F439169

General Info

Members Datasets Scaffolds Average Seq Length
417 244 417 74

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_1091073|Ga0501070_1091073_101_364
Length 87
Sequence LLKFHKGETLSASGEETTKTGPDCPSCGEPWLRGTNLPGRYRCVYCLHRFELRSECPNCGAHSTIARMSDTANVVCRNCGGSMLQAI

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
242 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 9.35
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10081084 3300001990 Bacteria 965
2 JGI24743J22301_10004425 3300001991 Bacteria 2291
3 JGI24745J21846_1027597 3300002073 Bacteria 679
4 JGI24749J21850_1070274 3300002076 Bacteria 540
5 JGI25407J50210_10089020 3300003373 Bacteria 764
6 JGI25407J50210_10095049 3300003373 Bacteria 737
7 Ga0070658_11944093 3300005327 Bacteria 508
8 Ga0070683_100002001 3300005329 Bacteria 15985
9 Ga0070683_100045287 3300005329 Bacteria 4060
10 Ga0070683_100089361 3300005329 Bacteria 2891
11 Ga0070683_100124864 3300005329 Bacteria 2433
12 Ga0070683_101276413 3300005329 Bacteria 706
13 Ga0070690_100203560 3300005330 Bacteria 1379
14 Ga0070670_100290426 3300005331 Bacteria 1429
15 Ga0068869_100354583 3300005334 Bacteria 1196
16 Ga0070680_100000851 3300005336 Bacteria 21636
17 Ga0070680_100459263 3300005336 Bacteria 1088
18 Ga0070680_100820111 3300005336 Bacteria 802
19 Ga0070682_100065405 3300005337 Bacteria 2310
20 Ga0070682_100219751 3300005337 Bacteria 1352
21 Ga0070682_101811610 3300005337 Bacteria 533
22 Ga0068868_100047076 3300005338 Bacteria 3377
23 Ga0070660_100038964 3300005339 Bacteria 3611
24 Ga0070660_100133590 3300005339 Bacteria 1987
25 Ga0070660_100443373 3300005339 Bacteria 1077
26 Ga0070689_100283215 3300005340 Bacteria 1375
27 Ga0070661_100029904 3300005344 Bacteria 3934
28 Ga0070661_100253833 3300005344 Bacteria 1358
29 Ga0070661_101319218 3300005344 Bacteria 606
30 Ga0070692_10028370 3300005345 Unclassified 2781
31 Ga0070669_100867871 3300005353 Bacteria 770
32 Ga0070675_100083284 3300005354 Bacteria 2670
33 Ga0070671_100689119 3300005355 Bacteria 886
34 Ga0070671_101371284 3300005355 Unclassified 624
35 Ga0070673_100843481 3300005364 Bacteria 848
36 Ga0070659_100010365 3300005366 Bacteria 6853
37 Ga0070659_100715112 3300005366 Bacteria 867
38 Ga0070659_101494446 3300005366 Unclassified 602
39 Ga0070709_11285282 3300005434 Bacteria 590
40 Ga0070709_11311794 3300005434 Bacteria 584
41 Ga0070714_100194584 3300005435 Bacteria 1852
42 Ga0070714_100369027 3300005435 Bacteria 1351
43 Ga0070714_100654206 3300005435 Bacteria 1012
44 Ga0070714_102165455 3300005435 Bacteria 542
45 Ga0070713_102367675 3300005436 Bacteria 514
46 Ga0070710_10045510 3300005437 Bacteria 2440
47 Ga0070710_10234598 3300005437 Bacteria 1173
48 Ga0070710_10462689 3300005437 Bacteria 862
49 Ga0070710_10482312 3300005437 Bacteria 846
50 Ga0070701_10016821 3300005438 Bacteria 3407
51 Ga0070711_100000559 3300005439 Bacteria 19456
52 Ga0070711_100054930 3300005439 Bacteria 2750
53 Ga0070711_100126614 3300005439 Bacteria 1897
54 Ga0070711_100256142 3300005439 Bacteria 1375
55 Ga0070711_100348723 3300005439 Bacteria 1190
56 Ga0070711_101220909 3300005439 Bacteria 651
57 Ga0070705_100064714 3300005440 Bacteria 2186
58 Ga0070700_100076202 3300005441 Bacteria 2153
59 Ga0070700_100873277 3300005441 Bacteria 730
60 Ga0070694_100813525 3300005444 Bacteria 767
61 Ga0070663_100193833 3300005455 Bacteria 1583
62 Ga0070678_100511666 3300005456 Bacteria 1061
63 Ga0070678_101057523 3300005456 Bacteria 748
64 Ga0070681_10019390 3300005458 Bacteria 6806
65 Ga0070681_10195313 3300005458 Bacteria 1943
66 Ga0070681_10803032 3300005458 Bacteria 858
67 Ga0068867_100071776 3300005459 Bacteria 2590
68 Ga0070685_10231922 3300005466 Bacteria 1215
69 Ga0070706_102042126 3300005467 Bacteria 519
70 Ga0070679_100004554 3300005530 Bacteria 12798
71 Ga0070679_100334393 3300005530 Unclassified 1463
72 Ga0070679_100557504 3300005530 Bacteria 1089
73 Ga0070684_100020205 3300005535 Bacteria 5525
74 Ga0070684_100175658 3300005535 Bacteria 1947
75 Ga0070684_100531909 3300005535 Bacteria 1090
76 Ga0070684_101472306 3300005535 Bacteria 641
77 Ga0068853_100056122 3300005539 Bacteria 3396
78 Ga0068853_101646386 3300005539 Bacteria 622
79 Ga0070686_100079761 3300005544 Bacteria 2164
80 Ga0070693_100337315 3300005547 Bacteria 1028
81 Ga0070704_100486954 3300005549 Bacteria 1068
82 Ga0070664_100288217 3300005564 Bacteria 1482
83 Ga0070664_101121085 3300005564 Bacteria 741
84 Ga0068857_100126484 3300005577 Unclassified 2303
85 Ga0068857_100874500 3300005577 Bacteria 861
86 Ga0068854_100149559 3300005578 Bacteria 1799
87 Ga0068854_100153738 3300005578 Unclassified 1776
88 Ga0068856_100116126 3300005614 Unclassified 2677
89 Ga0068856_100168149 3300005614 Bacteria 2204
90 Ga0068856_100973595 3300005614 Bacteria 867
91 Ga0068852_100007442 3300005616 Bacteria 7993
92 Ga0068852_100105917 3300005616 Bacteria 2548
93 Ga0068859_100096276 3300005617 Bacteria 3012
94 Ga0068864_100299982 3300005618 Bacteria 1504
95 Ga0068861_100474352 3300005719 Bacteria 1126
96 Ga0068861_100805246 3300005719 Bacteria 882
97 Ga0068851_10255791 3300005834 Bacteria 995
98 Ga0068870_10014173 3300005840 Bacteria 3760
99 Ga0068858_100451759 3300005842 Bacteria 1238
100 Ga0068860_100549826 3300005843 Bacteria 1156
101 Ga0081538_10000686 3300005981 Bacteria 37157
102 Ga0081538_10000796 3300005981 Bacteria 34251
103 Ga0081538_10001548 3300005981 Bacteria 23571
104 Ga0081538_10263093 3300005981 Bacteria 650
105 Ga0070717_10078150 3300006028 Bacteria 2772
106 Ga0070717_12012158 3300006028 Bacteria 520
107 Ga0075365_10212324 3300006038 Bacteria 1357
108 Ga0075365_11303800 3300006038 Bacteria 510
109 Ga0070715_11096972 3300006163 Bacteria 501
110 Ga0070716_100035787 3300006173 Bacteria 2732
111 Ga0070716_100247399 3300006173 Bacteria 1213
112 Ga0070716_100296340 3300006173 Bacteria 1123
113 Ga0070716_100487144 3300006173 Bacteria 907
114 Ga0070712_100112281 3300006175 Bacteria 2036
115 Ga0070712_100138418 3300006175 Bacteria 1854
116 Ga0070712_100139301 3300006175 Bacteria 1849
117 Ga0070712_100617640 3300006175 Bacteria 919
118 Ga0075367_10649340 3300006178 Bacteria 671
119 Ga0068871_100619176 3300006358 Bacteria 986
120 Ga0075431_100013418 3300006847 Bacteria 8277
121 Ga0075433_10067795 3300006852 Bacteria 3131
122 Ga0075433_10743370 3300006852 Bacteria 858
123 Ga0075433_11446382 3300006852 Bacteria 594
124 Ga0075434_100207024 3300006871 Bacteria 1982
125 Ga0075434_100254885 3300006871 Bacteria 1773
126 Ga0075434_100568027 3300006871 Bacteria 1154
127 Ga0075429_101034767 3300006880 Bacteria 718
128 Ga0068865_100223118 3300006881 Bacteria 1474
129 Ga0075436_100199004 3300006914 Bacteria 1419
130 Ga0097620_100096279 3300006931 Bacteria 3012
131 Ga0075435_100028663 3300007076 Bacteria 4367
132 Ga0099794_10643183 3300007265 Bacteria 563
133 Ga0105240_10058465 3300009093 Bacteria 4813
134 Ga0111539_10311544 3300009094 Bacteria 1832
135 Ga0105245_10045363 3300009098 Bacteria 3926
136 Ga0105245_12678610 3300009098 Bacteria 552
137 Ga0105247_10427197 3300009101 Bacteria 950
138 Ga0114129_10855171 3300009147 Bacteria 1156
139 Ga0105248_10450278 3300009177 Bacteria 1451
140 Ga0105237_10126131 3300009545 Bacteria 2554
141 Ga0105238_10021833 3300009551 Bacteria 6520
142 Ga0105239_10226306 3300010375 Unclassified 2098
143 Ga0157371_10284879 3300013102 Bacteria 1194
144 Ga0157370_10017809 3300013104 Bacteria 7158
145 Ga0157369_10064451 3300013105 Bacteria 3946
146 Ga0157369_10675022 3300013105 Bacteria 1065
147 Ga0157369_11510627 3300013105 Bacteria 683
148 Ga0157374_10148940 3300013296 Bacteria 2275
149 Ga0157378_10767161 3300013297 Bacteria 988
150 Ga0163162_10700006 3300013306 Bacteria 1135
151 Ga0157372_10469517 3300013307 Bacteria 1467
152 Ga0157372_10714581 3300013307 Bacteria 1166
153 Ga0157372_11746605 3300013307 Bacteria 716
154 Ga0163163_10041285 3300014325 Bacteria 4510
155 Ga0163163_10449990 3300014325 Bacteria 1348
156 Ga0157380_10429789 3300014326 Bacteria 1262
157 Ga0182008_10231485 3300014497 Bacteria 948
158 Ga0157377_11482773 3300014745 Unclassified 538
159 Ga0206356_10446832 3300020070 Bacteria 2535
160 Ga0206356_11625268 3300020070 Bacteria 507
161 Ga0206356_11868250 3300020070 Bacteria 554
162 Ga0206354_11267508 3300020081 Bacteria 549
163 Ga0206353_11609894 3300020082 Bacteria 2755
164 Ga0206353_11619556 3300020082 Bacteria 4512
165 Ga0213876_10005976 3300021384 Bacteria 6653
166 Ga0213876_10480502 3300021384 Bacteria 661
167 Ga0224712_10559569 3300022467 Bacteria 556
168 Ga0207692_10076115 3300025898 Bacteria 1782
169 Ga0207692_10481280 3300025898 Bacteria 785
170 Ga0207688_10041543 3300025901 Bacteria 2559
171 Ga0207680_10380944 3300025903 Bacteria 994
172 Ga0207699_10190428 3300025906 Bacteria 1384
173 Ga0207699_11043209 3300025906 Unclassified 605
174 Ga0207643_10014383 3300025908 Bacteria 4297
175 Ga0207705_10521295 3300025909 Bacteria 923
176 Ga0207705_11378267 3300025909 Bacteria 537
177 Ga0207707_10129810 3300025912 Bacteria 2204
178 Ga0207707_10739715 3300025912 Bacteria 823
179 Ga0207707_10831314 3300025912 Unclassified 767
180 Ga0207695_10050185 3300025913 Bacteria 4391
181 Ga0207671_10069725 3300025914 Bacteria 2620
182 Ga0207693_10033646 3300025915 Bacteria 4044
183 Ga0207693_10119114 3300025915 Bacteria 2073
184 Ga0207693_10125584 3300025915 Bacteria 2017
185 Ga0207693_10310876 3300025915 Bacteria 1234
186 Ga0207693_10553389 3300025915 Bacteria 897
187 Ga0207663_10058666 3300025916 Bacteria 2430
188 Ga0207663_10059253 3300025916 Bacteria 2421
189 Ga0207663_10217763 3300025916 Bacteria 1387
190 Ga0207663_10614694 3300025916 Bacteria 855
191 Ga0207663_10732873 3300025916 Bacteria 784
192 Ga0207660_10308793 3300025917 Bacteria 1261
193 Ga0207660_10994313 3300025917 Bacteria 684
194 Ga0207660_11158502 3300025917 Bacteria 629
195 Ga0207660_11340763 3300025917 Bacteria 580
196 Ga0207657_10041030 3300025919 Bacteria 4095
197 Ga0207657_10049094 3300025919 Bacteria 3680
198 Ga0207649_10316377 3300025920 Bacteria 1145
199 Ga0207649_10373456 3300025920 Bacteria 1061
200 Ga0207652_10113740 3300025921 Bacteria 2402
201 Ga0207652_10288221 3300025921 Unclassified 1481
202 Ga0207652_10698489 3300025921 Unclassified 905
203 Ga0207650_10134938 3300025925 Bacteria 1935
204 Ga0207659_10040429 3300025926 Bacteria 3261
205 Ga0207687_10280840 3300025927 Bacteria 1334
206 Ga0207700_10684388 3300025928 Bacteria 915
207 Ga0207700_11329168 3300025928 Bacteria 640
208 Ga0207664_10035449 3300025929 Bacteria 3850
209 Ga0207664_10456928 3300025929 Bacteria 1140
210 Ga0207664_10887788 3300025929 Bacteria 801
211 Ga0207664_11273469 3300025929 Bacteria 654
212 Ga0207644_10510502 3300025931 Bacteria 992
213 Ga0207709_10563421 3300025935 Bacteria 898
214 Ga0207669_10292273 3300025937 Bacteria 1234
215 Ga0207704_10028448 3300025938 Bacteria 3101
216 Ga0207704_11678975 3300025938 Bacteria 546
217 Ga0207665_10279725 3300025939 Bacteria 1241
218 Ga0207665_10551251 3300025939 Bacteria 896
219 Ga0207691_10448815 3300025940 Bacteria 1098
220 Ga0207711_10257185 3300025941 Bacteria 1604
221 Ga0207661_10004877 3300025944 Bacteria 9402
222 Ga0207661_10016432 3300025944 Bacteria 5460
223 Ga0207661_10248670 3300025944 Bacteria 1580
224 Ga0207679_10371750 3300025945 Bacteria 1251
225 Ga0207667_11607330 3300025949 Bacteria 618
226 Ga0207651_10651737 3300025960 Bacteria 924
227 Ga0207668_10422120 3300025972 Bacteria 1132
228 Ga0207658_10192104 3300025986 Bacteria 1698
229 Ga0207677_10190609 3300026023 Bacteria 1621
230 Ga0207703_10588960 3300026035 Bacteria 1051
231 Ga0207639_10285498 3300026041 Bacteria 1453
232 Ga0207678_10073789 3300026067 Bacteria 2924
233 Ga0207708_10065923 3300026075 Bacteria 2768
234 Ga0207702_10295619 3300026078 Unclassified 1535
235 Ga0207702_10770471 3300026078 Bacteria 950
236 Ga0207702_11453324 3300026078 Bacteria 679
237 Ga0207641_12133801 3300026088 Bacteria 561
238 Ga0207676_10342118 3300026095 Bacteria 1380
239 Ga0207674_10223913 3300026116 Bacteria 1829
240 Ga0207674_10359153 3300026116 Bacteria 1408
241 Ga0207675_100564134 3300026118 Bacteria 1139
242 Ga0207698_10919787 3300026142 Bacteria 882
243 Ga0207698_12539305 3300026142 Unclassified 522
244 Ga0207428_10026260 3300027907 Bacteria 4862
245 Ga0207428_10243867 3300027907 Bacteria 1342
246 Ga0268264_10026624 3300028381 Bacteria 4726
247 Ga0265319_1000118 3300028563 Bacteria 60393
248 Ga0265338_10779091 3300028800 Bacteria 656
249 Ga0265330_10106191 3300031235 Bacteria 1201
250 Ga0265320_10038599 3300031240 Bacteria 2394
251 Ga0307408_100056853 3300031548 Bacteria 2838
252 Ga0307413_10201145 3300031824 Bacteria 1439
253 Ga0307410_11639049 3300031852 Bacteria 569
254 Ga0326468_10043548 3300031889 Bacteria 652
255 Ga0307406_10849708 3300031901 Bacteria 774
256 Ga0307412_10931582 3300031911 Bacteria 763
257 Ga0307409_100171784 3300031995 Bacteria 1909
258 Ga0307409_100847132 3300031995 Bacteria 925
259 Ga0307409_101142661 3300031995 Bacteria 801
260 Ga0307416_100288956 3300032002 Bacteria 1622
261 Ga0307416_100738820 3300032002 Bacteria 1076
262 Ga0307414_10702449 3300032004 Bacteria 916
263 Ga0307414_11518719 3300032004 Bacteria 623
264 Ga0307415_100222771 3300032126 Bacteria 1513
265 Ga0307415_101479481 3300032126 Bacteria 649
266 Ga0307415_101548863 3300032126 Bacteria 635
267 Ga0373927_0687801 3300035695 Bacteria 676
268 Ga0373947_0766028 3300035725 Bacteria 659
269 Ga0373937_0044127 3300036401 Bacteria 4071
270 Ga0395898_1595002 3300037466 Bacteria 577
271 Ga0436364_0321095 3300037853 Bacteria 900
272 Ga0436365_0332865 3300039437 Bacteria 12161
273 Ga0436365_1008073 3300039437 Bacteria 1114
274 Ga0436363_0976284 3300039450 Bacteria 583
275 Ga0436363_1715688 3300039450 Bacteria 717
276 Ga0436362_1139331 3300039453 Bacteria 637
277 Ga0451795_1013088 3300041456 Bacteria 867
278 Ga0451800_1032958 3300041459 Bacteria 508
279 Ga0466965_0393414 3300044683 Bacteria 765
280 Ga0466966_0343809 3300044684 Bacteria 896
281 Ga0466966_0380890 3300044684 Unclassified 848
282 Ga0466966_0525101 3300044684 Bacteria 712
283 Ga0466961_0522914 3300044693 Bacteria 716
284 Ga0466963_0111283 3300044694 Bacteria 1880
285 Ga0466963_0145613 3300044694 Bacteria 1643
286 Ga0466963_0589111 3300044694 Bacteria 785
287 Ga0466964_0233098 3300044706 Bacteria 899
288 Ga0466964_0880717 3300044706 Bacteria 511
289 Ga0466971_0137926 3300044719 Bacteria 1135
290 Ga0466971_0535408 3300044719 Bacteria 580
291 Ga0466968_0013067 3300044735 Bacteria 3259
292 Ga0466957_0055567 3300044842 Bacteria 2420
293 Ga0466957_0083399 3300044842 Bacteria 1994
294 Ga0466957_0162976 3300044842 Bacteria 1449
295 Ga0466957_0804773 3300044842 Bacteria 668
296 Ga0466960_0034840 3300044901 Bacteria 2349
297 Ga0466960_0448892 3300044901 Bacteria 749
298 Ga0466959_0599733 3300045049 Bacteria 741
299 Ga0466959_0691188 3300045049 Bacteria 684
300 Ga0466958_0104610 3300045836 Bacteria 1763
301 Ga0466958_0257573 3300045836 Unclassified 1116
302 Ga0466958_0711155 3300045836 Bacteria 654
303 Ga0466958_0728246 3300045836 Bacteria 646
304 Ga0466958_0868639 3300045836 Bacteria 588
305 Ga0466967_0032439 3300045976 Bacteria 4411
306 Ga0466967_0058619 3300045976 Bacteria 3404
307 Ga0466967_0087771 3300045976 Bacteria 2821
308 Ga0466967_0222522 3300045976 Bacteria 1794
309 Ga0466967_0368985 3300045976 Bacteria 1392
310 Ga0466967_0451723 3300045976 Bacteria 1256
311 Ga0466967_1276725 3300045976 Bacteria 731
312 Ga0466967_1395152 3300045976 Bacteria 698
313 Ga0466967_2389265 3300045976 Bacteria 524
314 Ga0466967_2566481 3300045976 Bacteria 504
315 Ga0495592_0155461 3300046454 Bacteria 1578
316 Ga0495603_0773432 3300046455 Bacteria 548
317 Ga0495653_0001520 3300046463 Bacteria 18130
318 Ga0495653_0193338 3300046463 Bacteria 1386
319 Ga0495653_0385618 3300046463 Bacteria 894
320 Ga0495664_0000025 3300046477 Bacteria 120941
321 Ga0495608_0030576 3300046511 Bacteria 3645
322 Ga0495608_0065050 3300046511 Bacteria 2389
323 Ga0495618_0272343 3300046514 Bacteria 1058
324 Ga0495628_0035424 3300046516 Bacteria 4011
325 Ga0495630_0000440 3300046517 Bacteria 31661
326 Ga0495630_0424924 3300046517 Bacteria 1018
327 Ga0495630_0452476 3300046517 Bacteria 984
328 Ga0495652_0088765 3300046529 Bacteria 2533
329 Ga0495652_0133682 3300046529 Bacteria 1960
330 Ga0495665_0210128 3300046531 Bacteria 1008
331 Ga0495640_0025372 3300046533 Bacteria 4301
332 Ga0495587_0029604 3300046536 Bacteria 3324
333 Ga0495661_0299781 3300046665 Bacteria 805
334 Ga0495657_0000017 3300046675 Bacteria 174558
335 Ga0495623_0035669 3300046679 Bacteria 3188
336 Ga0495646_0162488 3300046680 Bacteria 1235
337 Ga0495600_0007859 3300046809 Bacteria 6531
338 Ga0495604_0000063 3300047317 Bacteria 92821
339 Ga0495604_0026854 3300047317 Bacteria 4582
340 Ga0495604_0212774 3300047317 Bacteria 1335
341 Ga0495674_0080436 3300047319 Bacteria 2796
342 Ga0495676_0279915 3300047321 Bacteria 1130
343 Ga0495684_0031055 3300047471 Bacteria 4101
344 Ga0496100_0177281 3300048903 Bacteria 1539
345 Ga0496100_0444110 3300048903 Bacteria 994
346 Ga0496100_1109256 3300048903 Bacteria 624
347 Ga0496102_0000002 3300048905 Bacteria 814588
348 Ga0496102_0172539 3300048905 Unclassified 2036
349 Ga0496102_0253727 3300048905 Bacteria 1658
350 Ga0496102_0674265 3300048905 Bacteria 957
351 Ga0496102_1646793 3300048905 Bacteria 560
352 Ga0496103_0000047 3300048906 Bacteria 161130
353 Ga0496103_0175082 3300048906 Bacteria 1378
354 Ga0496104_0967511 3300048907 Bacteria 755
355 Ga0496104_1041375 3300048907 Bacteria 722
356 Ga0496105_0005677 3300048908 Bacteria 9495
357 Ga0496105_0123090 3300048908 Bacteria 2138
358 Ga0496106_0185946 3300048909 Bacteria 1650
359 Ga0496106_1393112 3300048909 Bacteria 542
360 Ga0496106_1477429 3300048909 Bacteria 523
361 Ga0496107_0198896 3300048910 Bacteria 1489
362 Ga0496107_0584465 3300048910 Bacteria 826
363 Ga0496107_0602475 3300048910 Bacteria 812
364 Ga0496108_0160513 3300048911 Bacteria 1942
365 Ga0496108_0504920 3300048911 Bacteria 1056
366 Ga0496108_0645877 3300048911 Bacteria 920
367 Ga0496110_0060308 3300048913 Bacteria 3345
368 Ga0496110_0063284 3300048913 Bacteria 3268
369 Ga0496111_0098190 3300048914 Bacteria 2150
370 Ga0496112_0110443 3300048915 Bacteria 2720
371 Ga0496112_0316059 3300048915 Bacteria 1506
372 Ga0496112_0600785 3300048915 Bacteria 1032
373 Ga0496113_0033872 3300048916 Bacteria 3723
374 Ga0496113_0067862 3300048916 Bacteria 2705
375 Ga0496113_0155318 3300048916 Bacteria 1807
376 Ga0496113_0269341 3300048916 Bacteria 1361
377 Ga0496114_0257963 3300048917 Bacteria 1534
378 Ga0496114_1443833 3300048917 Bacteria 575
379 Ga0496115_0000017 3300048918 Bacteria 185702
380 Ga0496115_0273784 3300048918 Bacteria 1387
381 Ga0496121_0004160 3300048924 Bacteria 19786
382 Ga0501031_0373009 3300049568 Bacteria 923
383 Ga0501036_0061175 3300049572 Bacteria 3190
384 Ga0501037_0783830 3300049573 Bacteria 630
385 Ga0501040_0073270 3300049576 Bacteria 2366
386 Ga0501040_0719526 3300049576 Bacteria 722
387 Ga0501042_0471159 3300049578 Bacteria 911
388 Ga0501048_0162490 3300049582 Bacteria 1581
389 Ga0501048_1374513 3300049582 Bacteria 508
390 Ga0501067_0868044 3300049583 Bacteria 509
391 Ga0501068_0159854 3300049584 Bacteria 1420
392 Ga0501069_0181398 3300049585 Bacteria 1217
393 Ga0501070_0624974 3300049586 Bacteria 857
394 Ga0501070_1091073 3300049586 Bacteria 616
395 Ga0501071_0179415 3300049587 Bacteria 1587
396 Ga0501072_0599310 3300049588 Bacteria 869
397 Ga0501074_0039056 3300049590 Bacteria 3438
398 Ga0501076_0957631 3300049592 Bacteria 705
399 Ga0501245_149486 3300049708 Bacteria 515
400 Ga0501079_0067711 3300049741 Bacteria 2756
401 Ga0501079_0195452 3300049741 Bacteria 1579
402 Ga0501045_0017972 3300049824 Bacteria 5022
403 nmdc:mga0yw44_1217697_c1 3300050492 Bacteria 508
404 nmdc:mga0yw44_644390_c1 3300050492 Bacteria 720
405 nmdc:mga06z11_834610_c1 3300050494 Bacteria 561
406 nmdc:mga09592_401740_c1 3300050508 Bacteria 1184
407 nmdc:mga08y16_71613_c1 3300050511 Bacteria 3612
408 nmdc:mga0n895_832764_c1 3300050512 Bacteria 911
409 nmdc:mga0n895_962092_c1 3300050512 Bacteria 837
410 Ga0495601_0089725 3300053077 Bacteria 1977
411 Ga0495612_0114726 3300053078 Bacteria 1156
412 Ga0495595_0248184 3300053084 Bacteria 891
413 Ga0500614_081961 3300053123 Bacteria 904
414 Ga0587071_175907 3300060344 Bacteria 547
415 Ga0501082_0539927 3300060353 Bacteria 1020
416 Ga0466962_0274046 3300061719 Bacteria 832
417 Ga0466962_0303174 3300061719 Bacteria 790

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10649340 Ga0075367_106493402 59
2 3300014325 Ga0163163_10449990 Ga0163163_104499902 63
3 3300045049 Ga0466959_0599733 Ga0466959_0599733_115_327 63
4 3300013297 Ga0157378_10767161 Ga0157378_107671612 64
5 3300045976 Ga0466967_1395152 Ga0466967_1395152_138_383 64
6 3300048918 Ga0496115_0000017 Ga0496115_0000017_42111_42359 64
7 3300005434 Ga0070709_11311794 Ga0070709_113117942 65
8 3300005435 Ga0070714_100369027 Ga0070714_1003690272 65
9 3300005439 Ga0070711_100054930 Ga0070711_1000549303 65
10 3300006173 Ga0070716_100035787 Ga0070716_1000357872 65
11 3300020070 Ga0206356_11625268 Ga0206356_116252682 65
12 3300025906 Ga0207699_10190428 Ga0207699_101904282 65
13 3300025916 Ga0207663_10058666 Ga0207663_100586663 65
14 3300025929 Ga0207664_10887788 Ga0207664_108877882 65
15 3300039450 Ga0436363_1715688 Ga0436363_1715688_37_264 65
16 3300044693 Ga0466961_0522914 Ga0466961_0522914_349_576 65
17 3300044694 Ga0466963_0111283 Ga0466963_0111283_1433_1660 65
18 3300044694 Ga0466963_0145613 Ga0466963_0145613_921_1172 65
19 3300044706 Ga0466964_0880717 Ga0466964_0880717_33_284 65
20 3300044719 Ga0466971_0137926 Ga0466971_0137926_326_553 65
21 3300044719 Ga0466971_0535408 Ga0466971_0535408_147_374 65
22 3300044735 Ga0466968_0013067 Ga0466968_0013067_2599_2826 65
23 3300044842 Ga0466957_0162976 Ga0466957_0162976_1168_1419 65
24 3300044842 Ga0466957_0804773 Ga0466957_0804773_39_266 65
25 3300045049 Ga0466959_0691188 Ga0466959_0691188_35_262 65
26 3300045836 Ga0466958_0257573 Ga0466958_0257573_133_360 65
27 3300045836 Ga0466958_0711155 Ga0466958_0711155_311_562 65
28 3300045836 Ga0466958_0868639 Ga0466958_0868639_37_264 65
29 3300045976 Ga0466967_0368985 Ga0466967_0368985_132_359 65
30 3300045976 Ga0466967_0451723 Ga0466967_0451723_962_1189 65
31 3300048905 Ga0496102_1646793 Ga0496102_1646793_38_253 65
32 3300048916 Ga0496113_0269341 Ga0496113_0269341_67_294 65
33 3300050494 nmdc:mga06z11_834610_c1 nmdc:mga06z11_834610_c1_70_306 65
34 3300061719 Ga0466962_0274046 Ga0466962_0274046_411_638 65
35 3300005456 Ga0070678_101057523 Ga0070678_1010575232 66
36 3300006038 Ga0075365_11303800 Ga0075365_113038002 66
37 3300007265 Ga0099794_10643183 Ga0099794_106431831 66
38 3300025916 Ga0207663_10059253 Ga0207663_100592532 66
39 3300035725 Ga0373947_0766028 Ga0373947_0766028_119_361 66
40 3300044684 Ga0466966_0525101 Ga0466966_0525101_333_560 66
41 3300044694 Ga0466963_0589111 Ga0466963_0589111_444_680 66
42 3300044842 Ga0466957_0055567 Ga0466957_0055567_1337_1573 66
43 3300045836 Ga0466958_0104610 Ga0466958_0104610_469_705 66
44 3300045976 Ga0466967_2389265 Ga0466967_2389265_83_319 66
45 3300050492 nmdc:mga0yw44_1217697_c1 nmdc:mga0yw44_1217697_c1_77_307 66
46 3300005435 Ga0070714_100194584 Ga0070714_1001945842 67
47 3300005435 Ga0070714_100654206 Ga0070714_1006542062 67
48 3300005437 Ga0070710_10482312 Ga0070710_104823121 67
49 3300005439 Ga0070711_101220909 Ga0070711_1012209092 67
50 3300005614 Ga0068856_100973595 Ga0068856_1009735952 67
51 3300006028 Ga0070717_10078150 Ga0070717_100781502 67
52 3300006028 Ga0070717_12012158 Ga0070717_120121582 67
53 3300006173 Ga0070716_100247399 Ga0070716_1002473992 67
54 3300006852 Ga0075433_10743370 Ga0075433_107433702 67
55 3300006871 Ga0075434_100568027 Ga0075434_1005680272 67
56 3300013307 Ga0157372_11746605 Ga0157372_117466052 67
57 3300021384 Ga0213876_10005976 Ga0213876_100059763 67
58 3300021384 Ga0213876_10480502 Ga0213876_104805022 67
59 3300025906 Ga0207699_11043209 Ga0207699_110432091 67
60 3300025928 Ga0207700_11329168 Ga0207700_113291682 67
61 3300025929 Ga0207664_10035449 Ga0207664_100354494 67
62 3300025929 Ga0207664_11273469 Ga0207664_112734692 67
63 3300025939 Ga0207665_10551251 Ga0207665_105512512 67
64 3300026078 Ga0207702_11453324 Ga0207702_114533242 67
65 3300031911 Ga0307412_10931582 Ga0307412_109315822 67
66 3300031995 Ga0307409_100847132 Ga0307409_1008471322 67
67 3300032002 Ga0307416_100288956 Ga0307416_1002889563 67
68 3300032004 Ga0307414_10702449 Ga0307414_107024492 67
69 3300032126 Ga0307415_100222771 Ga0307415_1002227712 67
70 3300035695 Ga0373927_0687801 Ga0373927_0687801_411_647 67
71 3300036401 Ga0373937_0044127 Ga0373937_0044127_267_503 67
72 3300037466 Ga0395898_1595002 Ga0395898_1595002_227_463 67
73 3300037853 Ga0436364_0321095 Ga0436364_0321095_240_467 67
74 3300039437 Ga0436365_0332865 Ga0436365_0332865_5864_6091 67
75 3300039437 Ga0436365_1008073 Ga0436365_1008073_617_844 67
76 3300039450 Ga0436363_0976284 Ga0436363_0976284_115_342 67
77 3300039453 Ga0436362_1139331 Ga0436362_1139331_247_474 67
78 3300044684 Ga0466966_0380890 Ga0466966_0380890_268_495 67
79 3300046454 Ga0495592_0155461 Ga0495592_0155461_1269_1505 67
80 3300046463 Ga0495653_0001520 Ga0495653_0001520_16916_17164 67
81 3300046463 Ga0495653_0193338 Ga0495653_0193338_68_304 67
82 3300046511 Ga0495608_0030576 Ga0495608_0030576_855_1091 67
83 3300046514 Ga0495618_0272343 Ga0495618_0272343_772_1008 67
84 3300046516 Ga0495628_0035424 Ga0495628_0035424_797_1033 67
85 3300046517 Ga0495630_0000440 Ga0495630_0000440_24967_25215 67
86 3300046517 Ga0495630_0424924 Ga0495630_0424924_97_333 67
87 3300046517 Ga0495630_0452476 Ga0495630_0452476_78_314 67
88 3300046529 Ga0495652_0133682 Ga0495652_0133682_306_542 67
89 3300046531 Ga0495665_0210128 Ga0495665_0210128_705_941 67
90 3300046533 Ga0495640_0025372 Ga0495640_0025372_3930_4166 67
91 3300046536 Ga0495587_0029604 Ga0495587_0029604_2967_3203 67
92 3300046675 Ga0495657_0000017 Ga0495657_0000017_144112_144360 67
93 3300046679 Ga0495623_0035669 Ga0495623_0035669_2928_3164 67
94 3300046680 Ga0495646_0162488 Ga0495646_0162488_214_462 67
95 3300047317 Ga0495604_0026854 Ga0495604_0026854_2929_3165 67
96 3300047317 Ga0495604_0212774 Ga0495604_0212774_886_1122 67
97 3300047319 Ga0495674_0080436 Ga0495674_0080436_1067_1303 67
98 3300047471 Ga0495684_0031055 Ga0495684_0031055_1479_1727 67
99 3300048903 Ga0496100_1109256 Ga0496100_1109256_242_487 67
100 3300048905 Ga0496102_0674265 Ga0496102_0674265_589_825 67
101 3300048910 Ga0496107_0602475 Ga0496107_0602475_408_644 67
102 3300048911 Ga0496108_0645877 Ga0496108_0645877_450_686 67
103 3300048913 Ga0496110_0060308 Ga0496110_0060308_2480_2716 67
104 3300048916 Ga0496113_0033872 Ga0496113_0033872_1949_2185 67
105 3300048917 Ga0496114_1443833 Ga0496114_1443833_115_351 67
106 3300050512 nmdc:mga0n895_832764_c1 nmdc:mga0n895_832764_c1_519_764 67
107 3300053077 Ga0495601_0089725 Ga0495601_0089725_80_316 67
108 3300053078 Ga0495612_0114726 Ga0495612_0114726_658_894 67
109 3300053084 Ga0495595_0248184 Ga0495595_0248184_541_789 67
110 3300049587 Ga0501071_0179415 Ga0501071_0179415_718_945 68
111 3300049588 Ga0501072_0599310 Ga0501072_0599310_236_463 68
112 3300003373 JGI25407J50210_10089020 JGI25407J50210_100890202 70
113 3300003373 JGI25407J50210_10095049 JGI25407J50210_100950491 70
114 3300005329 Ga0070683_100002001 Ga0070683_10000200115 70
115 3300005458 Ga0070681_10195313 Ga0070681_101953132 70
116 3300005535 Ga0070684_100175658 Ga0070684_1001756583 70
117 3300005981 Ga0081538_10000686 Ga0081538_100006863 70
118 3300005981 Ga0081538_10000796 Ga0081538_100007967 70
119 3300013105 Ga0157369_10675022 Ga0157369_106750222 70
120 3300020070 Ga0206356_11868250 Ga0206356_118682502 70
121 3300020082 Ga0206353_11609894 Ga0206353_116098943 70
122 3300025912 Ga0207707_10129810 Ga0207707_101298101 70
123 3300025917 Ga0207660_11158502 Ga0207660_111585021 70
124 3300025944 Ga0207661_10016432 Ga0207661_100164325 70
125 3300045976 Ga0466967_0032439 Ga0466967_0032439_528_743 70
126 3300048924 Ga0496121_0004160 Ga0496121_0004160_18238_18450 70
127 3300049576 Ga0501040_0719526 Ga0501040_0719526_363_593 70
128 3300049592 Ga0501076_0957631 Ga0501076_0957631_428_658 70
129 3300049582 Ga0501048_1374513 Ga0501048_1374513_214_441 71
130 3300001990 JGI24737J22298_10081084 JGI24737J22298_100810842 72
131 3300001991 JGI24743J22301_10004425 JGI24743J22301_100044252 72
132 3300002073 JGI24745J21846_1027597 JGI24745J21846_10275972 72
133 3300002076 JGI24749J21850_1070274 JGI24749J21850_10702741 72
134 3300005327 Ga0070658_11944093 Ga0070658_119440931 72
135 3300005329 Ga0070683_100045287 Ga0070683_1000452875 72
136 3300005329 Ga0070683_100089361 Ga0070683_1000893613 72
137 3300005329 Ga0070683_100124864 Ga0070683_1001248643 72
138 3300005329 Ga0070683_101276413 Ga0070683_1012764132 72
139 3300005330 Ga0070690_100203560 Ga0070690_1002035602 72
140 3300005331 Ga0070670_100290426 Ga0070670_1002904262 72
141 3300005334 Ga0068869_100354583 Ga0068869_1003545832 72
142 3300005336 Ga0070680_100000851 Ga0070680_1000008515 72
143 3300005336 Ga0070680_100459263 Ga0070680_1004592632 72
144 3300005336 Ga0070680_100820111 Ga0070680_1008201112 72
145 3300005337 Ga0070682_100065405 Ga0070682_1000654054 72
146 3300005337 Ga0070682_100219751 Ga0070682_1002197512 72
147 3300005337 Ga0070682_101811610 Ga0070682_1018116102 72
148 3300005338 Ga0068868_100047076 Ga0068868_1000470762 72
149 3300005339 Ga0070660_100038964 Ga0070660_1000389642 72
150 3300005339 Ga0070660_100133590 Ga0070660_1001335902 72
