F439169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 417 | 244 | 417 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_1091073|Ga0501070_1091073_101_364 |
| Length | 87 |
| Sequence | LLKFHKGETLSASGEETTKTGPDCPSCGEPWLRGTNLPGRYRCVYCLHRFELRSECPNCGAHSTIARMSDTANVVCRNCGGSMLQAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 165 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 166 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 168 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 173 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 174 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 231 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 234 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 242 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 1.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.68 |
| Nodule | 0 |
| Rhizoplane | 9.35 |
| Rhizosphere | 87.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10081084 | 3300001990 | Bacteria | 965 |
| 2 | JGI24743J22301_10004425 | 3300001991 | Bacteria | 2291 |
| 3 | JGI24745J21846_1027597 | 3300002073 | Bacteria | 679 |
| 4 | JGI24749J21850_1070274 | 3300002076 | Bacteria | 540 |
| 5 | JGI25407J50210_10089020 | 3300003373 | Bacteria | 764 |
| 6 | JGI25407J50210_10095049 | 3300003373 | Bacteria | 737 |
| 7 | Ga0070658_11944093 | 3300005327 | Bacteria | 508 |
| 8 | Ga0070683_100002001 | 3300005329 | Bacteria | 15985 |
| 9 | Ga0070683_100045287 | 3300005329 | Bacteria | 4060 |
| 10 | Ga0070683_100089361 | 3300005329 | Bacteria | 2891 |
| 11 | Ga0070683_100124864 | 3300005329 | Bacteria | 2433 |
| 12 | Ga0070683_101276413 | 3300005329 | Bacteria | 706 |
| 13 | Ga0070690_100203560 | 3300005330 | Bacteria | 1379 |
| 14 | Ga0070670_100290426 | 3300005331 | Bacteria | 1429 |
| 15 | Ga0068869_100354583 | 3300005334 | Bacteria | 1196 |
| 16 | Ga0070680_100000851 | 3300005336 | Bacteria | 21636 |
| 17 | Ga0070680_100459263 | 3300005336 | Bacteria | 1088 |
| 18 | Ga0070680_100820111 | 3300005336 | Bacteria | 802 |
| 19 | Ga0070682_100065405 | 3300005337 | Bacteria | 2310 |
| 20 | Ga0070682_100219751 | 3300005337 | Bacteria | 1352 |
| 21 | Ga0070682_101811610 | 3300005337 | Bacteria | 533 |
| 22 | Ga0068868_100047076 | 3300005338 | Bacteria | 3377 |
| 23 | Ga0070660_100038964 | 3300005339 | Bacteria | 3611 |
| 24 | Ga0070660_100133590 | 3300005339 | Bacteria | 1987 |
| 25 | Ga0070660_100443373 | 3300005339 | Bacteria | 1077 |
| 26 | Ga0070689_100283215 | 3300005340 | Bacteria | 1375 |
| 27 | Ga0070661_100029904 | 3300005344 | Bacteria | 3934 |
| 28 | Ga0070661_100253833 | 3300005344 | Bacteria | 1358 |
| 29 | Ga0070661_101319218 | 3300005344 | Bacteria | 606 |
| 30 | Ga0070692_10028370 | 3300005345 | Unclassified | 2781 |
| 31 | Ga0070669_100867871 | 3300005353 | Bacteria | 770 |
| 32 | Ga0070675_100083284 | 3300005354 | Bacteria | 2670 |
| 33 | Ga0070671_100689119 | 3300005355 | Bacteria | 886 |
| 34 | Ga0070671_101371284 | 3300005355 | Unclassified | 624 |
| 35 | Ga0070673_100843481 | 3300005364 | Bacteria | 848 |
| 36 | Ga0070659_100010365 | 3300005366 | Bacteria | 6853 |
| 37 | Ga0070659_100715112 | 3300005366 | Bacteria | 867 |
| 38 | Ga0070659_101494446 | 3300005366 | Unclassified | 602 |
| 39 | Ga0070709_11285282 | 3300005434 | Bacteria | 590 |
| 40 | Ga0070709_11311794 | 3300005434 | Bacteria | 584 |
| 41 | Ga0070714_100194584 | 3300005435 | Bacteria | 1852 |
| 42 | Ga0070714_100369027 | 3300005435 | Bacteria | 1351 |
| 43 | Ga0070714_100654206 | 3300005435 | Bacteria | 1012 |
| 44 | Ga0070714_102165455 | 3300005435 | Bacteria | 542 |
| 45 | Ga0070713_102367675 | 3300005436 | Bacteria | 514 |
| 46 | Ga0070710_10045510 | 3300005437 | Bacteria | 2440 |
| 47 | Ga0070710_10234598 | 3300005437 | Bacteria | 1173 |
| 48 | Ga0070710_10462689 | 3300005437 | Bacteria | 862 |
| 49 | Ga0070710_10482312 | 3300005437 | Bacteria | 846 |
| 50 | Ga0070701_10016821 | 3300005438 | Bacteria | 3407 |
| 51 | Ga0070711_100000559 | 3300005439 | Bacteria | 19456 |
| 52 | Ga0070711_100054930 | 3300005439 | Bacteria | 2750 |
| 53 | Ga0070711_100126614 | 3300005439 | Bacteria | 1897 |
| 54 | Ga0070711_100256142 | 3300005439 | Bacteria | 1375 |
| 55 | Ga0070711_100348723 | 3300005439 | Bacteria | 1190 |
| 56 | Ga0070711_101220909 | 3300005439 | Bacteria | 651 |
| 57 | Ga0070705_100064714 | 3300005440 | Bacteria | 2186 |
| 58 | Ga0070700_100076202 | 3300005441 | Bacteria | 2153 |
| 59 | Ga0070700_100873277 | 3300005441 | Bacteria | 730 |
| 60 | Ga0070694_100813525 | 3300005444 | Bacteria | 767 |
| 61 | Ga0070663_100193833 | 3300005455 | Bacteria | 1583 |
| 62 | Ga0070678_100511666 | 3300005456 | Bacteria | 1061 |
| 63 | Ga0070678_101057523 | 3300005456 | Bacteria | 748 |
| 64 | Ga0070681_10019390 | 3300005458 | Bacteria | 6806 |
| 65 | Ga0070681_10195313 | 3300005458 | Bacteria | 1943 |
| 66 | Ga0070681_10803032 | 3300005458 | Bacteria | 858 |
| 67 | Ga0068867_100071776 | 3300005459 | Bacteria | 2590 |
| 68 | Ga0070685_10231922 | 3300005466 | Bacteria | 1215 |
| 69 | Ga0070706_102042126 | 3300005467 | Bacteria | 519 |
| 70 | Ga0070679_100004554 | 3300005530 | Bacteria | 12798 |
| 71 | Ga0070679_100334393 | 3300005530 | Unclassified | 1463 |
| 72 | Ga0070679_100557504 | 3300005530 | Bacteria | 1089 |
| 73 | Ga0070684_100020205 | 3300005535 | Bacteria | 5525 |
| 74 | Ga0070684_100175658 | 3300005535 | Bacteria | 1947 |
| 75 | Ga0070684_100531909 | 3300005535 | Bacteria | 1090 |
| 76 | Ga0070684_101472306 | 3300005535 | Bacteria | 641 |
| 77 | Ga0068853_100056122 | 3300005539 | Bacteria | 3396 |
| 78 | Ga0068853_101646386 | 3300005539 | Bacteria | 622 |
| 79 | Ga0070686_100079761 | 3300005544 | Bacteria | 2164 |
| 80 | Ga0070693_100337315 | 3300005547 | Bacteria | 1028 |
| 81 | Ga0070704_100486954 | 3300005549 | Bacteria | 1068 |
| 82 | Ga0070664_100288217 | 3300005564 | Bacteria | 1482 |
| 83 | Ga0070664_101121085 | 3300005564 | Bacteria | 741 |
| 84 | Ga0068857_100126484 | 3300005577 | Unclassified | 2303 |
| 85 | Ga0068857_100874500 | 3300005577 | Bacteria | 861 |
| 86 | Ga0068854_100149559 | 3300005578 | Bacteria | 1799 |
| 87 | Ga0068854_100153738 | 3300005578 | Unclassified | 1776 |
| 88 | Ga0068856_100116126 | 3300005614 | Unclassified | 2677 |
| 89 | Ga0068856_100168149 | 3300005614 | Bacteria | 2204 |
| 90 | Ga0068856_100973595 | 3300005614 | Bacteria | 867 |
| 91 | Ga0068852_100007442 | 3300005616 | Bacteria | 7993 |
| 92 | Ga0068852_100105917 | 3300005616 | Bacteria | 2548 |
| 93 | Ga0068859_100096276 | 3300005617 | Bacteria | 3012 |
| 94 | Ga0068864_100299982 | 3300005618 | Bacteria | 1504 |
| 95 | Ga0068861_100474352 | 3300005719 | Bacteria | 1126 |
| 96 | Ga0068861_100805246 | 3300005719 | Bacteria | 882 |
| 97 | Ga0068851_10255791 | 3300005834 | Bacteria | 995 |
| 98 | Ga0068870_10014173 | 3300005840 | Bacteria | 3760 |
| 99 | Ga0068858_100451759 | 3300005842 | Bacteria | 1238 |
| 100 | Ga0068860_100549826 | 3300005843 | Bacteria | 1156 |
| 101 | Ga0081538_10000686 | 3300005981 | Bacteria | 37157 |
| 102 | Ga0081538_10000796 | 3300005981 | Bacteria | 34251 |
| 103 | Ga0081538_10001548 | 3300005981 | Bacteria | 23571 |
| 104 | Ga0081538_10263093 | 3300005981 | Bacteria | 650 |
| 105 | Ga0070717_10078150 | 3300006028 | Bacteria | 2772 |
| 106 | Ga0070717_12012158 | 3300006028 | Bacteria | 520 |
| 107 | Ga0075365_10212324 | 3300006038 | Bacteria | 1357 |
| 108 | Ga0075365_11303800 | 3300006038 | Bacteria | 510 |
| 109 | Ga0070715_11096972 | 3300006163 | Bacteria | 501 |
| 110 | Ga0070716_100035787 | 3300006173 | Bacteria | 2732 |
| 111 | Ga0070716_100247399 | 3300006173 | Bacteria | 1213 |
| 112 | Ga0070716_100296340 | 3300006173 | Bacteria | 1123 |
| 113 | Ga0070716_100487144 | 3300006173 | Bacteria | 907 |
| 114 | Ga0070712_100112281 | 3300006175 | Bacteria | 2036 |
| 115 | Ga0070712_100138418 | 3300006175 | Bacteria | 1854 |
| 116 | Ga0070712_100139301 | 3300006175 | Bacteria | 1849 |
| 117 | Ga0070712_100617640 | 3300006175 | Bacteria | 919 |
| 118 | Ga0075367_10649340 | 3300006178 | Bacteria | 671 |
| 119 | Ga0068871_100619176 | 3300006358 | Bacteria | 986 |
| 120 | Ga0075431_100013418 | 3300006847 | Bacteria | 8277 |
| 121 | Ga0075433_10067795 | 3300006852 | Bacteria | 3131 |
| 122 | Ga0075433_10743370 | 3300006852 | Bacteria | 858 |
| 123 | Ga0075433_11446382 | 3300006852 | Bacteria | 594 |
| 124 | Ga0075434_100207024 | 3300006871 | Bacteria | 1982 |
| 125 | Ga0075434_100254885 | 3300006871 | Bacteria | 1773 |
| 126 | Ga0075434_100568027 | 3300006871 | Bacteria | 1154 |
| 127 | Ga0075429_101034767 | 3300006880 | Bacteria | 718 |
| 128 | Ga0068865_100223118 | 3300006881 | Bacteria | 1474 |
| 129 | Ga0075436_100199004 | 3300006914 | Bacteria | 1419 |
| 130 | Ga0097620_100096279 | 3300006931 | Bacteria | 3012 |
| 131 | Ga0075435_100028663 | 3300007076 | Bacteria | 4367 |
| 132 | Ga0099794_10643183 | 3300007265 | Bacteria | 563 |
| 133 | Ga0105240_10058465 | 3300009093 | Bacteria | 4813 |
| 134 | Ga0111539_10311544 | 3300009094 | Bacteria | 1832 |
| 135 | Ga0105245_10045363 | 3300009098 | Bacteria | 3926 |
| 136 | Ga0105245_12678610 | 3300009098 | Bacteria | 552 |
| 137 | Ga0105247_10427197 | 3300009101 | Bacteria | 950 |
| 138 | Ga0114129_10855171 | 3300009147 | Bacteria | 1156 |
| 139 | Ga0105248_10450278 | 3300009177 | Bacteria | 1451 |
| 140 | Ga0105237_10126131 | 3300009545 | Bacteria | 2554 |
| 141 | Ga0105238_10021833 | 3300009551 | Bacteria | 6520 |
| 142 | Ga0105239_10226306 | 3300010375 | Unclassified | 2098 |
| 143 | Ga0157371_10284879 | 3300013102 | Bacteria | 1194 |
| 144 | Ga0157370_10017809 | 3300013104 | Bacteria | 7158 |
| 145 | Ga0157369_10064451 | 3300013105 | Bacteria | 3946 |
| 146 | Ga0157369_10675022 | 3300013105 | Bacteria | 1065 |
| 147 | Ga0157369_11510627 | 3300013105 | Bacteria | 683 |
| 148 | Ga0157374_10148940 | 3300013296 | Bacteria | 2275 |
| 149 | Ga0157378_10767161 | 3300013297 | Bacteria | 988 |
| 150 | Ga0163162_10700006 | 3300013306 | Bacteria | 1135 |
| 151 | Ga0157372_10469517 | 3300013307 | Bacteria | 1467 |
| 152 | Ga0157372_10714581 | 3300013307 | Bacteria | 1166 |
| 153 | Ga0157372_11746605 | 3300013307 | Bacteria | 716 |
| 154 | Ga0163163_10041285 | 3300014325 | Bacteria | 4510 |
| 155 | Ga0163163_10449990 | 3300014325 | Bacteria | 1348 |
| 156 | Ga0157380_10429789 | 3300014326 | Bacteria | 1262 |
| 157 | Ga0182008_10231485 | 3300014497 | Bacteria | 948 |
| 158 | Ga0157377_11482773 | 3300014745 | Unclassified | 538 |
| 159 | Ga0206356_10446832 | 3300020070 | Bacteria | 2535 |
| 160 | Ga0206356_11625268 | 3300020070 | Bacteria | 507 |
| 161 | Ga0206356_11868250 | 3300020070 | Bacteria | 554 |
| 162 | Ga0206354_11267508 | 3300020081 | Bacteria | 549 |
| 163 | Ga0206353_11609894 | 3300020082 | Bacteria | 2755 |
| 164 | Ga0206353_11619556 | 3300020082 | Bacteria | 4512 |
| 165 | Ga0213876_10005976 | 3300021384 | Bacteria | 6653 |
| 166 | Ga0213876_10480502 | 3300021384 | Bacteria | 661 |
| 167 | Ga0224712_10559569 | 3300022467 | Bacteria | 556 |
| 168 | Ga0207692_10076115 | 3300025898 | Bacteria | 1782 |
| 169 | Ga0207692_10481280 | 3300025898 | Bacteria | 785 |
| 170 | Ga0207688_10041543 | 3300025901 | Bacteria | 2559 |
| 171 | Ga0207680_10380944 | 3300025903 | Bacteria | 994 |
| 172 | Ga0207699_10190428 | 3300025906 | Bacteria | 1384 |
| 173 | Ga0207699_11043209 | 3300025906 | Unclassified | 605 |
| 174 | Ga0207643_10014383 | 3300025908 | Bacteria | 4297 |
| 175 | Ga0207705_10521295 | 3300025909 | Bacteria | 923 |
| 176 | Ga0207705_11378267 | 3300025909 | Bacteria | 537 |
| 177 | Ga0207707_10129810 | 3300025912 | Bacteria | 2204 |
| 178 | Ga0207707_10739715 | 3300025912 | Bacteria | 823 |
| 179 | Ga0207707_10831314 | 3300025912 | Unclassified | 767 |
| 180 | Ga0207695_10050185 | 3300025913 | Bacteria | 4391 |
| 181 | Ga0207671_10069725 | 3300025914 | Bacteria | 2620 |
| 182 | Ga0207693_10033646 | 3300025915 | Bacteria | 4044 |
| 183 | Ga0207693_10119114 | 3300025915 | Bacteria | 2073 |
| 184 | Ga0207693_10125584 | 3300025915 | Bacteria | 2017 |
| 185 | Ga0207693_10310876 | 3300025915 | Bacteria | 1234 |
| 186 | Ga0207693_10553389 | 3300025915 | Bacteria | 897 |
| 187 | Ga0207663_10058666 | 3300025916 | Bacteria | 2430 |
| 188 | Ga0207663_10059253 | 3300025916 | Bacteria | 2421 |
| 189 | Ga0207663_10217763 | 3300025916 | Bacteria | 1387 |
| 190 | Ga0207663_10614694 | 3300025916 | Bacteria | 855 |
| 191 | Ga0207663_10732873 | 3300025916 | Bacteria | 784 |
| 192 | Ga0207660_10308793 | 3300025917 | Bacteria | 1261 |
| 193 | Ga0207660_10994313 | 3300025917 | Bacteria | 684 |
| 194 | Ga0207660_11158502 | 3300025917 | Bacteria | 629 |
| 195 | Ga0207660_11340763 | 3300025917 | Bacteria | 580 |
| 196 | Ga0207657_10041030 | 3300025919 | Bacteria | 4095 |
| 197 | Ga0207657_10049094 | 3300025919 | Bacteria | 3680 |
| 198 | Ga0207649_10316377 | 3300025920 | Bacteria | 1145 |
| 199 | Ga0207649_10373456 | 3300025920 | Bacteria | 1061 |
| 200 | Ga0207652_10113740 | 3300025921 | Bacteria | 2402 |
| 201 | Ga0207652_10288221 | 3300025921 | Unclassified | 1481 |
| 202 | Ga0207652_10698489 | 3300025921 | Unclassified | 905 |
| 203 | Ga0207650_10134938 | 3300025925 | Bacteria | 1935 |
| 204 | Ga0207659_10040429 | 3300025926 | Bacteria | 3261 |
| 205 | Ga0207687_10280840 | 3300025927 | Bacteria | 1334 |
| 206 | Ga0207700_10684388 | 3300025928 | Bacteria | 915 |
| 207 | Ga0207700_11329168 | 3300025928 | Bacteria | 640 |
| 208 | Ga0207664_10035449 | 3300025929 | Bacteria | 3850 |
| 209 | Ga0207664_10456928 | 3300025929 | Bacteria | 1140 |
| 210 | Ga0207664_10887788 | 3300025929 | Bacteria | 801 |
| 211 | Ga0207664_11273469 | 3300025929 | Bacteria | 654 |
| 212 | Ga0207644_10510502 | 3300025931 | Bacteria | 992 |
| 213 | Ga0207709_10563421 | 3300025935 | Bacteria | 898 |
| 214 | Ga0207669_10292273 | 3300025937 | Bacteria | 1234 |
| 215 | Ga0207704_10028448 | 3300025938 | Bacteria | 3101 |
| 216 | Ga0207704_11678975 | 3300025938 | Bacteria | 546 |
| 217 | Ga0207665_10279725 | 3300025939 | Bacteria | 1241 |
| 218 | Ga0207665_10551251 | 3300025939 | Bacteria | 896 |
| 219 | Ga0207691_10448815 | 3300025940 | Bacteria | 1098 |
| 220 | Ga0207711_10257185 | 3300025941 | Bacteria | 1604 |
| 221 | Ga0207661_10004877 | 3300025944 | Bacteria | 9402 |
| 222 | Ga0207661_10016432 | 3300025944 | Bacteria | 5460 |
| 223 | Ga0207661_10248670 | 3300025944 | Bacteria | 1580 |
| 224 | Ga0207679_10371750 | 3300025945 | Bacteria | 1251 |
| 225 | Ga0207667_11607330 | 3300025949 | Bacteria | 618 |
| 226 | Ga0207651_10651737 | 3300025960 | Bacteria | 924 |
| 227 | Ga0207668_10422120 | 3300025972 | Bacteria | 1132 |
| 228 | Ga0207658_10192104 | 3300025986 | Bacteria | 1698 |
| 229 | Ga0207677_10190609 | 3300026023 | Bacteria | 1621 |
| 230 | Ga0207703_10588960 | 3300026035 | Bacteria | 1051 |
| 231 | Ga0207639_10285498 | 3300026041 | Bacteria | 1453 |
| 232 | Ga0207678_10073789 | 3300026067 | Bacteria | 2924 |
| 233 | Ga0207708_10065923 | 3300026075 | Bacteria | 2768 |
| 234 | Ga0207702_10295619 | 3300026078 | Unclassified | 1535 |
| 235 | Ga0207702_10770471 | 3300026078 | Bacteria | 950 |
| 236 | Ga0207702_11453324 | 3300026078 | Bacteria | 679 |
| 237 | Ga0207641_12133801 | 3300026088 | Bacteria | 561 |
| 238 | Ga0207676_10342118 | 3300026095 | Bacteria | 1380 |
| 239 | Ga0207674_10223913 | 3300026116 | Bacteria | 1829 |
| 240 | Ga0207674_10359153 | 3300026116 | Bacteria | 1408 |
| 241 | Ga0207675_100564134 | 3300026118 | Bacteria | 1139 |
| 242 | Ga0207698_10919787 | 3300026142 | Bacteria | 882 |
| 243 | Ga0207698_12539305 | 3300026142 | Unclassified | 522 |
| 244 | Ga0207428_10026260 | 3300027907 | Bacteria | 4862 |
| 245 | Ga0207428_10243867 | 3300027907 | Bacteria | 1342 |
| 246 | Ga0268264_10026624 | 3300028381 | Bacteria | 4726 |
| 247 | Ga0265319_1000118 | 3300028563 | Bacteria | 60393 |
| 248 | Ga0265338_10779091 | 3300028800 | Bacteria | 656 |
| 249 | Ga0265330_10106191 | 3300031235 | Bacteria | 1201 |
| 250 | Ga0265320_10038599 | 3300031240 | Bacteria | 2394 |
| 251 | Ga0307408_100056853 | 3300031548 | Bacteria | 2838 |
| 252 | Ga0307413_10201145 | 3300031824 | Bacteria | 1439 |
| 253 | Ga0307410_11639049 | 3300031852 | Bacteria | 569 |
| 254 | Ga0326468_10043548 | 3300031889 | Bacteria | 652 |
| 255 | Ga0307406_10849708 | 3300031901 | Bacteria | 774 |
| 256 | Ga0307412_10931582 | 3300031911 | Bacteria | 763 |
| 257 | Ga0307409_100171784 | 3300031995 | Bacteria | 1909 |
| 258 | Ga0307409_100847132 | 3300031995 | Bacteria | 925 |
| 259 | Ga0307409_101142661 | 3300031995 | Bacteria | 801 |
| 260 | Ga0307416_100288956 | 3300032002 | Bacteria | 1622 |
| 261 | Ga0307416_100738820 | 3300032002 | Bacteria | 1076 |
| 262 | Ga0307414_10702449 | 3300032004 | Bacteria | 916 |
| 263 | Ga0307414_11518719 | 3300032004 | Bacteria | 623 |
| 264 | Ga0307415_100222771 | 3300032126 | Bacteria | 1513 |
| 265 | Ga0307415_101479481 | 3300032126 | Bacteria | 649 |
| 266 | Ga0307415_101548863 | 3300032126 | Bacteria | 635 |
| 267 | Ga0373927_0687801 | 3300035695 | Bacteria | 676 |
| 268 | Ga0373947_0766028 | 3300035725 | Bacteria | 659 |
| 269 | Ga0373937_0044127 | 3300036401 | Bacteria | 4071 |
| 270 | Ga0395898_1595002 | 3300037466 | Bacteria | 577 |
| 271 | Ga0436364_0321095 | 3300037853 | Bacteria | 900 |
| 272 | Ga0436365_0332865 | 3300039437 | Bacteria | 12161 |
| 273 | Ga0436365_1008073 | 3300039437 | Bacteria | 1114 |
| 274 | Ga0436363_0976284 | 3300039450 | Bacteria | 583 |
| 275 | Ga0436363_1715688 | 3300039450 | Bacteria | 717 |
| 276 | Ga0436362_1139331 | 3300039453 | Bacteria | 637 |
| 277 | Ga0451795_1013088 | 3300041456 | Bacteria | 867 |
| 278 | Ga0451800_1032958 | 3300041459 | Bacteria | 508 |
| 279 | Ga0466965_0393414 | 3300044683 | Bacteria | 765 |
| 280 | Ga0466966_0343809 | 3300044684 | Bacteria | 896 |
| 281 | Ga0466966_0380890 | 3300044684 | Unclassified | 848 |
| 282 | Ga0466966_0525101 | 3300044684 | Bacteria | 712 |
| 283 | Ga0466961_0522914 | 3300044693 | Bacteria | 716 |
| 284 | Ga0466963_0111283 | 3300044694 | Bacteria | 1880 |
| 285 | Ga0466963_0145613 | 3300044694 | Bacteria | 1643 |
| 286 | Ga0466963_0589111 | 3300044694 | Bacteria | 785 |
| 287 | Ga0466964_0233098 | 3300044706 | Bacteria | 899 |
| 288 | Ga0466964_0880717 | 3300044706 | Bacteria | 511 |
| 289 | Ga0466971_0137926 | 3300044719 | Bacteria | 1135 |
| 290 | Ga0466971_0535408 | 3300044719 | Bacteria | 580 |
| 291 | Ga0466968_0013067 | 3300044735 | Bacteria | 3259 |
| 292 | Ga0466957_0055567 | 3300044842 | Bacteria | 2420 |
| 293 | Ga0466957_0083399 | 3300044842 | Bacteria | 1994 |
| 294 | Ga0466957_0162976 | 3300044842 | Bacteria | 1449 |
| 295 | Ga0466957_0804773 | 3300044842 | Bacteria | 668 |
| 296 | Ga0466960_0034840 | 3300044901 | Bacteria | 2349 |
| 297 | Ga0466960_0448892 | 3300044901 | Bacteria | 749 |
| 298 | Ga0466959_0599733 | 3300045049 | Bacteria | 741 |
| 299 | Ga0466959_0691188 | 3300045049 | Bacteria | 684 |
| 300 | Ga0466958_0104610 | 3300045836 | Bacteria | 1763 |
| 301 | Ga0466958_0257573 | 3300045836 | Unclassified | 1116 |
| 302 | Ga0466958_0711155 | 3300045836 | Bacteria | 654 |
| 303 | Ga0466958_0728246 | 3300045836 | Bacteria | 646 |
| 304 | Ga0466958_0868639 | 3300045836 | Bacteria | 588 |
| 305 | Ga0466967_0032439 | 3300045976 | Bacteria | 4411 |
| 306 | Ga0466967_0058619 | 3300045976 | Bacteria | 3404 |
| 307 | Ga0466967_0087771 | 3300045976 | Bacteria | 2821 |
| 308 | Ga0466967_0222522 | 3300045976 | Bacteria | 1794 |
| 309 | Ga0466967_0368985 | 3300045976 | Bacteria | 1392 |
| 310 | Ga0466967_0451723 | 3300045976 | Bacteria | 1256 |
| 311 | Ga0466967_1276725 | 3300045976 | Bacteria | 731 |
| 312 | Ga0466967_1395152 | 3300045976 | Bacteria | 698 |
| 313 | Ga0466967_2389265 | 3300045976 | Bacteria | 524 |
| 314 | Ga0466967_2566481 | 3300045976 | Bacteria | 504 |
| 315 | Ga0495592_0155461 | 3300046454 | Bacteria | 1578 |
| 316 | Ga0495603_0773432 | 3300046455 | Bacteria | 548 |
| 317 | Ga0495653_0001520 | 3300046463 | Bacteria | 18130 |
| 318 | Ga0495653_0193338 | 3300046463 | Bacteria | 1386 |
| 319 | Ga0495653_0385618 | 3300046463 | Bacteria | 894 |
| 320 | Ga0495664_0000025 | 3300046477 | Bacteria | 120941 |
| 321 | Ga0495608_0030576 | 3300046511 | Bacteria | 3645 |
| 322 | Ga0495608_0065050 | 3300046511 | Bacteria | 2389 |
| 323 | Ga0495618_0272343 | 3300046514 | Bacteria | 1058 |
| 324 | Ga0495628_0035424 | 3300046516 | Bacteria | 4011 |
| 325 | Ga0495630_0000440 | 3300046517 | Bacteria | 31661 |
| 326 | Ga0495630_0424924 | 3300046517 | Bacteria | 1018 |
| 327 | Ga0495630_0452476 | 3300046517 | Bacteria | 984 |
| 328 | Ga0495652_0088765 | 3300046529 | Bacteria | 2533 |
| 329 | Ga0495652_0133682 | 3300046529 | Bacteria | 1960 |
| 330 | Ga0495665_0210128 | 3300046531 | Bacteria | 1008 |
| 331 | Ga0495640_0025372 | 3300046533 | Bacteria | 4301 |
| 332 | Ga0495587_0029604 | 3300046536 | Bacteria | 3324 |
| 333 | Ga0495661_0299781 | 3300046665 | Bacteria | 805 |
| 334 | Ga0495657_0000017 | 3300046675 | Bacteria | 174558 |
| 335 | Ga0495623_0035669 | 3300046679 | Bacteria | 3188 |
| 336 | Ga0495646_0162488 | 3300046680 | Bacteria | 1235 |
| 337 | Ga0495600_0007859 | 3300046809 | Bacteria | 6531 |
| 338 | Ga0495604_0000063 | 3300047317 | Bacteria | 92821 |
| 339 | Ga0495604_0026854 | 3300047317 | Bacteria | 4582 |
| 340 | Ga0495604_0212774 | 3300047317 | Bacteria | 1335 |
| 341 | Ga0495674_0080436 | 3300047319 | Bacteria | 2796 |
| 342 | Ga0495676_0279915 | 3300047321 | Bacteria | 1130 |
| 343 | Ga0495684_0031055 | 3300047471 | Bacteria | 4101 |
| 344 | Ga0496100_0177281 | 3300048903 | Bacteria | 1539 |
| 345 | Ga0496100_0444110 | 3300048903 | Bacteria | 994 |
| 346 | Ga0496100_1109256 | 3300048903 | Bacteria | 624 |
| 347 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 348 | Ga0496102_0172539 | 3300048905 | Unclassified | 2036 |
| 349 | Ga0496102_0253727 | 3300048905 | Bacteria | 1658 |
| 350 | Ga0496102_0674265 | 3300048905 | Bacteria | 957 |
| 351 | Ga0496102_1646793 | 3300048905 | Bacteria | 560 |
| 352 | Ga0496103_0000047 | 3300048906 | Bacteria | 161130 |
| 353 | Ga0496103_0175082 | 3300048906 | Bacteria | 1378 |
| 354 | Ga0496104_0967511 | 3300048907 | Bacteria | 755 |
| 355 | Ga0496104_1041375 | 3300048907 | Bacteria | 722 |
| 356 | Ga0496105_0005677 | 3300048908 | Bacteria | 9495 |
| 357 | Ga0496105_0123090 | 3300048908 | Bacteria | 2138 |
| 358 | Ga0496106_0185946 | 3300048909 | Bacteria | 1650 |
| 359 | Ga0496106_1393112 | 3300048909 | Bacteria | 542 |
| 360 | Ga0496106_1477429 | 3300048909 | Bacteria | 523 |
| 361 | Ga0496107_0198896 | 3300048910 | Bacteria | 1489 |
| 362 | Ga0496107_0584465 | 3300048910 | Bacteria | 826 |
| 363 | Ga0496107_0602475 | 3300048910 | Bacteria | 812 |
| 364 | Ga0496108_0160513 | 3300048911 | Bacteria | 1942 |
| 365 | Ga0496108_0504920 | 3300048911 | Bacteria | 1056 |
| 366 | Ga0496108_0645877 | 3300048911 | Bacteria | 920 |
| 367 | Ga0496110_0060308 | 3300048913 | Bacteria | 3345 |
| 368 | Ga0496110_0063284 | 3300048913 | Bacteria | 3268 |
| 369 | Ga0496111_0098190 | 3300048914 | Bacteria | 2150 |
| 370 | Ga0496112_0110443 | 3300048915 | Bacteria | 2720 |
| 371 | Ga0496112_0316059 | 3300048915 | Bacteria | 1506 |
| 372 | Ga0496112_0600785 | 3300048915 | Bacteria | 1032 |
| 373 | Ga0496113_0033872 | 3300048916 | Bacteria | 3723 |
| 374 | Ga0496113_0067862 | 3300048916 | Bacteria | 2705 |
| 375 | Ga0496113_0155318 | 3300048916 | Bacteria | 1807 |
| 376 | Ga0496113_0269341 | 3300048916 | Bacteria | 1361 |
| 377 | Ga0496114_0257963 | 3300048917 | Bacteria | 1534 |
| 378 | Ga0496114_1443833 | 3300048917 | Bacteria | 575 |
| 379 | Ga0496115_0000017 | 3300048918 | Bacteria | 185702 |
| 380 | Ga0496115_0273784 | 3300048918 | Bacteria | 1387 |
| 381 | Ga0496121_0004160 | 3300048924 | Bacteria | 19786 |
| 382 | Ga0501031_0373009 | 3300049568 | Bacteria | 923 |
| 383 | Ga0501036_0061175 | 3300049572 | Bacteria | 3190 |
| 384 | Ga0501037_0783830 | 3300049573 | Bacteria | 630 |
| 385 | Ga0501040_0073270 | 3300049576 | Bacteria | 2366 |
| 386 | Ga0501040_0719526 | 3300049576 | Bacteria | 722 |
| 387 | Ga0501042_0471159 | 3300049578 | Bacteria | 911 |
| 388 | Ga0501048_0162490 | 3300049582 | Bacteria | 1581 |
| 389 | Ga0501048_1374513 | 3300049582 | Bacteria | 508 |
| 390 | Ga0501067_0868044 | 3300049583 | Bacteria | 509 |
| 391 | Ga0501068_0159854 | 3300049584 | Bacteria | 1420 |
| 392 | Ga0501069_0181398 | 3300049585 | Bacteria | 1217 |
| 393 | Ga0501070_0624974 | 3300049586 | Bacteria | 857 |
| 394 | Ga0501070_1091073 | 3300049586 | Bacteria | 616 |
| 395 | Ga0501071_0179415 | 3300049587 | Bacteria | 1587 |
| 396 | Ga0501072_0599310 | 3300049588 | Bacteria | 869 |
| 397 | Ga0501074_0039056 | 3300049590 | Bacteria | 3438 |
| 398 | Ga0501076_0957631 | 3300049592 | Bacteria | 705 |
| 399 | Ga0501245_149486 | 3300049708 | Bacteria | 515 |
| 400 | Ga0501079_0067711 | 3300049741 | Bacteria | 2756 |
| 401 | Ga0501079_0195452 | 3300049741 | Bacteria | 1579 |
| 402 | Ga0501045_0017972 | 3300049824 | Bacteria | 5022 |
| 403 | nmdc:mga0yw44_1217697_c1 | 3300050492 | Bacteria | 508 |
| 404 | nmdc:mga0yw44_644390_c1 | 3300050492 | Bacteria | 720 |
| 405 | nmdc:mga06z11_834610_c1 | 3300050494 | Bacteria | 561 |
| 406 | nmdc:mga09592_401740_c1 | 3300050508 | Bacteria | 1184 |
| 407 | nmdc:mga08y16_71613_c1 | 3300050511 | Bacteria | 3612 |
| 408 | nmdc:mga0n895_832764_c1 | 3300050512 | Bacteria | 911 |
| 409 | nmdc:mga0n895_962092_c1 | 3300050512 | Bacteria | 837 |
| 410 | Ga0495601_0089725 | 3300053077 | Bacteria | 1977 |
| 411 | Ga0495612_0114726 | 3300053078 | Bacteria | 1156 |
| 412 | Ga0495595_0248184 | 3300053084 | Bacteria | 891 |
| 413 | Ga0500614_081961 | 3300053123 | Bacteria | 904 |
| 414 | Ga0587071_175907 | 3300060344 | Bacteria | 547 |
| 415 | Ga0501082_0539927 | 3300060353 | Bacteria | 1020 |
| 416 | Ga0466962_0274046 | 3300061719 | Bacteria | 832 |
| 417 | Ga0466962_0303174 | 3300061719 | Bacteria | 790 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006178 | Ga0075367_10649340 | Ga0075367_106493402 | 59 |
| 2 | 3300014325 | Ga0163163_10449990 | Ga0163163_104499902 | 63 |
| 3 | 3300045049 | Ga0466959_0599733 | Ga0466959_0599733_115_327 | 63 |
| 4 | 3300013297 | Ga0157378_10767161 | Ga0157378_107671612 | 64 |
| 5 | 3300045976 | Ga0466967_1395152 | Ga0466967_1395152_138_383 | 64 |
| 6 | 3300048918 | Ga0496115_0000017 | Ga0496115_0000017_42111_42359 | 64 |
| 7 | 3300005434 | Ga0070709_11311794 | Ga0070709_113117942 | 65 |
| 8 | 3300005435 | Ga0070714_100369027 | Ga0070714_1003690272 | 65 |
| 9 | 3300005439 | Ga0070711_100054930 | Ga0070711_1000549303 | 65 |
| 10 | 3300006173 | Ga0070716_100035787 | Ga0070716_1000357872 | 65 |
| 11 | 3300020070 | Ga0206356_11625268 | Ga0206356_116252682 | 65 |
| 12 | 3300025906 | Ga0207699_10190428 | Ga0207699_101904282 | 65 |
| 13 | 3300025916 | Ga0207663_10058666 | Ga0207663_100586663 | 65 |
| 14 | 3300025929 | Ga0207664_10887788 | Ga0207664_108877882 | 65 |
| 15 | 3300039450 | Ga0436363_1715688 | Ga0436363_1715688_37_264 | 65 |
| 16 | 3300044693 | Ga0466961_0522914 | Ga0466961_0522914_349_576 | 65 |
| 17 | 3300044694 | Ga0466963_0111283 | Ga0466963_0111283_1433_1660 | 65 |
| 18 | 3300044694 | Ga0466963_0145613 | Ga0466963_0145613_921_1172 | 65 |
| 19 | 3300044706 | Ga0466964_0880717 | Ga0466964_0880717_33_284 | 65 |
| 20 | 3300044719 | Ga0466971_0137926 | Ga0466971_0137926_326_553 | 65 |
| 21 | 3300044719 | Ga0466971_0535408 | Ga0466971_0535408_147_374 | 65 |
| 22 | 3300044735 | Ga0466968_0013067 | Ga0466968_0013067_2599_2826 | 65 |
| 23 | 3300044842 | Ga0466957_0162976 | Ga0466957_0162976_1168_1419 | 65 |
| 24 | 3300044842 | Ga0466957_0804773 | Ga0466957_0804773_39_266 | 65 |
| 25 | 3300045049 | Ga0466959_0691188 | Ga0466959_0691188_35_262 | 65 |
| 26 | 3300045836 | Ga0466958_0257573 | Ga0466958_0257573_133_360 | 65 |
| 27 | 3300045836 | Ga0466958_0711155 | Ga0466958_0711155_311_562 | 65 |
| 28 | 3300045836 | Ga0466958_0868639 | Ga0466958_0868639_37_264 | 65 |
| 29 | 3300045976 | Ga0466967_0368985 | Ga0466967_0368985_132_359 | 65 |
| 30 | 3300045976 | Ga0466967_0451723 | Ga0466967_0451723_962_1189 | 65 |
| 31 | 3300048905 | Ga0496102_1646793 | Ga0496102_1646793_38_253 | 65 |
| 32 | 3300048916 | Ga0496113_0269341 | Ga0496113_0269341_67_294 | 65 |
| 33 | 3300050494 | nmdc:mga06z11_834610_c1 | nmdc:mga06z11_834610_c1_70_306 | 65 |
| 34 | 3300061719 | Ga0466962_0274046 | Ga0466962_0274046_411_638 | 65 |
| 35 | 3300005456 | Ga0070678_101057523 | Ga0070678_1010575232 | 66 |
| 36 | 3300006038 | Ga0075365_11303800 | Ga0075365_113038002 | 66 |
| 37 | 3300007265 | Ga0099794_10643183 | Ga0099794_106431831 | 66 |
| 38 | 3300025916 | Ga0207663_10059253 | Ga0207663_100592532 | 66 |
| 39 | 3300035725 | Ga0373947_0766028 | Ga0373947_0766028_119_361 | 66 |
| 40 | 3300044684 | Ga0466966_0525101 | Ga0466966_0525101_333_560 | 66 |
| 41 | 3300044694 | Ga0466963_0589111 | Ga0466963_0589111_444_680 | 66 |
| 42 | 3300044842 | Ga0466957_0055567 | Ga0466957_0055567_1337_1573 | 66 |
| 43 | 3300045836 | Ga0466958_0104610 | Ga0466958_0104610_469_705 | 66 |
| 44 | 3300045976 | Ga0466967_2389265 | Ga0466967_2389265_83_319 | 66 |
| 45 | 3300050492 | nmdc:mga0yw44_1217697_c1 | nmdc:mga0yw44_1217697_c1_77_307 | 66 |
| 46 | 3300005435 | Ga0070714_100194584 | Ga0070714_1001945842 | 67 |
| 47 | 3300005435 | Ga0070714_100654206 | Ga0070714_1006542062 | 67 |
| 48 | 3300005437 | Ga0070710_10482312 | Ga0070710_104823121 | 67 |
| 49 | 3300005439 | Ga0070711_101220909 | Ga0070711_1012209092 | 67 |
| 50 | 3300005614 | Ga0068856_100973595 | Ga0068856_1009735952 | 67 |
| 51 | 3300006028 | Ga0070717_10078150 | Ga0070717_100781502 | 67 |
| 52 | 3300006028 | Ga0070717_12012158 | Ga0070717_120121582 | 67 |
| 53 | 3300006173 | Ga0070716_100247399 | Ga0070716_1002473992 | 67 |
| 54 | 3300006852 | Ga0075433_10743370 | Ga0075433_107433702 | 67 |
| 55 | 3300006871 | Ga0075434_100568027 | Ga0075434_1005680272 | 67 |
| 56 | 3300013307 | Ga0157372_11746605 | Ga0157372_117466052 | 67 |
| 57 | 3300021384 | Ga0213876_10005976 | Ga0213876_100059763 | 67 |
| 58 | 3300021384 | Ga0213876_10480502 | Ga0213876_104805022 | 67 |
| 59 | 3300025906 | Ga0207699_11043209 | Ga0207699_110432091 | 67 |
| 60 | 3300025928 | Ga0207700_11329168 | Ga0207700_113291682 | 67 |
| 61 | 3300025929 | Ga0207664_10035449 | Ga0207664_100354494 | 67 |
| 62 | 3300025929 | Ga0207664_11273469 | Ga0207664_112734692 | 67 |
| 63 | 3300025939 | Ga0207665_10551251 | Ga0207665_105512512 | 67 |
| 64 | 3300026078 | Ga0207702_11453324 | Ga0207702_114533242 | 67 |
| 65 | 3300031911 | Ga0307412_10931582 | Ga0307412_109315822 | 67 |
| 66 | 3300031995 | Ga0307409_100847132 | Ga0307409_1008471322 | 67 |
| 67 | 3300032002 | Ga0307416_100288956 | Ga0307416_1002889563 | 67 |
| 68 | 3300032004 | Ga0307414_10702449 | Ga0307414_107024492 | 67 |
| 69 | 3300032126 | Ga0307415_100222771 | Ga0307415_1002227712 | 67 |
| 70 | 3300035695 | Ga0373927_0687801 | Ga0373927_0687801_411_647 | 67 |
| 71 | 3300036401 | Ga0373937_0044127 | Ga0373937_0044127_267_503 | 67 |
| 72 | 3300037466 | Ga0395898_1595002 | Ga0395898_1595002_227_463 | 67 |
| 73 | 3300037853 | Ga0436364_0321095 | Ga0436364_0321095_240_467 | 67 |
| 74 | 3300039437 | Ga0436365_0332865 | Ga0436365_0332865_5864_6091 | 67 |
| 75 | 3300039437 | Ga0436365_1008073 | Ga0436365_1008073_617_844 | 67 |
| 76 | 3300039450 | Ga0436363_0976284 | Ga0436363_0976284_115_342 | 67 |
| 77 | 3300039453 | Ga0436362_1139331 | Ga0436362_1139331_247_474 | 67 |
| 78 | 3300044684 | Ga0466966_0380890 | Ga0466966_0380890_268_495 | 67 |
| 79 | 3300046454 | Ga0495592_0155461 | Ga0495592_0155461_1269_1505 | 67 |
| 80 | 3300046463 | