga0207661_10383283 3300025944 Bacteria 1273
103 Ga0207667_10459203 3300025949 Bacteria 1294
104 Ga0207712_10059079 3300025961 Bacteria 2713
105 Ga0207677_10902355 3300026023 Bacteria 797
106 Ga0207703_10381877 3300026035 Bacteria 1303
107 Ga0207678_10709586 3300026067 Bacteria 885
108 Ga0207678_11091256 3300026067 Bacteria 707
109 Ga0207702_10102144 3300026078 Bacteria 2533
110 Ga0207676_11959276 3300026095 Bacteria 584
111 Ga0207674_10009885 3300026116 Bacteria 10853
112 Ga0207674_10022587 3300026116 Bacteria 6753
113 Ga0207674_10369689 3300026116 Bacteria 1386
114 Ga0207674_10441544 3300026116 Bacteria 1258
115 Ga0207675_100619048 3300026118 Bacteria 1087
116 Ga0207698_10046876 3300026142 Bacteria 3269
117 Ga0207698_10898692 3300026142 Bacteria 893
118 Ga0207698_11529917 3300026142 Bacteria 682
119 Ga0268266_10001392 3300028379 Bacteria 28952
120 Ga0268264_10425255 3300028381 Bacteria 1282
121 Ga0307515_10788305 3300028794 Bacteria 572
122 Ga0307513_10788458 3300031456 Bacteria 656
123 Ga0316575_10057595 3300031665 Bacteria 1549
124 Ga0307405_10484794 3300031731 Bacteria 988
125 Ga0307405_10827098 3300031731 Bacteria 778
126 Ga0307405_11809826 3300031731 Bacteria 543
127 Ga0307409_101135333 3300031995 Bacteria 803
128 Ga0307411_11799254 3300032005 Bacteria 569
129 Ga0307415_100969318 3300032126 Bacteria 788
130 Ga0395900_0002682 3300037418 Bacteria 19458
131 Ga0395905_0026161 3300037471 Bacteria 5504
132 Ga0395901_0037474 3300038443 Bacteria 5015
133 Ga0395901_0074736 3300038443 Bacteria 3535
134 Ga0395901_0143565 3300038443 Bacteria 2509
135 Ga0436365_1547931 3300039437 Bacteria 1176
136 Ga0451833_0381070 3300041491 Bacteria 596
137 Ga0451853_0898948 3300041512 Bacteria 617
138 Ga0439455_0126468 3300042012 Bacteria 719
139 Ga0450918_035068 3300042531 Bacteria 892
140 Ga0466972_0028874 3300044658 Bacteria 2733
141 Ga0466972_0131743 3300044658 Bacteria 1177
142 Ga0466965_0000002 3300044683 Bacteria 297957
143 Ga0466965_0037710 3300044683 Bacteria 2373
144 Ga0466966_0715182 3300044684 Bacteria 604
145 Ga0466961_0007929 3300044693 Bacteria 6767
146 Ga0466961_0062027 3300044693 Bacteria 2376
147 Ga0466961_0116617 3300044693 Bacteria 1678
148 Ga0466961_0186416 3300044693 Bacteria 1287
149 Ga0466961_0225170 3300044693 Bacteria 1155
150 Ga0466963_0053559 3300044694 Bacteria 2679
151 Ga0466963_0233110 3300044694 Bacteria 1290
152 Ga0466963_0330721 3300044694 Bacteria 1073
153 Ga0466964_0012500 3300044706 Bacteria 3213
154 Ga0466964_0563644 3300044706 Bacteria 620
155 Ga0466968_0057662 3300044735 Bacteria 1670
156 Ga0466968_0408105 3300044735 Bacteria 667
157 Ga0466968_0742890 3300044735 Bacteria 503
158 Ga0466970_0010082 3300044765 Bacteria 4788
159 Ga0466970_0041477 3300044765 Bacteria 2445
160 Ga0466970_0043836 3300044765 Bacteria 2381
161 Ga0466970_0126418 3300044765 Bacteria 1402
162 Ga0466957_0023822 3300044842 Bacteria 3622
163 Ga0466957_0129968 3300044842 Bacteria 1613
164 Ga0466957_0878123 3300044842 Bacteria 640
165 Ga0466960_0012695 3300044901 Bacteria 3561
166 Ga0466960_0165870 3300044901 Bacteria 1189
167 Ga0466960_0804991 3300044901 Bacteria 569
168 Ga0466959_1096213 3300045049 Bacteria 529
169 Ga0451576_0849271 3300045051 Bacteria 958