151 3300005339 Ga0070660_100443373 Ga0070660_1004433732 72
152 3300005340 Ga0070689_100283215 Ga0070689_1002832152 72
153 3300005344 Ga0070661_100029904 Ga0070661_1000299042 72
154 3300005344 Ga0070661_100253833 Ga0070661_1002538332 72
155 3300005344 Ga0070661_101319218 Ga0070661_1013192181 72
156 3300005345 Ga0070692_10028370 Ga0070692_100283701 72
157 3300005353 Ga0070669_100867871 Ga0070669_1008678712 72
158 3300005354 Ga0070675_100083284 Ga0070675_1000832843 72
159 3300005355 Ga0070671_100689119 Ga0070671_1006891192 72
160 3300005355 Ga0070671_101371284 Ga0070671_1013712842 72
161 3300005364 Ga0070673_100843481 Ga0070673_1008434812 72
162 3300005366 Ga0070659_100010365 Ga0070659_1000103658 72
163 3300005366 Ga0070659_100715112 Ga0070659_1007151122 72
164 3300005366 Ga0070659_101494446 Ga0070659_1014944461 72
165 3300005434 Ga0070709_11285282 Ga0070709_112852822 72
166 3300005435 Ga0070714_102165455 Ga0070714_1021654552 72
167 3300005436 Ga0070713_102367675 Ga0070713_1023676752 72
168 3300005437 Ga0070710_10045510 Ga0070710_100455103 72
169 3300005437 Ga0070710_10234598 Ga0070710_102345981 72
170 3300005437 Ga0070710_10462689 Ga0070710_104626892 72
171 3300005438 Ga0070701_10016821 Ga0070701_100168213 72
172 3300005439 Ga0070711_100000559 Ga0070711_1000005593 72
173 3300005439 Ga0070711_100126614 Ga0070711_1001266142 72
174 3300005439 Ga0070711_100256142 Ga0070711_1002561422 72
175 3300005439 Ga0070711_100348723 Ga0070711_1003487232 72
176 3300005440 Ga0070705_100064714 Ga0070705_1000647142 72
177 3300005441 Ga0070700_100076202 Ga0070700_1000762022 72
178 3300005441 Ga0070700_100873277 Ga0070700_1008732772 72
179 3300005444 Ga0070694_100813525 Ga0070694_1008135252 72
180 3300005455 Ga0070663_100193833 Ga0070663_1001938332 72
181 3300005456 Ga0070678_100511666 Ga0070678_1005116662 72
182 3300005458 Ga0070681_10019390 Ga0070681_100193903 72
183 3300005458 Ga0070681_10803032 Ga0070681_108030322 72
184 3300005459 Ga0068867_100071776 Ga0068867_1000717763 72
185 3300005466 Ga0070685_10231922 Ga0070685_102319222 72
186 3300005467 Ga0070706_102042126 Ga0070706_1020421262 72
187 3300005530 Ga0070679_100004554 Ga0070679_1000045546 72
188 3300005530 Ga0070679_100334393 Ga0070679_1003343932 72
189 3300005530 Ga0070679_100557504 Ga0070679_1005575042 72
190 3300005535 Ga0070684_100020205 Ga0070684_1000202056 72
191 3300005535 Ga0070684_100531909 Ga0070684_1005319092 72
192 3300005535 Ga0070684_101472306 Ga0070684_1014723062 72
193 3300005539 Ga0068853_100056122 Ga0068853_1000561222 72
194 3300005539 Ga0068853_101646386 Ga0068853_1016463862 72
195 3300005544 Ga0070686_100079761 Ga0070686_1000797611 72
196 3300005547 Ga0070693_100337315 Ga0070693_1003373152 72
197 3300005549 Ga0070704_100486954 Ga0070704_1004869542 72
198 3300005564 Ga0070664_100288217 Ga0070664_1002882172 72
199 3300005564 Ga0070664_101121085 Ga0070664_1011210851 72
200 3300005577 Ga0068857_100126484 Ga0068857_1001264842 72
201 3300005577 Ga0068857_100874500 Ga0068857_1008745002 72
202 3300005578 Ga0068854_100149559 Ga0068854_1001495592 72
203 3300005578 Ga0068854_100153738 Ga0068854_1001537382 72
204 3300005614 Ga0068856_100116126 Ga0068856_1001161263 72
205 3300005614 Ga0068856_100168149 Ga0068856_1001681493 72
206 3300005616 Ga0068852_100007442 Ga0068852_1000074424 72
207 3300005616 Ga0068852_100105917 Ga0068852_1001059172 72
208 3300005617 Ga0068859_100096276 Ga0068859_1000962762 72
209 3300005618 Ga0068864_100299982 Ga0068864_1002999823 72
210 3300005719 Ga0068861_100474352 Ga0068861_1004743522 72
211 3300005719 Ga0068861_100805246 Ga0068861_1008052462 72
212 3300005834 Ga0068851_10255791 Ga0068851_102557911 72
213 3300005840 Ga0068870_10014173 Ga0068870_100141732 72
214 3300005842 Ga0068858_100451759 Ga0068858_1004517592 72
215 3300005843 Ga0068860_100549826 Ga0068860_1005498262 72
216 3300005981 Ga0081538_10001548 Ga0081538_1000154813 72
217 3300005981 Ga0081538_10263093 Ga0081538_102630932 72
218 3300006038 Ga0075365_10212324 Ga0075365_102123242 72
219 3300006163 Ga0070715_11096972 Ga0070715_110969722 72
220 3300006173 Ga0070716_100296340 Ga0070716_1002963402 72
221 3300006173 Ga0070716_100487144 Ga0070716_1004871442 72
222 3300006175 Ga0070712_100112281 Ga0070712_1001122813 72
223 3300006175 Ga0070712_100138418 Ga0070712_1001384182 72
224 3300006175 Ga0070712_100139301 Ga0070712_1001393013 72
225 3300006175 Ga0070712_100617640 Ga0070712_1006176402 72
226 3300006358 Ga0068871_100619176 Ga0068871_1006191762 72
227 3300006847 Ga0075431_100013418 Ga0075431_1000134185 72
228 3300006852 Ga0075433_10067795 Ga0075433_100677953 72
229 3300006852 Ga0075433_11446382 Ga0075433_114463821 72
230 3300006871 Ga0075434_100207024 Ga0075434_1002070242 72
231 3300006871 Ga0075434_100254885 Ga0075434_1002548852 72
232 3300006880 Ga0075429_101034767 Ga0075429_1010347672 72
233 3300006881 Ga0068865_100223118 Ga0068865_1002231182 72
234 3300006914 Ga0075436_100199004 Ga0075436_1001990042 72
235 3300006931 Ga0097620_100096279 Ga0097620_1000962794 72
236 3300007076 Ga0075435_100028663 Ga0075435_1000286635 72
237 3300009093 Ga0105240_10058465 Ga0105240_100584653 72
238 3300009094 Ga0111539_10311544 Ga0111539_103115443 72
239 3300009098 Ga0105245_10045363 Ga0105245_100453634 72
240 3300009098 Ga0105245_12678610 Ga0105245_126786102 72
241 3300009101 Ga0105247_10427197 Ga0105247_104271972 72
242 3300009147 Ga0114129_10855171 Ga0114129_108551712 72
243 3300009177 Ga0105248_10450278 Ga0105248_104502782 72
244 3300009545 Ga0105237_10126131 Ga0105237_101261312 72
245 3300009551 Ga0105238_10021833 Ga0105238_100218335 72
246 3300010375 Ga0105239_10226306 Ga0105239_102263062 72
247 3300013102 Ga0157371_10284879 Ga0157371_102848792 72
248 3300013104 Ga0157370_10017809 Ga0157370_100178095 72
249 3300013105 Ga0157369_10064451 Ga0157369_100644512 72
250 3300013105 Ga0157369_11510627 Ga0157369_115106272 72
251 3300013296 Ga0157374_10148940 Ga0157374_101489402 72
252 3300013306 Ga0163162_10700006 Ga0163162_107000062 72
253 3300013307 Ga0157372_10469517 Ga0157372_104695172 72
254 3300013307 Ga0157372_10714581 Ga0157372_107145812 72
255 3300014325 Ga0163163_10041285 Ga0163163_100412854 72
256 3300014326 Ga0157380_10429789 Ga0157380_104297892 72
257 3300014497 Ga0182008_10231485 Ga0182008_102314852 72
258 3300014745 Ga0157377_11482773 Ga0157377_114827732 72
259 3300020070 Ga0206356_10446832 Ga0206356_104468322 72
260 3300020081 Ga0206354_11267508 Ga0206354_112675081 72
261 3300020082 Ga0206353_11619556 Ga0206353_116195565 72
262 3300022467 Ga0224712_10559569 Ga0224712_105595692 72
263 3300025898 Ga0207692_10076115 Ga0207692_100761152 72
264 3300025898 Ga0207692_10481280 Ga0207692_104812802 72
265 3300025901 Ga0207688_10041543 Ga0207688_100415432 72
266 3300025903 Ga0207680_10380944 Ga0207680_103809442 72
267 3300025908 Ga0207643_10014383 Ga0207643_100143835 72
268 3300025909 Ga0207705_10521295 Ga0207705_105212952 72
269 3300025909 Ga0207705_11378267 Ga0207705_113782672 72
270 3300025912 Ga0207707_10739715 Ga0207707_107397152 72
271 3300025912 Ga0207707_10831314 Ga0207707_108313142 72
272 3300025913 Ga0207695_10050185 Ga0207695_100501853 72
273 3300025914 Ga0207671_10069725 Ga0207671_100697252 72
274 3300025915 Ga0207693_10033646 Ga0207693_100336465 72
275 3300025915 Ga0207693_10119114 Ga0207693_101191142 72
276 3300025915 Ga0207693_10125584 Ga0207693_101255844 72
277 3300025915 Ga0207693_10310876 Ga0207693_103108762 72
278 3300025915 Ga0207693_10553389 Ga0207693_105533892 72
279 3300025916 Ga0207663_10217763 Ga0207663_102177632 72
280 3300025916 Ga0207663_10614694 Ga0207663_106146942 72
281 3300025916 Ga0207663_10732873 Ga0207663_107328732 72
282 3300025917 Ga0207660_10308793 Ga0207660_103087932 72
283 3300025917 Ga0207660_10994313 Ga0207660_109943131 72
284 3300025917 Ga0207660_11340763 Ga0207660_113407632 72
285 3300025919 Ga0207657_10041030 Ga0207657_100410304 72
286 3300025919 Ga0207657_10049094 Ga0207657_100490942 72
287 3300025920 Ga0207649_10316377 Ga0207649_103163771 72
288 3300025920 Ga0207649_10373456 Ga0207649_103734562 72
289 3300025921 Ga0207652_10113740 Ga0207652_101137404 72
290 3300025921 Ga0207652_10288221 Ga0207652_102882212 72
291 3300025921 Ga0207652_10698489 Ga0207652_106984892 72
292 3300025925 Ga0207650_10134938 Ga0207650_101349383 72
293 3300025926 Ga0207659_10040429 Ga0207659_100404292 72
294 3300025927 Ga0207687_10280840 Ga0207687_102808402 72
295 3300025928 Ga0207700_10684388 Ga0207700_106843882 72
296 3300025929 Ga0207664_10456928 Ga0207664_104569282 72
297 3300025931 Ga0207644_10510502 Ga0207644_105105022 72
298 3300025935 Ga0207709_10563421 Ga0207709_105634212 72
299 3300025937 Ga0207669_10292273 Ga0207669_102922732 72
300 3300025938 Ga0207704_10028448 Ga0207704_100284484 72
301 3300025938 Ga0207704_11678975 Ga0207704_116789752 72
302 3300025939 Ga0207665_10279725 Ga0207665_102797252 72
303 3300025940 Ga0207691_10448815 Ga0207691_104488152 72
304 3300025941 Ga0207711_10257185 Ga0207711_102571854 72
305 3300025944 Ga0207661_10004877 Ga0207661_100048777 72
306 3300025944 Ga0207661_10248670 Ga0207661_102486701 72
307 3300025945 Ga0207679_10371750 Ga0207679_103717502 72
308 3300025949 Ga0207667_11607330 Ga0207667_116073302 72
309 3300025960 Ga0207651_10651737 Ga0207651_106517372 72
310 3300025972 Ga0207668_10422120 Ga0207668_104221202 72
311 3300025986 Ga0207658_10192104 Ga0207658_101921042 72
312 3300026023 Ga0207677_10190609 Ga0207677_101906092 72
313 3300026035 Ga0207703_10588960 Ga0207703_105889602 72
314 3300026041 Ga0207639_10285498 Ga0207639_102854982 72
315 3300026067 Ga0207678_10073789 Ga0207678_100737892 72
316 3300026075 Ga0207708_10065923 Ga0207708_100659234 72
317 3300026078 Ga0207702_10295619 Ga0207702_102956192 72
318 3300026078 Ga0207702_10770471 Ga0207702_107704712 72
319 3300026088 Ga0207641_12133801 Ga0207641_121338012 72
320 3300026095 Ga0207676_10342118 Ga0207676_103421182 72
321 3300026116 Ga0207674_10223913 Ga0207674_102239132 72
322 3300026116 Ga0207674_10359153 Ga0207674_103591532 72
323 3300026118 Ga0207675_100564134 Ga0207675_1005641342 72
324 3300026142 Ga0207698_10919787 Ga0207698_109197872 72
325 3300026142 Ga0207698_12539305 Ga0207698_125393051 72
326 3300027907 Ga0207428_10026260 Ga0207428_100262602 72
327 3300027907 Ga0207428_10243867 Ga0207428_102438672 72
328 3300028381 Ga0268264_10026624 Ga0268264_100266243 72
329 3300028563 Ga0265319_1000118 Ga0265319_100011851 72
330 3300028800 Ga0265338_10779091 Ga0265338_107790912 72
331 3300031235 Ga0265330_10106191 Ga0265330_101061913 72
332 3300031240 Ga0265320_10038599 Ga0265320_100385992 72
333 3300031548 Ga0307408_100056853 Ga0307408_1000568532 72
334 3300031824 Ga0307413_10201145 Ga0307413_102011451 72
335 3300031852 Ga0307410_11639049 Ga0307410_116390492 72
336 3300031889 Ga0326468_10043548 Ga0326468_100435482 72
337 3300031901 Ga0307406_10849708 Ga0307406_108497082 72
338 3300031995 Ga0307409_100171784 Ga0307409_1001717842 72
339 3300031995 Ga0307409_101142661 Ga0307409_1011426612 72
340 3300032002 Ga0307416_100738820 Ga0307416_1007388202 72
341 3300032004 Ga0307414_11518719 Ga0307414_115187192 72
342 3300032126 Ga0307415_101479481 Ga0307415_1014794812 72
343 3300032126 Ga0307415_101548863 Ga0307415_1015488632 72
344 3300041456 Ga0451795_1013088 Ga0451795_1013088_438_662 72
345 3300041459 Ga0451800_1032958 Ga0451800_1032958_213_431 72
346 3300044683 Ga0466965_0393414 Ga0466965_0393414_514_732 72
347 3300044684 Ga0466966_0343809 Ga0466966_0343809_139_363 72
348 3300044706 Ga0466964_0233098 Ga0466964_0233098_62_280 72
349 3300044842 Ga0466957_0083399 Ga0466957_0083399_170_394 72
350 3300044901 Ga0466960_0034840 Ga0466960_0034840_1666_1884 72
351 3300044901 Ga0466960_0448892 Ga0466960_0448892_253_480 72
352 3300045836 Ga0466958_0728246 Ga0466958_0728246_352_576 72
353 3300045976 Ga0466967_0058619 Ga0466967_0058619_2102_2320 72
354 3300045976 Ga0466967_0087771 Ga0466967_0087771_2232_2456 72
355 3300045976 Ga0466967_0222522 Ga0466967_0222522_789_1007 72
356 3300045976 Ga0466967_1276725 Ga0466967_1276725_401_619 72
357 3300045976 Ga0466967_2566481 Ga0466967_2566481_186_404 72
358 3300046455 Ga0495603_0773432 Ga0495603_0773432_252_470 72
359 3300046463 Ga0495653_0385618 Ga0495653_0385618_15_263 72
360 3300046477 Ga0495664_0000025 Ga0495664_0000025_7257_7505 72
361 3300046511 Ga0495608_0065050 Ga0495608_0065050_1426_1674 72
362 3300046529 Ga0495652_0088765 Ga0495652_0088765_721_969 72
363 3300046665 Ga0495661_0299781 Ga0495661_0299781_420_656 72
364 3300046809 Ga0495600_0007859 Ga0495600_0007859_1467_1715 72
365 3300047317 Ga0495604_0000063 Ga0495604_0000063_8695_8946 72
366 3300047321 Ga0495676_0279915 Ga0495676_0279915_295_537 72
367 3300048903 Ga0496100_0177281 Ga0496100_0177281_730_948 72
368 3300048903 Ga0496100_0444110 Ga0496100_0444110_660_878 72
369 3300048905 Ga0496102_0000002 Ga0496102_0000002_125160_125408 72
370 3300048905 Ga0496102_0172539 Ga0496102_0172539_427_657 72
371 3300048905 Ga0496102_0253727 Ga0496102_0253727_752_970 72
372 3300048906 Ga0496103_0000047 Ga0496103_0000047_24594_24842 72
373 3300048906 Ga0496103_0175082 Ga0496103_0175082_727_945 72
374 3300048907 Ga0496104_0967511 Ga0496104_0967511_359_577 72
375 3300048907 Ga0496104_1041375 Ga0496104_1041375_438_668 72
376 3300048908 Ga0496105_0005677 Ga0496105_0005677_7334_7576 72
377 3300048908 Ga0496105_0123090 Ga0496105_0123090_640_858 72
378 3300048909 Ga0496106_0185946 Ga0496106_0185946_552_770 72
379 3300048909 Ga0496106_1393112 Ga0496106_1393112_17_235 72
380 3300048909 Ga0496106_1477429 Ga0496106_1477429_149_367 72
381 3300048910 Ga0496107_0198896 Ga0496107_0198896_1007_1225 72
382 3300048910 Ga0496107_0584465 Ga0496107_0584465_45_263 72
383 3300048911 Ga0496108_0160513 Ga0496108_0160513_182_400 72
384 3300048911 Ga0496108_0504920 Ga0496108_0504920_155_385 72
385 3300048913 Ga0496110_0063284 Ga0496110_0063284_2128_2346 72
386 3300048914 Ga0496111_0098190 Ga0496111_0098190_1414_1632 72
387 3300048915 Ga0496112_0110443 Ga0496112_0110443_445_675 72
388 3300048915 Ga0496112_0316059 Ga0496112_0316059_519_737 72
389 3300048915 Ga0496112_0600785 Ga0496112_0600785_261_491 72
390 3300048916 Ga0496113_0067862 Ga0496113_0067862_158_376 72
391 3300048916 Ga0496113_0155318 Ga0496113_0155318_300_518 72
392 3300048917 Ga0496114_0257963 Ga0496114_0257963_185_403 72
393 3300048918 Ga0496115_0273784 Ga0496115_0273784_930_1148 72
394 3300049568 Ga0501031_0373009 Ga0501031_0373009_59_295 72
395 3300049572 Ga0501036_0061175 Ga0501036_0061175_521_757 72
396 3300049573 Ga0501037_0783830 Ga0501037_0783830_83_319 72
397 3300049576 Ga0501040_0073270 Ga0501040_0073270_526_762 72
398 3300049578 Ga0501042_0471159 Ga0501042_0471159_198_428 72
399 3300049582 Ga0501048_0162490 Ga0501048_0162490_966_1202 72
400 3300049583 Ga0501067_0868044 Ga0501067_0868044_130_348 72
401 3300049584 Ga0501068_0159854 Ga0501068_0159854_209_433 72
402 3300049585 Ga0501069_0181398 Ga0501069_0181398_947_1171 72
403 3300049586 Ga0501070_0624974 Ga0501070_0624974_186_410 72
404 3300049586 Ga0501070_1091073 Ga0501070_1091073_101_364 72
405 3300049590 Ga0501074_0039056 Ga0501074_0039056_3073_3297 72
406 3300049708 Ga0501245_149486 Ga0501245_149486_129_347 72
407 3300049741 Ga0501079_0067711 Ga0501079_0067711_2024_2248 72
408 3300049741 Ga0501079_0195452 Ga0501079_0195452_96_332 72
409 3300049824 Ga0501045_0017972 Ga0501045_0017972_4392_4628 72
410 3300050492 nmdc:mga0yw44_644390_c1 nmdc:mga0yw44_644390_c1_98_322 72
411 3300050508 nmdc:mga09592_401740_c1 nmdc:mga09592_401740_c1_112_348 72
412 3300050511 nmdc:mga08y16_71613_c1 nmdc:mga08y16_71613_c1_1562_1780 72
413 3300050512 nmdc:mga0n895_962092_c1 nmdc:mga0n895_962092_c1_135_353 72
414 3300053123 Ga0500614_081961 Ga0500614_081961_59_289 72
415 3300060344 Ga0587071_175907 Ga0587071_175907_12_260 72
416 3300060353 Ga0501082_0539927 Ga0501082_0539927_449_685 72
417 3300061719 Ga0466962_0303174 Ga0466962_0303174_72_296 72

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17283

Zn_ribbon_SprT

SprT-like zinc ribbon domain

55

87

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6th6-assembly1.cif.gz_Bg cryo-em structure of t. kodakarensis 70s ribosome 0.9289 9 37
7pwo-assembly1.cif.gz_p2 cryo-em structure of giardia lamblia ribosome at 2.75 a resolution 0.9222 6 37
7pzy-assembly1.cif.gz_AQ structure of the vacant candida albicans 80s ribosome 0.9163 6 34
7zs5-assembly1.cif.gz_BB structure of 60s ribosomal subunit from s. cerevisiae with eif6 and trna 0.9117 6 36
4v8p-assembly2.cif.gz_CY t.thermophila 60s ribosomal subunit in complex with initiation factor 6. 0.9107 6 37
ID Description Score Start End Superfamily
af_Q8IJU4_13_189_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.9255 25 37 3.40.1000.30
af_D4AAZ6_2_72_2.20.25.30 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9132 6 34 2.20.25.30
4a17Y00 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9107 6 37 2.20.25.30
1k8a100 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.853 8 34 2.20.25.30
af_C6SXD2_1_92_2.20.25.30 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8449 6 34 2.20.25.30
ID Description Score Start End GO Terms
AF-A0A7C4GSZ0-F1-model_v4 Uncharacterized protein 0.9675 7 37
AF-A0A087KKQ3-F1-model_v4 Transposase zinc-ribbon domain-containing protein 0.9331 9 36
AF-A0A811UJ77-F1-model_v4 (Mediterranean fruit fly) hypothetical protein 0.9296 6 37 GO:0003735
GO:0005840
GO:0006412
GO:0016020
GO:1990904
AF-A0A538AP44-F1-model_v4 Insertion element protein 0.9247 9 38
AF-A0A1G8W5N3-F1-model_v4 Transposase zinc-ribbon domain-containing protein 0.9036 6 36

Feature Viewer

pLDDT pTM Quality
72.56 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map