F439162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 417 | 201 | 834 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0006512|Ga0501034_0006512_1621_2079 |
| Length | 152 |
| Sequence | MTAQPAQQTTQRQTSQRTLVLVKPDGVRRGLTGEVIRRIEAKGYTLVALELRTATRDLLAQHYAEHEGKPFYEPLVEFMLSGPVVAMVVEGERVIEGFRSLAGATDPTTAAPGTIRGDLGRDWGLAVQQNLVHGSDAPESAEREIGIWFPQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 83 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 84 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 85 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 87 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 88 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 93 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 94 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 95 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 96 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 97 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 98 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 99 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 100 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 101 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 102 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 103 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 104 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 105 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 106 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 107 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 108 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 109 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 110 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 111 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 127 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 130 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 131 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 134 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 135 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 136 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 137 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 138 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 139 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 174 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 175 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 176 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 177 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 178 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 181 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 182 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 183 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 184 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 185 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 186 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 187 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 188 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 189 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 190 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 191 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 192 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 193 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 194 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 195 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 196 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 197 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 198 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 199 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 200 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 201 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 0.48 |
| Isolates | 4.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 2.16 |
| Nodule | 0 |
| Rhizoplane | 6.24 |
| Rhizosphere | 85.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0006512 | 3300049571 | Bacteria | 12557 |
| 2 | Ga0070658_10064255 | 3300005327 | Bacteria | 2994 |
| 3 | Ga0070658_10072716 | 3300005327 | Bacteria | 2818 |
| 4 | Ga0070658_11029916 | 3300005327 | Bacteria | 716 |
| 5 | Ga0070683_100001571 | 3300005329 | Bacteria | 17647 |
| 6 | Ga0070683_100005532 | 3300005329 | Bacteria | 10558 |
| 7 | Ga0070683_100176358 | 3300005329 | Bacteria | 2029 |
| 8 | Ga0070683_101152559 | 3300005329 | Bacteria | 745 |
| 9 | Ga0070680_100101608 | 3300005336 | Bacteria | 2387 |
| 10 | Ga0070682_100562973 | 3300005337 | Bacteria | 894 |
| 11 | Ga0070682_100619828 | 3300005337 | Bacteria | 857 |
| 12 | Ga0068868_100746457 | 3300005338 | Bacteria | 879 |
| 13 | Ga0068868_101319497 | 3300005338 | Bacteria | 671 |
| 14 | Ga0070660_100013192 | 3300005339 | Bacteria | 5921 |
| 15 | Ga0070660_100256620 | 3300005339 | Bacteria | 1427 |
| 16 | Ga0070691_10112856 | 3300005341 | Bacteria | 1361 |
| 17 | Ga0070687_100871883 | 3300005343 | Bacteria | 643 |
| 18 | Ga0070661_100113071 | 3300005344 | Bacteria | 2029 |
| 19 | Ga0070659_100022910 | 3300005366 | Bacteria | 4774 |
| 20 | Ga0070659_100599034 | 3300005366 | Bacteria | 947 |
| 21 | Ga0070713_100014022 | 3300005436 | Bacteria | 5934 |
| 22 | Ga0070663_100109938 | 3300005455 | Bacteria | 2070 |
| 23 | Ga0070685_10121095 | 3300005466 | Bacteria | 1625 |
| 24 | Ga0070679_100021615 | 3300005530 | Bacteria | 6284 |
| 25 | Ga0070679_100381086 | 3300005530 | Bacteria | 1357 |
| 26 | Ga0070684_100010384 | 3300005535 | Bacteria | 7374 |
| 27 | Ga0070684_100103227 | 3300005535 | Bacteria | 2550 |
| 28 | Ga0070684_100148432 | 3300005535 | Bacteria | 2123 |
| 29 | Ga0070684_100240762 | 3300005535 | Bacteria | 1653 |
| 30 | Ga0070684_101147509 | 3300005535 | Bacteria | 731 |
| 31 | Ga0070665_100000868 | 3300005548 | Bacteria | 39125 |
| 32 | Ga0070665_102650349 | 3300005548 | Bacteria | 502 |
| 33 | Ga0068855_100624669 | 3300005563 | Bacteria | 1160 |
| 34 | Ga0070664_100020111 | 3300005564 | Bacteria | 5497 |
| 35 | Ga0068857_100006537 | 3300005577 | Bacteria | 10004 |
| 36 | Ga0068857_100021943 | 3300005577 | Bacteria | 5619 |
| 37 | Ga0068856_100008211 | 3300005614 | Bacteria | 10175 |
| 38 | Ga0068864_100352100 | 3300005618 | Bacteria | 1390 |
| 39 | Ga0068861_100508164 | 3300005719 | Bacteria | 1091 |
| 40 | Ga0068858_100026761 | 3300005842 | Bacteria | 5357 |
| 41 | Ga0068860_100096684 | 3300005843 | Bacteria | 2815 |
| 42 | Ga0070717_10236814 | 3300006028 | Bacteria | 1608 |
| 43 | Ga0068865_100114501 | 3300006881 | Bacteria | 1995 |
| 44 | Ga0105240_10025605 | 3300009093 | Bacteria | 7748 |
| 45 | Ga0105245_10015414 | 3300009098 | Bacteria | 6663 |
| 46 | Ga0105243_10455138 | 3300009148 | Bacteria | 1202 |
| 47 | Ga0105243_11345745 | 3300009148 | Bacteria | 733 |
| 48 | Ga0105243_12757784 | 3300009148 | Bacteria | 532 |
| 49 | Ga0105241_10003419 | 3300009174 | Bacteria | 11818 |
| 50 | Ga0105248_10051721 | 3300009177 | Bacteria | 4609 |
| 51 | Ga0105237_10116286 | 3300009545 | Bacteria | 2668 |
| 52 | Ga0105249_10056409 | 3300009553 | Bacteria | 3596 |
| 53 | Ga0105239_10001318 | 3300010375 | Bacteria | 33415 |
| 54 | Ga0105246_10043913 | 3300011119 | Bacteria | 3035 |
| 55 | Ga0157371_10203067 | 3300013102 | Bacteria | 1421 |
| 56 | Ga0157371_10393522 | 3300013102 | Bacteria | 1013 |
| 57 | Ga0157370_11226931 | 3300013104 | Bacteria | 676 |
| 58 | Ga0157369_10045989 | 3300013105 | Bacteria | 4745 |
| 59 | Ga0157369_10519564 | 3300013105 | Bacteria | 1231 |
| 60 | Ga0157369_11662863 | 3300013105 | Bacteria | 649 |
| 61 | Ga0157374_10796877 | 3300013296 | Bacteria | 960 |
| 62 | Ga0163162_10042785 | 3300013306 | Bacteria | 4534 |
| 63 | Ga0157372_10022652 | 3300013307 | Bacteria | 6800 |
| 64 | Ga0157375_10338694 | 3300013308 | Bacteria | 1669 |
| 65 | Ga0157375_10486217 | 3300013308 | Bacteria | 1399 |
| 66 | Ga0157375_12137567 | 3300013308 | Bacteria | 666 |
| 67 | Ga0163163_10135111 | 3300014325 | Bacteria | 2507 |
| 68 | Ga0157380_11552252 | 3300014326 | Bacteria | 716 |
| 69 | Ga0157377_10305759 | 3300014745 | Bacteria | 1051 |
| 70 | Ga0157379_10012714 | 3300014968 | Bacteria | 7358 |
| 71 | Ga0157376_10485516 | 3300014969 | Bacteria | 1211 |
| 72 | Ga0206353_10938905 | 3300020082 | Bacteria | 1215 |
| 73 | Ga0206353_11793161 | 3300020082 | Bacteria | 548 |
| 74 | Ga0209148_1000624 | 3300025254 | Bacteria | 31386 |
| 75 | Ga0207647_10026041 | 3300025904 | Bacteria | 3832 |
| 76 | Ga0207647_10049583 | 3300025904 | Bacteria | 2603 |
| 77 | Ga0207705_10013455 | 3300025909 | Bacteria | 5902 |
| 78 | Ga0207705_11159009 | 3300025909 | Bacteria | 594 |
| 79 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 80 | Ga0207695_10043223 | 3300025913 | Bacteria | 4803 |
| 81 | Ga0207671_10413113 | 3300025914 | Bacteria | 1073 |
| 82 | Ga0207663_10658311 | 3300025916 | Bacteria | 827 |
| 83 | Ga0207660_10075115 | 3300025917 | Bacteria | 2468 |
| 84 | Ga0207662_11002852 | 3300025918 | Bacteria | 593 |
| 85 | Ga0207657_10030976 | 3300025919 | Bacteria | 4849 |
| 86 | Ga0207657_10288532 | 3300025919 | Bacteria | 1302 |
| 87 | Ga0207649_10861087 | 3300025920 | Bacteria | 709 |
| 88 | Ga0207652_10163245 | 3300025921 | Bacteria | 1997 |
| 89 | Ga0207652_10367852 | 3300025921 | Bacteria | 1298 |
| 90 | Ga0207694_10838991 | 3300025924 | Bacteria | 777 |
| 91 | Ga0207687_10026634 | 3300025927 | Bacteria | 3873 |
| 92 | Ga0207687_10647948 | 3300025927 | Bacteria | 893 |
| 93 | Ga0207690_10104710 | 3300025932 | Bacteria | 2027 |
| 94 | Ga0207709_10243020 | 3300025935 | Bacteria | 1311 |
| 95 | Ga0207709_10651036 | 3300025935 | Bacteria | 839 |
| 96 | Ga0207704_11870518 | 3300025938 | Bacteria | 516 |
| 97 | Ga0207711_10039720 | 3300025941 | Bacteria | 4003 |
| 98 | Ga0207689_10098954 | 3300025942 | Bacteria | 2396 |
| 99 | Ga0207661_10020025 | 3300025944 | Bacteria | 4996 |
| 100 | Ga0207661_10020279 | 3300025944 | Bacteria | 4965 |
| 101 | Ga0207661_10129395 | 3300025944 | Bacteria | 2160 |
| 102 | Ga0207661_10383283 | 3300025944 | Bacteria | 1273 |
| 103 | Ga0207667_10459203 | 3300025949 | Bacteria | 1294 |
| 104 | Ga0207712_10059079 | 3300025961 | Bacteria | 2713 |
| 105 | Ga0207677_10902355 | 3300026023 | Bacteria | 797 |
| 106 | Ga0207703_10381877 | 3300026035 | Bacteria | 1303 |
| 107 | Ga0207678_10709586 | 3300026067 | Bacteria | 885 |
| 108 | Ga0207678_11091256 | 3300026067 | Bacteria | 707 |
| 109 | Ga0207702_10102144 | 3300026078 | Bacteria | 2533 |
| 110 | Ga0207676_11959276 | 3300026095 | Bacteria | 584 |
| 111 | Ga0207674_10009885 | 3300026116 | Bacteria | 10853 |
| 112 | Ga0207674_10022587 | 3300026116 | Bacteria | 6753 |
| 113 | Ga0207674_10369689 | 3300026116 | Bacteria | 1386 |
| 114 | Ga0207674_10441544 | 3300026116 | Bacteria | 1258 |
| 115 | Ga0207675_100619048 | 3300026118 | Bacteria | 1087 |
| 116 | Ga0207698_10046876 | 3300026142 | Bacteria | 3269 |
| 117 | Ga0207698_10898692 | 3300026142 | Bacteria | 893 |
| 118 | Ga0207698_11529917 | 3300026142 | Bacteria | 682 |
| 119 | Ga0268266_10001392 | 3300028379 | Bacteria | 28952 |
| 120 | Ga0268264_10425255 | 3300028381 | Bacteria | 1282 |
| 121 | Ga0307515_10788305 | 3300028794 | Bacteria | 572 |
| 122 | Ga0307513_10788458 | 3300031456 | Bacteria | 656 |
| 123 | Ga0316575_10057595 | 3300031665 | Bacteria | 1549 |
| 124 | Ga0307405_10484794 | 3300031731 | Bacteria | 988 |
| 125 | Ga0307405_10827098 | 3300031731 | Bacteria | 778 |
| 126 | Ga0307405_11809826 | 3300031731 | Bacteria | 543 |
| 127 | Ga0307409_101135333 | 3300031995 | Bacteria | 803 |
| 128 | Ga0307411_11799254 | 3300032005 | Bacteria | 569 |
| 129 | Ga0307415_100969318 | 3300032126 | Bacteria | 788 |
| 130 | Ga0395900_0002682 | 3300037418 | Bacteria | 19458 |
| 131 | Ga0395905_0026161 | 3300037471 | Bacteria | 5504 |
| 132 | Ga0395901_0037474 | 3300038443 | Bacteria | 5015 |
| 133 | Ga0395901_0074736 | 3300038443 | Bacteria | 3535 |
| 134 | Ga0395901_0143565 | 3300038443 | Bacteria | 2509 |
| 135 | Ga0436365_1547931 | 3300039437 | Bacteria | 1176 |
| 136 | Ga0451833_0381070 | 3300041491 | Bacteria | 596 |
| 137 | Ga0451853_0898948 | 3300041512 | Bacteria | 617 |
| 138 | Ga0439455_0126468 | 3300042012 | Bacteria | 719 |
| 139 | Ga0450918_035068 | 3300042531 | Bacteria | 892 |
| 140 | Ga0466972_0028874 | 3300044658 | Bacteria | 2733 |
| 141 | Ga0466972_0131743 | 3300044658 | Bacteria | 1177 |
| 142 | Ga0466965_0000002 | 3300044683 | Bacteria | 297957 |
| 143 | Ga0466965_0037710 | 3300044683 | Bacteria | 2373 |
| 144 | Ga0466966_0715182 | 3300044684 | Bacteria | 604 |
| 145 | Ga0466961_0007929 | 3300044693 | Bacteria | 6767 |
| 146 | Ga0466961_0062027 | 3300044693 | Bacteria | 2376 |
| 147 | Ga0466961_0116617 | 3300044693 | Bacteria | 1678 |
| 148 | Ga0466961_0186416 | 3300044693 | Bacteria | 1287 |
| 149 | Ga0466961_0225170 | 3300044693 | Bacteria | 1155 |
| 150 | Ga0466963_0053559 | 3300044694 | Bacteria | 2679 |
| 151 | Ga0466963_0233110 | 3300044694 | Bacteria | 1290 |
| 152 | Ga0466963_0330721 | 3300044694 | Bacteria | 1073 |
| 153 | Ga0466964_0012500 | 3300044706 | Bacteria | 3213 |
| 154 | Ga0466964_0563644 | 3300044706 | Bacteria | 620 |
| 155 | Ga0466968_0057662 | 3300044735 | Bacteria | 1670 |
| 156 | Ga0466968_0408105 | 3300044735 | Bacteria | 667 |
| 157 | Ga0466968_0742890 | 3300044735 | Bacteria | 503 |
| 158 | Ga0466970_0010082 | 3300044765 | Bacteria | 4788 |
| 159 | Ga0466970_0041477 | 3300044765 | Bacteria | 2445 |
| 160 | Ga0466970_0043836 | 3300044765 | Bacteria | 2381 |
| 161 | Ga0466970_0126418 | 3300044765 | Bacteria | 1402 |
| 162 | Ga0466957_0023822 | 3300044842 | Bacteria | 3622 |
| 163 | Ga0466957_0129968 | 3300044842 | Bacteria | 1613 |
| 164 | Ga0466957_0878123 | 3300044842 | Bacteria | 640 |
| 165 | Ga0466960_0012695 | 3300044901 | Bacteria | 3561 |
| 166 | Ga0466960_0165870 | 3300044901 | Bacteria | 1189 |
| 167 | Ga0466960_0804991 | 3300044901 | Bacteria | 569 |
| 168 | Ga0466959_1096213 | 3300045049 | Bacteria | 529 |
| 169 | Ga0451576_0849271 | 3300045051 | Bacteria | 958 |
| 170 | Ga0466958_0217390 | 3300045836 | Bacteria | 1219 |
| 171 | Ga0466967_0011297 | 3300045976 | Bacteria | 6752 |
| 172 | Ga0466967_0036242 | 3300045976 | Bacteria | 4208 |
| 173 | Ga0466967_0156538 | 3300045976 | Bacteria | 2135 |
| 174 | Ga0466967_0346854 | 3300045976 | Bacteria | 1436 |
| 175 | Ga0466967_0348282 | 3300045976 | Bacteria | 1433 |
| 176 | Ga0466967_0622454 | 3300045976 | Bacteria | 1066 |
| 177 | Ga0466967_0709641 | 3300045976 | Bacteria | 996 |
| 178 | Ga0466967_0804451 | 3300045976 | Bacteria | 933 |
| 179 | Ga0466967_2260532 | 3300045976 | Bacteria | 539 |
| 180 | Ga0495641_0208058 | 3300046461 | Bacteria | 877 |
| 181 | Ga0495651_0173398 | 3300046462 | Bacteria | 1534 |
| 182 | Ga0495650_0016313 | 3300046471 | Bacteria | 3768 |
| 183 | Ga0495587_0683500 | 3300046536 | Bacteria | 563 |
| 184 | Ga0495667_0156236 | 3300046559 | Bacteria | 1468 |
| 185 | Ga0495635_0756010 | 3300046663 | Bacteria | 628 |
| 186 | Ga0495657_0193392 | 3300046675 | Bacteria | 1243 |
| 187 | Ga0495600_0346500 | 3300046809 | Bacteria | 931 |
| 188 | Ga0495672_0027099 | 3300047320 | Bacteria | 3647 |
| 189 | Ga0495676_0225445 | 3300047321 | Bacteria | 1290 |
| 190 | Ga0496100_0034041 | 3300048903 | Bacteria | 3192 |
| 191 | Ga0496100_0208347 | 3300048903 | Bacteria | 1429 |
| 192 | Ga0496101_0023425 | 3300048904 | Bacteria | 4265 |
| 193 | Ga0496102_0010117 | 3300048905 | Bacteria | 8113 |
| 194 | Ga0496102_0064046 | 3300048905 | Bacteria | 3367 |
| 195 | Ga0496103_0136395 | 3300048906 | Bacteria | 1568 |
| 196 | Ga0496103_0366407 | 3300048906 | Bacteria | 926 |
| 197 | Ga0496104_0029662 | 3300048907 | Bacteria | 5075 |
| 198 | Ga0496104_0290344 | 3300048907 | Bacteria | 1548 |
| 199 | Ga0496105_0051351 | 3300048908 | Bacteria | 3407 |
| 200 | Ga0496107_0242531 | 3300048910 | Bacteria | 1341 |
| 201 | Ga0496107_1155550 | 3300048910 | Bacteria | 558 |
| 202 | Ga0496109_0021402 | 3300048912 | Bacteria | 5717 |
| 203 | Ga0496109_0359138 | 3300048912 | Bacteria | 1376 |
| 204 | Ga0496109_0506426 | 3300048912 | Bacteria | 1140 |
| 205 | Ga0496109_0934456 | 3300048912 | Bacteria | 805 |
| 206 | Ga0496110_0015929 | 3300048913 | Bacteria | 6270 |
| 207 | Ga0496110_1087054 | 3300048913 | Bacteria | 708 |
| 208 | Ga0496111_0001463 | 3300048914 | Bacteria | 13499 |
| 209 | Ga0496111_0407996 | 3300048914 | Bacteria | 1004 |
| 210 | Ga0496114_0043865 | 3300048917 | Bacteria | 3708 |
| 211 | Ga0496114_0074237 | 3300048917 | Bacteria | 2863 |
| 212 | Ga0496114_0530983 | 3300048917 | Bacteria | 1040 |
| 213 | Ga0496114_1496544 | 3300048917 | Bacteria | 563 |
| 214 | Ga0496115_0389200 | 3300048918 | Bacteria | 1132 |
| 215 | Ga0496115_1335674 | 3300048918 | Bacteria | 532 |
| 216 | Ga0496118_0037903 | 3300048921 | Bacteria | 3872 |
| 217 | Ga0496119_0004803 | 3300048922 | Bacteria | 13262 |
| 218 | Ga0496119_0064508 | 3300048922 | Bacteria | 2174 |
| 219 | Ga0496119_0135545 | 3300048922 | Bacteria | 1336 |
| 220 | Ga0496120_0010152 | 3300048923 | Bacteria | 6595 |
| 221 | Ga0496120_0083639 | 3300048923 | Bacteria | 1722 |
| 222 | Ga0496120_0119827 | 3300048923 | Bacteria | 1362 |
| 223 | Ga0496121_0000528 | 3300048924 | Bacteria | 72606 |
| 224 | Ga0496121_0258335 | 3300048924 | Bacteria | 1204 |
| 225 | Ga0496121_0401225 | 3300048924 | Bacteria | 898 |
| 226 | Ga0496121_0518775 | 3300048924 | Bacteria | 752 |
| 227 | Ga0496124_0587222 | 3300048927 | Bacteria | 727 |
| 228 | Ga0496126_0001272 | 3300048929 | Bacteria | 40541 |
| 229 | Ga0496126_0035151 | 3300048929 | Bacteria | 4699 |
| 230 | Ga0496126_0084231 | 3300048929 | Bacteria | 2804 |
| 231 | Ga0496126_0191133 | 3300048929 | Bacteria | 1734 |
| 232 | Ga0501031_0002626 | 3300049568 | Bacteria | 11443 |
| 233 | Ga0501031_0005342 | 3300049568 | Bacteria | 8367 |
| 234 | Ga0501031_0404675 | 3300049568 | Bacteria | 883 |
| 235 | Ga0501032_0024504 | 3300049569 | Bacteria | 4166 |
| 236 | Ga0501032_0066879 | 3300049569 | Bacteria | 2401 |
| 237 | Ga0501032_0218070 | 3300049569 | Bacteria | 1242 |
| 238 | Ga0501032_0244324 | 3300049569 | Bacteria | 1166 |
| 239 | Ga0501032_0511337 | 3300049569 | Bacteria | 767 |
| 240 | Ga0501033_0004564 | 3300049570 | Bacteria | 11090 |
| 241 | Ga0501033_0018134 | 3300049570 | Bacteria | 5318 |
| 242 | Ga0501033_0019142 | 3300049570 | Bacteria | 5176 |
| 243 | Ga0501033_0025856 | 3300049570 | Bacteria | 4420 |
| 244 | Ga0501033_1013142 | 3300049570 | Bacteria | 555 |
| 245 | Ga0501034_0013012 | 3300049571 | Bacteria | 8577 |
| 246 | Ga0501034_0052619 | 3300049571 | Bacteria | 4101 |
| 247 | Ga0501034_0091248 | 3300049571 | Bacteria | 3044 |
| 248 | Ga0501034_0104693 | 3300049571 | Bacteria | 2823 |
| 249 | Ga0501034_0143872 | 3300049571 | Bacteria | 2362 |
| 250 | Ga0501034_0287313 | 3300049571 | Bacteria | 1583 |
| 251 | Ga0501034_0292212 | 3300049571 | Bacteria | 1567 |
| 252 | Ga0501034_0583503 | 3300049571 | Bacteria | 1024 |
| 253 | Ga0501034_0618516 | 3300049571 | Bacteria | 987 |
| 254 | Ga0501036_0017667 | 3300049572 | Bacteria | 5968 |
| 255 | Ga0501036_0032142 | 3300049572 | Bacteria | 4433 |
| 256 | Ga0501036_0104081 | 3300049572 | Bacteria | 2400 |
| 257 | Ga0501036_0327636 | 3300049572 | Bacteria | 1279 |
| 258 | Ga0501036_0831147 | 3300049572 | Bacteria | 760 |
| 259 | Ga0501037_0016849 | 3300049573 | Bacteria | 5376 |
| 260 | Ga0501037_0032009 | 3300049573 | Bacteria | 3882 |
| 261 | Ga0501037_0057046 | 3300049573 | Bacteria | 2852 |
| 262 | Ga0501037_0127597 | 3300049573 | Bacteria | 1825 |
| 263 | Ga0501037_0158795 | 3300049573 | Bacteria | 1612 |
| 264 | Ga0501037_0414701 | 3300049573 | Bacteria | 922 |
| 265 | Ga0501037_0430273 | 3300049573 | Bacteria | 902 |
| 266 | Ga0501038_0000986 | 3300049574 | Bacteria | 25579 |
| 267 | Ga0501038_0005101 | 3300049574 | Bacteria | 12204 |
| 268 | Ga0501038_0030902 | 3300049574 | Bacteria | 4734 |
| 269 | Ga0501038_0093818 | 3300049574 | Bacteria | 2510 |
| 270 | Ga0501038_0107395 | 3300049574 | Bacteria | 2315 |
| 271 | Ga0501038_0494005 | 3300049574 | Bacteria | 936 |
| 272 | Ga0501038_0794503 | 3300049574 | Bacteria | 703 |
| 273 | Ga0501039_0011177 | 3300049575 | Bacteria | 6840 |
| 274 | Ga0501039_0094783 | 3300049575 | Bacteria | 2327 |
| 275 | Ga0501039_0161442 | 3300049575 | Bacteria | 1761 |
| 276 | Ga0501039_0218250 | 3300049575 | Bacteria | 1499 |
| 277 | Ga0501040_0010072 | 3300049576 | Bacteria | 6176 |
| 278 | Ga0501040_0238285 | 3300049576 | Bacteria | 1296 |
| 279 | Ga0501041_0000493 | 3300049577 | Bacteria | 20222 |
| 280 | Ga0501042_0002259 | 3300049578 | Bacteria | 11757 |
| 281 | Ga0501042_0012714 | 3300049578 | Bacteria | 5712 |
| 282 | Ga0501042_0014594 | 3300049578 | Bacteria | 5365 |
| 283 | Ga0501042_0032226 | 3300049578 | Bacteria | 3710 |
| 284 | Ga0501042_0343996 | 3300049578 | Bacteria | 1078 |
| 285 | Ga0501043_0053808 | 3300049579 | Bacteria | 3161 |
| 286 | Ga0501043_0088749 | 3300049579 | Bacteria | 2430 |
| 287 | Ga0501043_0097864 | 3300049579 | Bacteria | 2306 |
| 288 | Ga0501043_0185532 | 3300049579 | Bacteria | 1619 |
| 289 | Ga0501043_0285828 | 3300049579 | Bacteria | 1263 |
| 290 | Ga0501043_0308614 | 3300049579 | Bacteria | 1208 |
| 291 | Ga0501043_0414294 | 3300049579 | Bacteria | 1016 |
| 292 | Ga0501046_0002023 | 3300049580 | Bacteria | 19256 |
| 293 | Ga0501046_0003153 | 3300049580 | Bacteria | 15217 |
| 294 | Ga0501046_0006897 | 3300049580 | Bacteria | 10013 |
| 295 | Ga0501046_0016287 | 3300049580 | Bacteria | 6231 |
| 296 | Ga0501046_0035862 | 3300049580 | Bacteria | 3994 |
| 297 | Ga0501046_0113096 | 3300049580 | Bacteria | 2072 |
| 298 | Ga0501046_1080441 | 3300049580 | Bacteria | 555 |
| 299 | Ga0501047_0001958 | 3300049581 | Bacteria | 19779 |
| 300 | Ga0501047_0044568 | 3300049581 | Bacteria | 4286 |
| 301 | Ga0501047_0046802 | 3300049581 | Bacteria | 4180 |
| 302 | Ga0501047_0068749 | 3300049581 | Bacteria | 3411 |
| 303 | Ga0501047_0104727 | 3300049581 | Bacteria | 2709 |
| 304 | Ga0501047_0166623 | 3300049581 | Bacteria | 2073 |
| 305 | Ga0501047_0212470 | 3300049581 | Bacteria | 1792 |
| 306 | Ga0501047_0241344 | 3300049581 | Bacteria | 1657 |
| 307 | Ga0501047_0349002 | 3300049581 | Bacteria | 1316 |
| 308 | Ga0501048_0004427 | 3300049582 | Bacteria | 10697 |
| 309 | Ga0501048_0006539 | 3300049582 | Bacteria | 8859 |
| 310 | Ga0501048_0007135 | 3300049582 | Bacteria | 8490 |
| 311 | Ga0501048_0034547 | 3300049582 | Bacteria | 3646 |
| 312 | Ga0501067_0063875 | 3300049583 | Bacteria | 2039 |
| 313 | Ga0501067_0122722 | 3300049583 | Bacteria | 1446 |
| 314 | Ga0501067_0266780 | 3300049583 | Bacteria | 953 |
| 315 | Ga0501068_0029728 | 3300049584 | Bacteria | 3238 |
| 316 | Ga0501068_0437738 | 3300049584 | Bacteria | 845 |
| 317 | Ga0501069_0009851 | 3300049585 | Bacteria | 5053 |
| 318 | Ga0501069_0038764 | 3300049585 | Bacteria | 2631 |
| 319 | Ga0501069_0048982 | 3300049585 | Bacteria | 2348 |
| 320 | Ga0501069_0546531 | 3300049585 | Bacteria | 693 |
| 321 | Ga0501070_0000621 | 3300049586 | Bacteria | 32571 |
| 322 | Ga0501070_0098085 | 3300049586 | Bacteria | 2424 |
| 323 | Ga0501070_0123247 | 3300049586 | Bacteria | 2142 |
| 324 | Ga0501070_0574703 | 3300049586 | Bacteria | 900 |
| 325 | Ga0501070_0697678 | 3300049586 | Bacteria | 803 |
| 326 | Ga0501071_0003477 | 3300049587 | Bacteria | 9840 |
| 327 | Ga0501071_0006763 | 3300049587 | Bacteria | 7464 |
| 328 | Ga0501072_0010496 | 3300049588 | Bacteria | 7054 |
| 329 | Ga0501072_0019617 | 3300049588 | Bacteria | 5229 |
| 330 | Ga0501072_0356436 | 3300049588 | Bacteria | 1161 |
| 331 | Ga0501072_0603498 | 3300049588 | Bacteria | 865 |
| 332 | Ga0501073_0012510 | 3300049589 | Bacteria | 6194 |
| 333 | Ga0501073_0042934 | 3300049589 | Bacteria | 3190 |
| 334 | Ga0501073_0055963 | 3300049589 | Bacteria | 2759 |
| 335 | Ga0501073_0359803 | 3300049589 | Bacteria | 1005 |
| 336 | Ga0501073_0942322 | 3300049589 | Bacteria | 594 |
| 337 | Ga0501074_0130921 | 3300049590 | Bacteria | 1794 |
| 338 | Ga0501075_0249780 | 3300049591 | Bacteria | 1352 |
| 339 | Ga0501075_0509146 | 3300049591 | Bacteria | 918 |
| 340 | Ga0501076_0011976 | 3300049592 | Bacteria | 6479 |
| 341 | Ga0501076_0015101 | 3300049592 | Bacteria | 5830 |
| 342 | Ga0501077_0020508 | 3300049593 | Bacteria | 4184 |
| 343 | Ga0501077_0032940 | 3300049593 | Bacteria | 3300 |
| 344 | Ga0501079_0014628 | 3300049741 | Bacteria | 5985 |
| 345 | Ga0501079_0029924 | 3300049741 | Bacteria | 4183 |
| 346 | Ga0501079_1035569 | 3300049741 | Bacteria | 647 |
| 347 | Ga0501079_1588874 | 3300049741 | Bacteria | 514 |
| 348 | Ga0501080_0062921 | 3300049742 | Bacteria | 3453 |
| 349 | Ga0501080_1144923 | 3300049742 | Bacteria | 670 |
| 350 | Ga0501081_0003450 | 3300049743 | Bacteria | 10090 |
| 351 | Ga0501081_0506388 | 3300049743 | Bacteria | 900 |
| 352 | Ga0501083_0159658 | 3300049744 | Bacteria | 1475 |
| 353 | Ga0501083_0631706 | 3300049744 | Bacteria | 697 |
| 354 | Ga0501083_0997489 | 3300049744 | Bacteria | 545 |
| 355 | Ga0501035_0009210 | 3300049822 | Bacteria | 9181 |
| 356 | Ga0501035_0020277 | 3300049822 | Bacteria | 6104 |
| 357 | Ga0501035_0022249 | 3300049822 | Bacteria | 5822 |
| 358 | Ga0501035_0058856 | 3300049822 | Bacteria | 3422 |
| 359 | Ga0501035_0078115 | 3300049822 | Bacteria | 2925 |
| 360 | Ga0501035_0095991 | 3300049822 | Bacteria | 2605 |
| 361 | Ga0501035_0111390 | 3300049822 | Bacteria | 2398 |
| 362 | Ga0501035_0244178 | 3300049822 | Bacteria | 1526 |
| 363 | Ga0501035_0414217 | 3300049822 | Bacteria | 1119 |
| 364 | Ga0501035_0696831 | 3300049822 | Bacteria | 819 |
| 365 | Ga0501044_0002953 | 3300049823 | Bacteria | 19346 |
| 366 | Ga0501044_0017489 | 3300049823 | Bacteria | 7696 |
| 367 | Ga0501044_0021908 | 3300049823 | Bacteria | 6814 |
| 368 | Ga0501044_0029757 | 3300049823 | Bacteria | 5757 |
| 369 | Ga0501044_0092886 | 3300049823 | Bacteria | 3043 |
| 370 | Ga0501044_0118241 | 3300049823 | Bacteria | 2653 |
| 371 | Ga0501044_0385237 | 3300049823 | Bacteria | 1316 |
| 372 | Ga0501044_0385244 | 3300049823 | Bacteria | 1316 |
| 373 | Ga0501044_0533336 | 3300049823 | Bacteria | 1072 |
| 374 | Ga0501045_0002771 | 3300049824 | Bacteria | 11968 |
| 375 | Ga0501045_0046664 | 3300049824 | Bacteria | 3155 |
| 376 | Ga0501045_0058120 | 3300049824 | Bacteria | 2831 |
| 377 | Ga0501045_0264288 | 3300049824 | Bacteria | 1281 |
| 378 | Ga0501045_0376008 | 3300049824 | Bacteria | 1057 |
| 379 | Ga0501045_0863685 | 3300049824 | Bacteria | 665 |
| 380 | Ga0495601_0726214 | 3300053077 | Bacteria | 633 |
| 381 | Ga0495619_0078881 | 3300053085 | Bacteria | 2214 |
| 382 | Ga0500554_135161 | 3300053102 | Bacteria | 833 |
| 383 | Ga0500592_025058 | 3300053116 | Bacteria | 962 |
| 384 | Ga0500568_0000049 | 3300053139 | Bacteria | 116515 |
| 385 | Ga0500568_0012594 | 3300053139 | Bacteria | 3882 |
| 386 | Ga0500568_0168194 | 3300053139 | Bacteria | 807 |
| 387 | Ga0500573_0012971 | 3300053140 | Bacteria | 4686 |
| 388 | Ga0500573_0099600 | 3300053140 | Bacteria | 1637 |
| 389 | Ga0500577_0062165 | 3300053142 | Bacteria | 1439 |
| 390 | Ga0501084_0026469 | 3300054114 | Bacteria | 4840 |
| 391 | Ga0501084_0080376 | 3300054114 | Bacteria | 2733 |
| 392 | Ga0501082_0002317 | 3300060353 | Bacteria | 16653 |
| 393 | Ga0466962_0224645 | 3300061719 | Bacteria | 920 |
| 394 | Ga0466962_0372999 | 3300061719 | Bacteria | 712 |
| 395 | Ga0466962_0603143 | 3300061719 | Bacteria | 560 |
| 396 | Ga0530510_0001985 | 3300061734 | Bacteria | 14025 |
| 397 | Ga0530510_0033798 | 3300061734 | Bacteria | 3682 |
| 398 | 2723642056 | 2721755702 | Bacteria | 4373124 |
| 399 | 2729905710 | 2728369276 | Bacteria | 5610032 |
| 400 | 2739602464 | 2739367653 | Bacteria | 2780952 |
| 401 | 2817509024 | 2816332305 | Bacteria | 2697803 |
| 402 | 2857729225 | 2857727296 | Bacteria | 2745552 |
| 403 | 2857730049 | 2857729791 | Bacteria | 4040535 |
| 404 | 2893686916 | 2893684298 | Bacteria | 2897960 |
| 405 | 2895661311 | 2895660088 | Bacteria | 3782833 |
| 406 | 2904433450 | 2904430863 | Bacteria | 3486923 |
| 407 | 2904503683 | 2904501621 | Bacteria | 3401437 |
| 408 | 2908675323 | 2908674828 | Bacteria | 3382763 |
| 409 | 2909075354 | 2909074476 | Bacteria | 3436050 |
| 410 | 2919040007 | 2919039151 | Bacteria | 3391018 |
| 411 | 2919447185 | 2919446982 | Bacteria | 3994487 |
| 412 | 2920881943 | 2920879853 | Bacteria | 4216831 |
| 413 | 2928123274 | 2928121344 | Bacteria | 3972376 |
| 414 | 2928501348 | 2928500415 | Bacteria | 3384541 |
| 415 | 2935411406 | 2935409751 | Bacteria | 4179611 |
| 416 | 2984553515 | 2984551494 | Bacteria | 3877562 |
| 417 | 8046356415 | 8046352972 | Bacteria | 3613806 |
| 418 | Ga0501034_0006512 | |||
| 419 | Ga0070658_10064255 | |||
| 420 | Ga0070658_10072716 | |||
| 421 | Ga0070658_11029916 | |||
| 422 | Ga0070683_100001571 | |||
| 423 | Ga0070683_100005532 | |||
| 424 | Ga0070683_100176358 | |||
| 425 | Ga0070683_101152559 | |||
| 426 | Ga0070680_100101608 | |||
| 427 | Ga0070682_100562973 | |||
| 428 | Ga0070682_100619828 | |||
| 429 | Ga0068868_100746457 | |||
| 430 | Ga0068868_101319497 | |||
| 431 | Ga0070660_100013192 | |||
| 432 | Ga0070660_100256620 | |||
| 433 | Ga0070691_10112856 | |||
| 434 | Ga0070687_100871883 | |||
| 435 | Ga0070661_100113071 | |||
| 436 | Ga0070659_100022910 | |||
| 437 | Ga0070659_100599034 | |||
| 438 | Ga0070713_100014022 | |||
| 439 | Ga0070663_100109938 | |||
| 440 | Ga0070685_10121095 | |||
| 441 | Ga0070679_100021615 | |||
| 442 | Ga0070679_100381086 | |||
| 443 | Ga0070684_100010384 | |||
| 444 | Ga0070684_100103227 | |||
| 445 | Ga0070684_100148432 | |||
| 446 | Ga0070684_100240762 | |||
| 447 | Ga0070684_101147509 | |||
| 448 | Ga0070665_100000868 | |||
| 449 | Ga0070665_102650349 | |||
| 450 | Ga0068855_100624669 | |||
| 451 | Ga0070664_100020111 | |||
| 452 | Ga0068857_100006537 | |||
| 453 | Ga0068857_100021943 | |||
| 454 | Ga0068856_100008211 | |||
| 455 | Ga0068864_100352100 | |||
| 456 | Ga0068861_100508164 | |||
| 457 | Ga0068858_100026761 | |||
| 458 | Ga0068860_100096684 | |||
| 459 | Ga0070717_10236814 | |||
| 460 | Ga0068865_100114501 | |||
| 461 | Ga0105240_10025605 | |||
| 462 | Ga0105245_10015414 | |||
| 463 | Ga0105243_10455138 | |||
| 464 | Ga0105243_11345745 | |||
| 465 | Ga0105243_12757784 | |||
| 466 | Ga0105241_10003419 | |||
| 467 | Ga0105248_10051721 | |||
| 468 | Ga0105237_10116286 | |||
| 469 | Ga0105249_10056409 | |||
| 470 | Ga0105239_10001318 | |||
| 471 | Ga0105246_10043913 | |||
| 472 | Ga0157371_10203067 | |||
| 473 | Ga0157371_10393522 | |||
| 474 | Ga0157370_11226931 | |||
| 475 | Ga0157369_10045989 | |||
| 476 | Ga0157369_10519564 | |||
| 477 | Ga0157369_11662863 | |||
| 478 | Ga0157374_10796877 | |||
| 479 | Ga0163162_10042785 | |||
| 480 | Ga0157372_10022652 | |||
| 481 | Ga0157375_10338694 | |||
| 482 | Ga0157375_10486217 | |||
| 483 | Ga0157375_12137567 | |||
| 484 | Ga0163163_10135111 | |||
| 485 | Ga0157380_11552252 | |||
| 486 | Ga0157377_10305759 | |||
| 487 | Ga0157379_10012714 | |||
| 488 | Ga0157376_10485516 | |||
| 489 | Ga0206353_10938905 | |||
| 490 | Ga0206353_11793161 | |||
| 491 | Ga0209148_1000624 | |||
| 492 | Ga0207647_10026041 | |||
| 493 | Ga0207647_10049583 | |||
| 494 | Ga0207705_10013455 | |||
| 495 | Ga0207705_11159009 | |||
| 496 | Ga0207654_10000001 | |||
| 497 | Ga0207695_10043223 | |||
| 498 | Ga0207671_10413113 | |||
| 499 | Ga0207663_10658311 | |||
| 500 | Ga0207660_10075115 | |||
| 501 | Ga0207662_11002852 | |||
| 502 | Ga0207657_10030976 | |||
| 503 | Ga0207657_10288532 | |||
| 504 | Ga0207649_10861087 | |||
| 505 | Ga0207652_10163245 | |||
| 506 | Ga0207652_10367852 | |||
| 507 | Ga0207694_10838991 | |||
| 508 | Ga0207687_10026634 | |||
| 509 | Ga0207687_10647948 | |||
| 510 | Ga0207690_10104710 | |||
| 511 | Ga0207709_10243020 | |||
| 512 | Ga0207709_10651036 | |||
| 513 | Ga0207704_11870518 | |||
| 514 | Ga0207711_10039720 | |||
| 515 | Ga0207689_10098954 | |||
| 516 | Ga0207661_10020025 | |||
| 517 | Ga0207661_10020279 | |||
| 518 | Ga0207661_10129395 | |||
| 519 | Ga0207661_10383283 | |||
| 520 | Ga0207667_10459203 | |||
| 521 | Ga0207712_10059079 | |||
| 522 | Ga0207677_10902355 | |||
| 523 | Ga0207703_10381877 | |||
| 524 | Ga0207678_10709586 | |||
| 525 | Ga0207678_11091256 | |||
| 526 | Ga0207702_10102144 | |||
| 527 | Ga0207676_11959276 | |||
| 528 | Ga0207674_10009885 | |||
| 529 | Ga0207674_10022587 | |||
| 530 | Ga0207674_10369689 | |||
| 531 | Ga0207674_10441544 | |||
| 532 | Ga0207675_100619048 | |||
| 533 | Ga0207698_10046876 | |||
| 534 | Ga0207698_10898692 | |||
| 535 | Ga0207698_11529917 | |||
| 536 | Ga0268266_10001392 | |||
| 537 | Ga0268264_10425255 | |||
| 538 | Ga0307515_10788305 | |||
| 539 | Ga0307513_10788458 | |||
| 540 | Ga0316575_10057595 | |||
| 541 | Ga0307405_10484794 | |||
| 542 | Ga0307405_10827098 | |||
| 543 | Ga0307405_11809826 | |||
| 544 | Ga0307409_101135333 | |||
| 545 | Ga0307411_11799254 | |||
| 546 | Ga0307415_100969318 | |||
| 547 | Ga0395900_0002682 | |||
| 548 | Ga0395905_0026161 | |||
| 549 | Ga0395901_0037474 | |||
| 550 | Ga0395901_0074736 | |||
| 551 | Ga0395901_0143565 | |||
| 552 | Ga0436365_1547931 | |||
| 553 | Ga0451833_0381070 | |||
| 554 | Ga0451853_0898948 | |||
| 555 | Ga0439455_0126468 | |||
| 556 | Ga0450918_035068 | |||
| 557 | Ga0466972_0028874 | |||
| 558 | Ga0466972_0131743 | |||
| 559 | Ga0466965_0000002 | |||
| 560 | Ga0466965_0037710 | |||
| 561 | Ga0466966_0715182 | |||
| 562 | Ga0466961_0007929 | |||
| 563 | Ga0466961_0062027 | |||
| 564 | Ga0466961_0116617 | |||
| 565 | Ga0466961_0186416 | |||
| 566 | Ga0466961_0225170 | |||
| 567 | Ga0466963_0053559 | |||
| 568 | Ga0466963_0233110 | |||
| 569 | Ga0466963_0330721 | |||
| 570 | Ga0466964_0012500 | |||
| 571 | Ga0466964_0563644 | |||
| 572 | Ga0466968_0057662 | |||
| 573 | Ga0466968_0408105 | |||
| 574 | Ga0466968_0742890 | |||
| 575 | Ga0466970_0010082 | |||
| 576 | Ga0466970_0041477 | |||
| 577 | Ga0466970_0043836 | |||
| 578 | Ga0466970_0126418 | |||
| 579 | Ga0466957_0023822 | |||
| 580 | Ga0466957_0129968 | |||
| 581 | Ga0466957_0878123 | |||
| 582 | Ga0466960_0012695 | |||
| 583 | Ga0466960_0165870 | |||
| 584 | Ga0466960_0804991 | |||
| 585 | Ga0466959_1096213 | |||
| 586 | Ga0451576_0849271 | |||
| 587 | Ga0466958_0217390 | |||
| 588 | Ga0466967_0011297 | |||
| 589 | Ga0466967_0036242 | |||
| 590 | Ga0466967_0156538 | |||
| 591 | Ga0466967_0346854 | |||
| 592 | Ga0466967_0348282 | |||
| 593 | Ga0466967_0622454 | |||
| 594 | Ga0466967_0709641 | |||
| 595 | Ga0466967_0804451 | |||
| 596 | Ga0466967_2260532 | |||
| 597 | Ga0495641_0208058 | |||
| 598 | Ga0495651_0173398 | |||
| 599 | Ga0495650_0016313 | |||
| 600 | Ga0495587_0683500 | |||
| 601 | Ga0495667_0156236 | |||
| 602 | Ga0495635_0756010 | |||
| 603 | Ga0495657_0193392 | |||
| 604 | Ga0495600_0346500 | |||
| 605 | Ga0495672_0027099 | |||
| 606 | Ga0495676_0225445 | |||
| 607 | Ga0496100_0034041 | |||
| 608 | Ga0496100_0208347 | |||
| 609 | Ga0496101_0023425 | |||
| 610 | Ga0496102_0010117 | |||
| 611 | Ga0496102_0064046 | |||
| 612 | Ga0496103_0136395 | |||
| 613 | Ga0496103_0366407 | |||
| 614 | Ga0496104_0029662 | |||
| 615 | Ga0496104_0290344 | |||
| 616 | Ga0496105_0051351 | |||
| 617 | Ga0496107_0242531 | |||
| 618 | Ga0496107_1155550 | |||
| 619 | Ga0496109_0021402 | |||
| 620 | Ga0496109_0359138 | |||
| 621 | Ga0496109_0506426 | |||
| 622 | Ga0496109_0934456 | |||
| 623 | Ga0496110_0015929 | |||
| 624 | Ga0496110_1087054 | |||
| 625 | Ga0496111_0001463 | |||
| 626 | Ga0496111_0407996 | |||
| 627 | Ga0496114_0043865 | |||
| 628 | Ga0496114_0074237 | |||
| 629 | Ga0496114_0530983 | |||
| 630 | Ga0496114_1496544 | |||
| 631 | Ga0496115_0389200 | |||
| 632 | Ga0496115_1335674 | |||
| 633 | Ga0496118_0037903 | |||
| 634 | Ga0496119_0004803 | |||
| 635 | Ga0496119_0064508 | |||
| 636 | Ga0496119_0135545 | |||
| 637 | Ga0496120_0010152 | |||
| 638 | Ga0496120_0083639 | |||
| 639 | Ga0496120_0119827 | |||
| 640 | Ga0496121_0000528 | |||
| 641 | Ga0496121_0258335 | |||
| 642 | Ga0496121_0401225 | |||
| 643 | Ga0496121_0518775 | |||
| 644 | Ga0496124_0587222 | |||
| 645 | Ga0496126_0001272 | |||
| 646 | Ga0496126_0035151 | |||
| 647 | Ga0496126_0084231 | |||
| 648 | Ga0496126_0191133 | |||
| 649 | Ga0501031_0002626 | |||
| 650 | Ga0501031_0005342 | |||
| 651 | Ga0501031_0404675 | |||
| 652 | Ga0501032_0024504 | |||
| 653 | Ga0501032_0066879 | |||
| 654 | Ga0501032_0218070 | |||
| 655 | Ga0501032_0244324 | |||
| 656 | Ga0501032_0511337 | |||
| 657 | Ga0501033_0004564 | |||
| 658 | Ga0501033_0018134 | |||
| 659 | Ga0501033_0019142 | |||
| 660 | Ga0501033_0025856 | |||
| 661 | Ga0501033_1013142 | |||
| 662 | Ga0501034_0013012 | |||
| 663 | Ga0501034_0052619 | |||
| 664 | Ga0501034_0091248 | |||
| 665 | Ga0501034_0104693 | |||
| 666 | Ga0501034_0143872 | |||
| 667 | Ga0501034_0287313 | |||
| 668 | Ga0501034_0292212 | |||
| 669 | Ga0501034_0583503 | |||
| 670 | Ga0501034_0618516 | |||
| 671 | Ga0501036_0017667 | |||
| 672 | Ga0501036_0032142 | |||
| 673 | Ga0501036_0104081 | |||
| 674 | Ga0501036_0327636 | |||
| 675 | Ga0501036_0831147 | |||
| 676 | Ga0501037_0016849 | |||
| 677 | Ga0501037_0032009 | |||
| 678 | Ga0501037_0057046 | |||
| 679 | Ga0501037_0127597 | |||
| 680 | Ga0501037_0158795 | |||
| 681 | Ga0501037_0414701 | |||
| 682 | Ga0501037_0430273 | |||
| 683 | Ga0501038_0000986 | |||
| 684 | Ga0501038_0005101 | |||
| 685 | Ga0501038_0030902 | |||
| 686 | Ga0501038_0093818 | |||
| 687 | Ga0501038_0107395 | |||
| 688 | Ga0501038_0494005 | |||
| 689 | Ga0501038_0794503 | |||
| 690 | Ga0501039_0011177 | |||
| 691 | Ga0501039_0094783 | |||
| 692 | Ga0501039_0161442 | |||
| 693 | Ga0501039_0218250 | |||
| 694 | Ga0501040_0010072 | |||
| 695 | Ga0501040_0238285 | |||
| 696 | Ga0501041_0000493 | |||
| 697 | Ga0501042_0002259 | |||
| 698 | Ga0501042_0012714 | |||
| 699 | Ga0501042_0014594 | |||
| 700 | Ga0501042_0032226 | |||
| 701 | Ga0501042_0343996 | |||
| 702 | Ga0501043_0053808 | |||
| 703 | Ga0501043_0088749 | |||
| 704 | Ga0501043_0097864 | |||
| 705 | Ga0501043_0185532 | |||
| 706 | Ga0501043_0285828 | |||
| 707 | Ga0501043_0308614 | |||
| 708 | Ga0501043_0414294 | |||
| 709 | Ga0501046_0002023 | |||
| 710 | Ga0501046_0003153 | |||
| 711 | Ga0501046_0006897 | |||
| 712 | Ga0501046_0016287 | |||
| 713 | Ga0501046_0035862 | |||
| 714 | Ga0501046_0113096 | |||
| 715 | Ga0501046_1080441 | |||
| 716 | Ga0501047_0001958 | |||
| 717 | Ga0501047_0044568 | |||
| 718 | Ga0501047_0046802 | |||
| 719 | Ga0501047_0068749 | |||
| 720 | Ga0501047_0104727 | |||
| 721 | Ga0501047_0166623 | |||
| 722 | Ga0501047_0212470 | |||
| 723 | Ga0501047_0241344 | |||
| 724 | Ga0501047_0349002 | |||
| 725 | Ga0501048_0004427 | |||
| 726 | Ga0501048_0006539 | |||
| 727 | Ga0501048_0007135 | |||
| 728 | Ga0501048_0034547 | |||
| 729 | Ga0501067_0063875 | |||
| 730 | Ga0501067_0122722 | |||
| 731 | Ga0501067_0266780 | |||
| 732 | Ga0501068_0029728 | |||
| 733 | Ga0501068_0437738 | |||
| 734 | Ga0501069_0009851 | |||
| 735 | Ga0501069_0038764 | |||
| 736 | Ga0501069_0048982 | |||
| 737 | Ga0501069_0546531 | |||
| 738 | Ga0501070_0000621 | |||
| 739 | Ga0501070_0098085 | |||
| 740 | Ga0501070_0123247 | |||
| 741 | Ga0501070_0574703 | |||
| 742 | Ga0501070_0697678 | |||
| 743 | Ga0501071_0003477 | |||
| 744 | Ga0501071_0006763 | |||
| 745 | Ga0501072_0010496 | |||
| 746 | Ga0501072_0019617 | |||
| 747 | Ga0501072_0356436 | |||
| 748 | Ga0501072_0603498 | |||
| 749 | Ga0501073_0012510 | |||
| 750 | Ga0501073_0042934 | |||
| 751 | Ga0501073_0055963 | |||
| 752 | Ga0501073_0359803 | |||
| 753 | Ga0501073_0942322 | |||
| 754 | Ga0501074_0130921 | |||
| 755 | Ga0501075_0249780 | |||
| 756 | Ga0501075_0509146 | |||
| 757 | Ga0501076_0011976 | |||
| 758 | Ga0501076_0015101 | |||
| 759 | Ga0501077_0020508 | |||
| 760 | Ga0501077_0032940 | |||
| 761 | Ga0501079_0014628 | |||
| 762 | Ga0501079_0029924 | |||
| 763 | Ga0501079_1035569 | |||
| 764 | Ga0501079_1588874 | |||
| 765 | Ga0501080_0062921 | |||
| 766 | Ga0501080_1144923 | |||
| 767 | Ga0501081_0003450 | |||
| 768 | Ga0501081_0506388 | |||
| 769 | Ga0501083_0159658 | |||
| 770 | Ga0501083_0631706 | |||
| 771 | Ga0501083_0997489 | |||
| 772 | Ga0501035_0009210 | |||
| 773 | Ga0501035_0020277 | |||
| 774 | Ga0501035_0022249 | |||
| 775 | Ga0501035_0058856 | |||
| 776 | Ga0501035_0078115 | |||
| 777 | Ga0501035_0095991 | |||
| 778 | Ga0501035_0111390 | |||
| 779 | Ga0501035_0244178 | |||
| 780 | Ga0501035_0414217 | |||
| 781 | Ga0501035_0696831 | |||
| 782 | Ga0501044_0002953 | |||
| 783 | Ga0501044_0017489 | |||
| 784 | Ga0501044_0021908 | |||
| 785 | Ga0501044_0029757 | |||
| 786 | Ga0501044_0092886 | |||
| 787 | Ga0501044_0118241 | |||
| 788 | Ga0501044_0385237 | |||
| 789 | Ga0501044_0385244 | |||
| 790 | Ga0501044_0533336 | |||
| 791 | Ga0501045_0002771 | |||
| 792 | Ga0501045_0046664 | |||
| 793 | Ga0501045_0058120 | |||
| 794 | Ga0501045_0264288 | |||
| 795 | Ga0501045_0376008 | |||
| 796 | Ga0501045_0863685 | |||
| 797 | Ga0495601_0726214 | |||
| 798 | Ga0495619_0078881 | |||
| 799 | Ga0500554_135161 | |||
| 800 | Ga0500592_025058 | |||
| 801 | Ga0500568_0000049 | |||
| 802 | Ga0500568_0012594 | |||
| 803 | Ga0500568_0168194 | |||
| 804 | Ga0500573_0012971 | |||
| 805 | Ga0500573_0099600 | |||
| 806 | Ga0500577_0062165 | |||
| 807 | Ga0501084_0026469 | |||
| 808 | Ga0501084_0080376 | |||
| 809 | Ga0501082_0002317 | |||
| 810 | Ga0466962_0224645 | |||
| 811 | Ga0466962_0372999 | |||
| 812 | Ga0466962_0603143 | |||
| 813 | Ga0530510_0001985 | |||
| 814 | Ga0530510_0033798 | |||
| 815 | 2723642056 | |||
| 816 | 2729905710 | |||
| 817 | 2739602464 | |||
| 818 | 2817509024 | |||
| 819 | 2857729225 | |||
| 820 | 2857730049 | |||
| 821 | 2893686916 | |||
| 822 | 2895661311 | |||
| 823 | 2904433450 | |||
| 824 | 2904503683 | |||
| 825 | 2908675323 | |||
| 826 | 2909075354 | |||
| 827 | 2919040007 | |||
| 828 | 2919447185 | |||
| 829 | 2920881943 | |||
| 830 | 2928123274 | |||
| 831 | 2928501348 | |||
| 832 | 2935411406 | |||
| 833 | 2984553515 | |||
| 834 | 8046356415 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iol-assembly1.cif.gz_F | crystal structure of nucleoside diphosphate kinase from schistosoma mansoni | 0.9733 | 2 | 136 |
| 5v6d-assembly3.cif.gz_F | crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate | 0.9668 | 2 | 136 |
| 3vgv-assembly6.cif.gz_L | e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 | 0.9653 | 2 | 136 |
| 4ek2-assembly1.cif.gz_A | the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate | 0.9645 | 2 | 136 |
| 2nck-assembly1.cif.gz_R | crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution | 0.9622 | 2 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0G2L2L7_25_106_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9889 | 2 | 77 | 3.30.70.141 |
| af_C6T4F9_81_235_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9563 | 1 | 136 | 3.30.70.141 |
| af_A0A1D6EH51_54_191_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9506 | 19 | 136 | 3.30.70.141 |
| 5go1A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9487 | 1 | 136 | 3.30.70.141 |
| 6ay1F00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9481 | 4 | 136 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3BKP0-F1-model_v4 | nucleoside-diphosphate kinase (EC 2.7.4.6) | 0.9948 | 1 | 105 |
GO:0004550
GO:0005524 GO:0006183 GO:0006228 GO:0006241 |
| AF-A0A2Y9HWM5-F1-model_v4 | nucleoside-diphosphate kinase (EC 2.7.4.6) | 0.9921 | 2 | 104 |
GO:0004550
GO:0005741 GO:0005856 GO:0006183 GO:0006228 GO:0006241 GO:0042995 |
| AF-A0A3Q7PG60-F1-model_v4 | nucleoside-diphosphate kinase (EC 2.7.4.6) | 0.9913 | 2 | 107 |
GO:0004550
GO:0005741 GO:0005856 GO:0006183 GO:0006228 GO:0006241 GO:0042995 |
| AF-A0A3Q7VS53-F1-model_v4 | deleted | 0.9885 | 2 | 105 |
|
| AF-A0A7X6TSR4-F1-model_v4 | Nucleoside diphosphate kinase (EC 2.7.4.6) | 0.9845 | 1 | 135 |
GO:0004550
GO:0005524 GO:0006183 GO:0006228 GO:0006241 |