170 Ga0466958_0217390 3300045836 Bacteria 1219
171 Ga0466967_0011297 3300045976 Bacteria 6752
172 Ga0466967_0036242 3300045976 Bacteria 4208
173 Ga0466967_0156538 3300045976 Bacteria 2135
174 Ga0466967_0346854 3300045976 Bacteria 1436
175 Ga0466967_0348282 3300045976 Bacteria 1433
176 Ga0466967_0622454 3300045976 Bacteria 1066
177 Ga0466967_0709641 3300045976 Bacteria 996
178 Ga0466967_0804451 3300045976 Bacteria 933
179 Ga0466967_2260532 3300045976 Bacteria 539
180 Ga0495641_0208058 3300046461 Bacteria 877
181 Ga0495651_0173398 3300046462 Bacteria 1534
182 Ga0495650_0016313 3300046471 Bacteria 3768
183 Ga0495587_0683500 3300046536 Bacteria 563
184 Ga0495667_0156236 3300046559 Bacteria 1468
185 Ga0495635_0756010 3300046663 Bacteria 628
186 Ga0495657_0193392 3300046675 Bacteria 1243
187 Ga0495600_0346500 3300046809 Bacteria 931
188 Ga0495672_0027099 3300047320 Bacteria 3647
189 Ga0495676_0225445 3300047321 Bacteria 1290
190 Ga0496100_0034041 3300048903 Bacteria 3192
191 Ga0496100_0208347 3300048903 Bacteria 1429
192 Ga0496101_0023425 3300048904 Bacteria 4265
193 Ga0496102_0010117 3300048905 Bacteria 8113
194 Ga0496102_0064046 3300048905 Bacteria 3367
195 Ga0496103_0136395 3300048906 Bacteria 1568
196 Ga0496103_0366407 3300048906 Bacteria 926
197 Ga0496104_0029662 3300048907 Bacteria 5075
198 Ga0496104_0290344 3300048907 Bacteria 1548
199 Ga0496105_0051351 3300048908 Bacteria 3407
200 Ga0496107_0242531 3300048910 Bacteria 1341
201 Ga0496107_1155550 3300048910 Bacteria 558
202 Ga0496109_0021402 3300048912 Bacteria 5717
203 Ga0496109_0359138 3300048912 Bacteria 1376
204 Ga0496109_0506426 3300048912 Bacteria 1140
205 Ga0496109_0934456 3300048912 Bacteria 805
206 Ga0496110_0015929 3300048913 Bacteria 6270
207 Ga0496110_1087054 3300048913 Bacteria 708
208 Ga0496111_0001463 3300048914 Bacteria 13499
209 Ga0496111_0407996 3300048914 Bacteria 1004
210 Ga0496114_0043865 3300048917 Bacteria 3708
211 Ga0496114_0074237 3300048917 Bacteria 2863
212 Ga0496114_0530983 3300048917 Bacteria 1040
213 Ga0496114_1496544 3300048917 Bacteria 563
214 Ga0496115_0389200 3300048918 Bacteria 1132
215 Ga0496115_1335674 3300048918 Bacteria 532
216 Ga0496118_0037903 3300048921 Bacteria 3872
217 Ga0496119_0004803 3300048922 Bacteria 13262
218 Ga0496119_0064508 3300048922 Bacteria 2174
219 Ga0496119_0135545 3300048922 Bacteria 1336
220 Ga0496120_0010152 3300048923 Bacteria 6595
221 Ga0496120_0083639 3300048923 Bacteria 1722
222 Ga0496120_0119827 3300048923 Bacteria 1362
223 Ga0496121_0000528 3300048924 Bacteria 72606
224 Ga0496121_0258335 3300048924 Bacteria 1204
225 Ga0496121_0401225 3300048924 Bacteria 898
226 Ga0496121_0518775 3300048924 Bacteria 752
227 Ga0496124_0587222 3300048927 Bacteria 727
228 Ga0496126_0001272 3300048929 Bacteria 40541
229 Ga0496126_0035151 3300048929 Bacteria 4699
230 Ga0496126_0084231 3300048929 Bacteria 2804
231 Ga0496126_0191133 3300048929 Bacteria 1734
232 Ga0501031_0002626 3300049568 Bacteria 11443
233 Ga0501031_0005342 3300049568 Bacteria 8367
234 Ga0501031_0404675 3300049568 Bacteria 883
235 Ga0501032_0024504 3300049569 Bacteria 4166
236 Ga0501032_0066879 3300049569 Bacteria 2401
237 Ga0501032_0218070 3300049569 Bacteria 1242
238 Ga0501032_0244324 3300049569 Bacteria 1166
239 Ga0501032_0511337 3300049569 Bacteria 767
240 Ga0501033_0004564 3300049570 Bacteria 11090
241 Ga0501033_0018134 3300049570 Bacteria 5318
242 Ga0501033_0019142 3300049570 Bacteria 5176
243 Ga0501033_0025856 3300049570 Bacteria 4420
244 Ga0501033_1013142 3300049570 Bacteria 555
245 Ga0501034_0013012 3300049571 Bacteria 8577
246 Ga0501034_0052619 3300049571 Bacteria 4101
247 Ga0501034_0091248 3300049571 Bacteria 3044
248 Ga0501034_0104693 3300049571 Bacteria 2823
249 Ga0501034_0143872 3300049571 Bacteria 2362
250 Ga0501034_0287313 3300049571 Bacteria 1583
251 Ga0501034_0292212 3300049571 Bacteria 1567
252 Ga0501034_0583503 3300049571 Bacteria 1024
253 Ga0501034_0618516 3300049571 Bacteria 987
254 Ga0501036_0017667 3300049572 Bacteria 5968
255 Ga0501036_0032142 3300049572 Bacteria 4433
256 Ga0501036_0104081 3300049572 Bacteria 2400
257 Ga0501036_0327636 3300049572 Bacteria 1279
258 Ga0501036_0831147 3300049572 Bacteria 760
259 Ga0501037_0016849 3300049573 Bacteria 5376
260 Ga0501037_0032009 3300049573 Bacteria 3882
261 Ga0501037_0057046 3300049573 Bacteria 2852
262 Ga0501037_0127597 3300049573 Bacteria 1825
263 Ga0501037_0158795 3300049573 Bacteria 1612
264 Ga0501037_0414701 3300049573 Bacteria 922
265 Ga0501037_0430273 3300049573 Bacteria 902
266 Ga0501038_0000986 3300049574 Bacteria 25579
267 Ga0501038_0005101 3300049574 Bacteria 12204
268 Ga0501038_0030902 3300049574 Bacteria 4734
269 Ga0501038_0093818 3300049574 Bacteria 2510
270 Ga0501038_0107395 3300049574 Bacteria 2315
271 Ga0501038_0494005 3300049574 Bacteria 936
272 Ga0501038_0794503 3300049574 Bacteria 703
273 Ga0501039_0011177 3300049575 Bacteria 6840
274 Ga0501039_0094783 3300049575 Bacteria 2327
275 Ga0501039_0161442 3300049575 Bacteria 1761
276 Ga0501039_0218250 3300049575 Bacteria 1499
277 Ga0501040_0010072 3300049576 Bacteria 6176
278 Ga0501040_0238285 3300049576 Bacteria 1296
279 Ga0501041_0000493 3300049577 Bacteria 20222
280 Ga0501042_0002259 3300049578 Bacteria 11757
281 Ga0501042_0012714 3300049578 Bacteria 5712
282 Ga0501042_0014594 3300049578 Bacteria 5365
283 Ga0501042_0032226 3300049578 Bacteria 3710
284 Ga0501042_0343996 3300049578 Bacteria 1078
285 Ga0501043_0053808 3300049579 Bacteria 3161
286 Ga0501043_0088749 3300049579 Bacteria 2430
287 Ga0501043_0097864 3300049579 Bacteria 2306
288 Ga0501043_0185532 3300049579 Bacteria 1619
289 Ga0501043_0285828 3300049579 Bacteria 1263
290 Ga0501043_0308614 3300049579 Bacteria 1208
291 Ga0501043_0414294 3300049579 Bacteria 1016
292 Ga0501046_0002023 3300049580 Bacteria 19256
293 Ga0501046_0003153 3300049580 Bacteria 15217
294 Ga0501046_0006897 3300049580 Bacteria 10013
295 Ga0501046_0016287 3300049580 Bacteria 6231
296 Ga0501046_0035862 3300049580 Bacteria 3994
297 Ga0501046_0113096 3300049580 Bacteria 2072
298 Ga0501046_1080441 3300049580 Bacteria 555
299 Ga0501047_0001958 3300049581 Bacteria 19779
300 Ga0501047_0044568 3300049581 Bacteria 4286
301 Ga0501047_0046802 3300049581 Bacteria 4180
302 Ga0501047_0068749 3300049581 Bacteria 3411
303 Ga0501047_0104727 3300049581 Bacteria 2709
304 Ga0501047_0166623 3300049581 Bacteria 2073
305 Ga0501047_0212470 3300049581 Bacteria 1792
306 Ga0501047_0241344 3300049581 Bacteria 1657
307 Ga0501047_0349002 3300049581 Bacteria 1316
308 Ga0501048_0004427 3300049582 Bacteria 10697
309 Ga0501048_0006539 3300049582 Bacteria 8859
310 Ga0501048_0007135 3300049582 Bacteria 8490
311 Ga0501048_0034547 3300049582 Bacteria 3646
312 Ga0501067_0063875 3300049583 Bacteria 2039
313 Ga0501067_0122722 3300049583 Bacteria 1446
314 Ga0501067_0266780 3300049583 Bacteria 953
315 Ga0501068_0029728 3300049584 Bacteria 3238
316 Ga0501068_0437738 3300049584 Bacteria 845
317 Ga0501069_0009851 3300049585 Bacteria 5053
318 Ga0501069_0038764 3300049585 Bacteria 2631
319 Ga0501069_0048982 3300049585 Bacteria 2348
320 Ga0501069_0546531 3300049585 Bacteria 693
321 Ga0501070_0000621 3300049586 Bacteria 32571
322 Ga0501070_0098085 3300049586 Bacteria 2424
323 Ga0501070_0123247 3300049586 Bacteria 2142
324 Ga0501070_0574703 3300049586 Bacteria 900
325 Ga0501070_0697678 3300049586 Bacteria 803
326 Ga0501071_0003477 3300049587 Bacteria 9840
327 Ga0501071_0006763 3300049587 Bacteria 7464
328 Ga0501072_0010496 3300049588 Bacteria 7054
329 Ga0501072_0019617 3300049588 Bacteria 5229
330 Ga0501072_0356436 3300049588 Bacteria 1161
331 Ga0501072_0603498 3300049588 Bacteria 865
332 Ga0501073_0012510 3300049589 Bacteria 6194
333 Ga0501073_0042934 3300049589 Bacteria 3190
334 Ga0501073_0055963 3300049589 Bacteria 2759
335 Ga0501073_0359803 3300049589 Bacteria 1005
336 Ga0501073_0942322 3300049589 Bacteria 594
337 Ga0501074_0130921 3300049590 Bacteria 1794
338 Ga0501075_0249780 3300049591 Bacteria 1352
339 Ga0501075_0509146 3300049591 Bacteria 918
340 Ga0501076_0011976 3300049592 Bacteria 6479
341 Ga0501076_0015101 3300049592 Bacteria 5830
342 Ga0501077_0020508 3300049593 Bacteria 4184
343 Ga0501077_0032940 3300049593 Bacteria 3300
344 Ga0501079_0014628 3300049741 Bacteria 5985
345 Ga0501079_0029924 3300049741 Bacteria 4183
346 Ga0501079_1035569 3300049741 Bacteria 647
347 Ga0501079_1588874 3300049741 Bacteria 514
348 Ga0501080_0062921 3300049742 Bacteria 3453
349 Ga0501080_1144923 3300049742 Bacteria 670
350 Ga0501081_0003450 3300049743 Bacteria 10090
351 Ga0501081_0506388 3300049743 Bacteria 900
352 Ga0501083_0159658 3300049744 Bacteria 1475
353 Ga0501083_0631706 3300049744 Bacteria 697
354 Ga0501083_0997489 3300049744 Bacteria 545
355 Ga0501035_0009210 3300049822 Bacteria 9181
356 Ga0501035_0020277 3300049822 Bacteria 6104
357 Ga0501035_0022249 3300049822 Bacteria 5822
358 Ga0501035_0058856 3300049822 Bacteria 3422
359 Ga0501035_0078115 3300049822 Bacteria 2925
360 Ga0501035_0095991 3300049822 Bacteria 2605
361 Ga0501035_0111390 3300049822 Bacteria 2398
362 Ga0501035_0244178 3300049822 Bacteria 1526
363 Ga0501035_0414217 3300049822 Bacteria 1119
364 Ga0501035_0696831 3300049822 Bacteria 819
365 Ga0501044_0002953 3300049823 Bacteria 19346
366 Ga0501044_0017489 3300049823 Bacteria 7696
367 Ga0501044_0021908 3300049823 Bacteria 6814
368 Ga0501044_0029757 3300049823 Bacteria 5757
369 Ga0501044_0092886 3300049823 Bacteria 3043
370 Ga0501044_0118241 3300049823 Bacteria 2653
371 Ga0501044_0385237 3300049823 Bacteria 1316
372 Ga0501044_0385244 3300049823 Bacteria 1316
373 Ga0501044_0533336 3300049823 Bacteria 1072
374 Ga0501045_0002771 3300049824 Bacteria 11968
375 Ga0501045_0046664 3300049824 Bacteria 3155
376 Ga0501045_0058120 3300049824 Bacteria 2831
377 Ga0501045_0264288 3300049824 Bacteria 1281
378 Ga0501045_0376008 3300049824 Bacteria 1057
379 Ga0501045_0863685 3300049824 Bacteria 665
380 Ga0495601_0726214 3300053077 Bacteria 633
381 Ga0495619_0078881 3300053085 Bacteria 2214
382 Ga0500554_135161 3300053102 Bacteria 833
383 Ga0500592_025058 3300053116 Bacteria 962
384 Ga0500568_0000049 3300053139 Bacteria 116515
385 Ga0500568_0012594 3300053139 Bacteria 3882
386 Ga0500568_0168194 3300053139 Bacteria 807
387 Ga0500573_0012971 3300053140 Bacteria 4686
388 Ga0500573_0099600 3300053140 Bacteria 1637
389 Ga0500577_0062165 3300053142 Bacteria 1439
390 Ga0501084_0026469 3300054114 Bacteria 4840
391 Ga0501084_0080376 3300054114 Bacteria 2733
392 Ga0501082_0002317 3300060353 Bacteria 16653
393 Ga0466962_0224645 3300061719 Bacteria 920
394 Ga0466962_0372999 3300061719 Bacteria 712
395 Ga0466962_0603143 3300061719 Bacteria 560
396 Ga0530510_0001985 3300061734 Bacteria 14025
397 Ga0530510_0033798 3300061734 Bacteria 3682
398 2723642056 2721755702 Bacteria 4373124
399 2729905710 2728369276 Bacteria 5610032
400 2739602464 2739367653 Bacteria 2780952
401 2817509024 2816332305 Bacteria 2697803
402 2857729225 2857727296 Bacteria 2745552
403 2857730049 2857729791 Bacteria 4040535
404 2893686916 2893684298 Bacteria 2897960
405 2895661311 2895660088 Bacteria 3782833
406 2904433450 2904430863 Bacteria 3486923
407 2904503683 2904501621 Bacteria 3401437
408 2908675323 2908674828 Bacteria 3382763
409 2909075354 2909074476 Bacteria 3436050
410 2919040007 2919039151 Bacteria 3391018
411 2919447185 2919446982 Bacteria 3994487
412 2920881943 2920879853 Bacteria 4216831
413 2928123274 2928121344 Bacteria 3972376
414 2928501348 2928500415 Bacteria 3384541
415 2935411406 2935409751 Bacteria 4179611
416 2984553515 2984551494 Bacteria 3877562
417 8046356415 8046352972 Bacteria 3613806
418 Ga0501034_0006512
419 Ga0070658_10064255
420 Ga0070658_10072716
421 Ga0070658_11029916
422 Ga0070683_100001571
423 Ga0070683_100005532
424 Ga0070683_100176358
425 Ga0070683_101152559
426 Ga0070680_100101608
427 Ga0070682_100562973
428 Ga0070682_100619828
429 Ga0068868_100746457
430 Ga0068868_101319497
431 Ga0070660_100013192
432 Ga0070660_100256620
433 Ga0070691_10112856
434 Ga0070687_100871883
435 Ga0070661_100113071
436 Ga0070659_100022910
437 Ga0070659_100599034
438 Ga0070713_100014022
439 Ga0070663_100109938
440 Ga0070685_10121095
441 Ga0070679_100021615
442 Ga0070679_100381086
443 Ga0070684_100010384
444 Ga0070684_100103227
445 Ga0070684_100148432
446 Ga0070684_100240762
447 Ga0070684_101147509
448 Ga0070665_100000868
449 Ga0070665_102650349
450 Ga0068855_100624669
451 Ga0070664_100020111
452 Ga0068857_100006537
453 Ga0068857_100021943
454 Ga0068856_100008211
455 Ga0068864_100352100
456 Ga0068861_100508164
457 Ga0068858_100026761
458 Ga0068860_100096684
459 Ga0070717_10236814
460 Ga0068865_100114501
461 Ga0105240_10025605
462 Ga0105245_10015414
463 Ga0105243_10455138
464 Ga0105243_11345745
465 Ga0105243_12757784
466 Ga0105241_10003419
467 Ga0105248_10051721
468 Ga0105237_10116286
469 Ga0105249_10056409
470 Ga0105239_10001318
471 Ga0105246_10043913
472 Ga0157371_10203067
473 Ga0157371_10393522
474 Ga0157370_11226931
475 Ga0157369_10045989
476 Ga0157369_10519564
477 Ga0157369_11662863
478 Ga0157374_10796877
479 Ga0163162_10042785
480 Ga0157372_10022652
481 Ga0157375_10338694
482 Ga0157375_10486217
483 Ga0157375_12137567
484 Ga0163163_10135111
485 Ga0157380_11552252
486 Ga0157377_10305759
487 Ga0157379_10012714
488 Ga0157376_10485516
489 Ga0206353_10938905
490 Ga0206353_11793161
491 Ga0209148_1000624
492 Ga0207647_10026041
493 Ga0207647_10049583
494 Ga0207705_10013455
495 Ga0207705_11159009
496 Ga0207654_10000001
497 Ga0207695_10043223
498 Ga0207671_10413113
499 Ga0207663_10658311
500 Ga0207660_10075115
501 Ga0207662_11002852
502 Ga0207657_10030976
503 Ga0207657_10288532
504 Ga0207649_10861087
505 Ga0207652_10163245
506 Ga0207652_10367852
507 Ga0207694_10838991
508 Ga0207687_10026634
509 Ga0207687_10647948
510 Ga0207690_10104710
511 Ga0207709_10243020
512 Ga0207709_10651036
513 Ga0207704_11870518
514 Ga0207711_10039720
515 Ga0207689_10098954
516 Ga0207661_10020025
517 Ga0207661_10020279
518 Ga0207661_10129395
519 Ga0207661_10383283
520 Ga0207667_10459203
521 Ga0207712_10059079
522 Ga0207677_10902355
523 Ga0207703_10381877
524 Ga0207678_10709586
525 Ga0207678_11091256
526 Ga0207702_10102144
527 Ga0207676_11959276
528 Ga0207674_10009885
529 Ga0207674_10022587
530 Ga0207674_10369689
531 Ga0207674_10441544
532 Ga0207675_100619048
533 Ga0207698_10046876
534 Ga0207698_10898692
535 Ga0207698_11529917
536 Ga0268266_10001392
537 Ga0268264_10425255
538 Ga0307515_10788305
539 Ga0307513_10788458
540 Ga0316575_10057595
541 Ga0307405_10484794
542 Ga0307405_10827098
543 Ga0307405_11809826
544 Ga0307409_101135333
545 Ga0307411_11799254
546 Ga0307415_100969318
547 Ga0395900_0002682
548 Ga0395905_0026161
549 Ga0395901_0037474
550 Ga0395901_0074736
551 Ga0395901_0143565
552 Ga0436365_1547931
553 Ga0451833_0381070
554 Ga0451853_0898948
555 Ga0439455_0126468
556 Ga0450918_035068
557 Ga0466972_0028874
558 Ga0466972_0131743
559 Ga0466965_0000002
560 Ga0466965_0037710
561 Ga0466966_0715182
562 Ga0466961_0007929
563 Ga0466961_0062027
564 Ga0466961_0116617
565 Ga0466961_0186416
566 Ga0466961_0225170
567 Ga0466963_0053559
568 Ga0466963_0233110
569 Ga0466963_0330721
570 Ga0466964_0012500
571 Ga0466964_0563644
572 Ga0466968_0057662
573 Ga0466968_0408105
574 Ga0466968_0742890
575 Ga0466970_0010082
576 Ga0466970_0041477
577 Ga0466970_0043836
578 Ga0466970_0126418
579 Ga0466957_0023822
580 Ga0466957_0129968
581 Ga0466957_0878123
582 Ga0466960_0012695
583 Ga0466960_0165870
584 Ga0466960_0804991
585 Ga0466959_1096213
586 Ga0451576_0849271
587 Ga0466958_0217390
588 Ga0466967_0011297
589 Ga0466967_0036242
590 Ga0466967_0156538
591 Ga0466967_0346854
592 Ga0466967_0348282
593 Ga0466967_0622454
594 Ga0466967_0709641
595 Ga0466967_0804451
596 Ga0466967_2260532
597 Ga0495641_0208058
598 Ga0495651_0173398
599 Ga0495650_0016313
600 Ga0495587_0683500
601 Ga0495667_0156236
602 Ga0495635_0756010
603 Ga0495657_0193392
604 Ga0495600_0346500
605 Ga0495672_0027099
606 Ga0495676_0225445
607 Ga0496100_0034041
608 Ga0496100_0208347
609 Ga0496101_0023425
610 Ga0496102_0010117
611 Ga0496102_0064046
612 Ga0496103_0136395
613 Ga0496103_0366407
614 Ga0496104_0029662
615 Ga0496104_0290344
616 Ga0496105_0051351
617 Ga0496107_0242531
618 Ga0496107_1155550
619 Ga0496109_0021402
620 Ga0496109_0359138
621 Ga0496109_0506426
622 Ga0496109_0934456
623 Ga0496110_0015929
624 Ga0496110_1087054
625 Ga0496111_0001463
626 Ga0496111_0407996
627 Ga0496114_0043865
628 Ga0496114_0074237
629 Ga0496114_0530983
630 Ga0496114_1496544
631 Ga0496115_0389200
632 Ga0496115_1335674
633 Ga0496118_0037903
634 Ga0496119_0004803
635 Ga0496119_0064508
636 Ga0496119_0135545
637 Ga0496120_0010152
638 Ga0496120_0083639
639 Ga0496120_0119827
640 Ga0496121_0000528
641 Ga0496121_0258335
642 Ga0496121_0401225
643 Ga0496121_0518775
644 Ga0496124_0587222
645 Ga0496126_0001272
646 Ga0496126_0035151
647 Ga0496126_0084231
648 Ga0496126_0191133
649 Ga0501031_0002626
650 Ga0501031_0005342
651 Ga0501031_0404675
652 Ga0501032_0024504
653 Ga0501032_0066879
654 Ga0501032_0218070
655 Ga0501032_0244324
656 Ga0501032_0511337
657 Ga0501033_0004564
658 Ga0501033_0018134
659 Ga0501033_0019142
660 Ga0501033_0025856
661 Ga0501033_1013142
662 Ga0501034_0013012
663 Ga0501034_0052619
664 Ga0501034_0091248
665 Ga0501034_0104693
666 Ga0501034_0143872
667 Ga0501034_0287313
668 Ga0501034_0292212
669 Ga0501034_0583503
670 Ga0501034_0618516
671 Ga0501036_0017667
672 Ga0501036_0032142
673 Ga0501036_0104081
674 Ga0501036_0327636
675 Ga0501036_0831147
676 Ga0501037_0016849
677 Ga0501037_0032009
678 Ga0501037_0057046
679 Ga0501037_0127597
680 Ga0501037_0158795
681 Ga0501037_0414701
682 Ga0501037_0430273
683 Ga0501038_0000986
684 Ga0501038_0005101
685 Ga0501038_0030902
686 Ga0501038_0093818
687 Ga0501038_0107395
688 Ga0501038_0494005
689 Ga0501038_0794503
690 Ga0501039_0011177
691 Ga0501039_0094783
692 Ga0501039_0161442
693 Ga0501039_0218250
694 Ga0501040_0010072
695 Ga0501040_0238285
696 Ga0501041_0000493
697 Ga0501042_0002259
698 Ga0501042_0012714
699 Ga0501042_0014594
700 Ga0501042_0032226
701 Ga0501042_0343996
702 Ga0501043_0053808
703 Ga0501043_0088749
704 Ga0501043_0097864
705 Ga0501043_0185532
706 Ga0501043_0285828
707 Ga0501043_0308614
708 Ga0501043_0414294
709 Ga0501046_0002023
710 Ga0501046_0003153
711 Ga0501046_0006897
712 Ga0501046_0016287
713 Ga0501046_0035862
714 Ga0501046_0113096
715 Ga0501046_1080441
716 Ga0501047_0001958
717 Ga0501047_0044568
718 Ga0501047_0046802
719 Ga0501047_0068749
720 Ga0501047_0104727
721 Ga0501047_0166623
722 Ga0501047_0212470
723 Ga0501047_0241344
724 Ga0501047_0349002
725 Ga0501048_0004427
726 Ga0501048_0006539
727 Ga0501048_0007135
728 Ga0501048_0034547
729 Ga0501067_0063875
730 Ga0501067_0122722
731 Ga0501067_0266780
732 Ga0501068_0029728
733 Ga0501068_0437738
734 Ga0501069_0009851
735 Ga0501069_0038764
736 Ga0501069_0048982
737 Ga0501069_0546531
738 Ga0501070_0000621
739 Ga0501070_0098085
740 Ga0501070_0123247
741 Ga0501070_0574703
742 Ga0501070_0697678
743 Ga0501071_0003477
744 Ga0501071_0006763
745 Ga0501072_0010496
746 Ga0501072_0019617
747 Ga0501072_0356436
748 Ga0501072_0603498
749 Ga0501073_0012510
750 Ga0501073_0042934
751 Ga0501073_0055963
752 Ga0501073_0359803
753 Ga0501073_0942322
754 Ga0501074_0130921
755 Ga0501075_0249780
756 Ga0501075_0509146
757 Ga0501076_0011976
758 Ga0501076_0015101
759 Ga0501077_0020508
760 Ga0501077_0032940
761 Ga0501079_0014628
762 Ga0501079_0029924
763 Ga0501079_1035569
764 Ga0501079_1588874
765 Ga0501080_0062921
766 Ga0501080_1144923
767 Ga0501081_0003450
768 Ga0501081_0506388
769 Ga0501083_0159658
770 Ga0501083_0631706
771 Ga0501083_0997489
772 Ga0501035_0009210
773 Ga0501035_0020277
774 Ga0501035_0022249
775 Ga0501035_0058856
776 Ga0501035_0078115
777 Ga0501035_0095991
778 Ga0501035_0111390
779 Ga0501035_0244178
780 Ga0501035_0414217
781 Ga0501035_0696831
782 Ga0501044_0002953
783 Ga0501044_0017489
784 Ga0501044_0021908
785 Ga0501044_0029757
786 Ga0501044_0092886
787 Ga0501044_0118241
788 Ga0501044_0385237
789 Ga0501044_0385244
790 Ga0501044_0533336
791 Ga0501045_0002771
792 Ga0501045_0046664
793 Ga0501045_0058120
794 Ga0501045_0264288
795 Ga0501045_0376008
796 Ga0501045_0863685
797 Ga0495601_0726214
798 Ga0495619_0078881
799 Ga0500554_135161
800 Ga0500592_025058
801 Ga0500568_0000049
802 Ga0500568_0012594
803 Ga0500568_0168194
804 Ga0500573_0012971
805 Ga0500573_0099600
806 Ga0500577_0062165
807 Ga0501084_0026469
808 Ga0501084_0080376
809 Ga0501082_0002317
810 Ga0466962_0224645
811 Ga0466962_0372999
812 Ga0466962_0603143
813 Ga0530510_0001985
814 Ga0530510_0033798
815 2723642056
816 2729905710
817 2739602464
818 2817509024
819 2857729225
820 2857730049
821 2893686916
822 2895661311
823 2904433450
824 2904503683
825 2908675323
826 2909075354
827 2919040007
828 2919447185
829 2920881943
830 2928123274
831 2928501348
832 2935411406
833 2984553515
834 8046356415

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

16

152

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iol-assembly1.cif.gz_F crystal structure of nucleoside diphosphate kinase from schistosoma mansoni 0.9733 2 136
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9668 2 136
3vgv-assembly6.cif.gz_L e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 0.9653 2 136
4ek2-assembly1.cif.gz_A the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate 0.9645 2 136
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9622 2 136
ID Description Score Start End Superfamily
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9889 2 77 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9563 1 136 3.30.70.141
af_A0A1D6EH51_54_191_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9506 19 136 3.30.70.141
5go1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9487 1 136 3.30.70.141
6ay1F00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9481 4 136 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A1M3BKP0-F1-model_v4 nucleoside-diphosphate kinase (EC 2.7.4.6) 0.9948 1 105 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
AF-A0A2Y9HWM5-F1-model_v4 nucleoside-diphosphate kinase (EC 2.7.4.6) 0.9921 2 104 GO:0004550
GO:0005741
GO:0005856
GO:0006183
GO:0006228
GO:0006241
GO:0042995
AF-A0A3Q7PG60-F1-model_v4 nucleoside-diphosphate kinase (EC 2.7.4.6) 0.9913 2 107 GO:0004550
GO:0005741
GO:0005856
GO:0006183
GO:0006228
GO:0006241
GO:0042995
AF-A0A3Q7VS53-F1-model_v4 deleted 0.9885 2 105
AF-A0A7X6TSR4-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9845 1 135 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241

Map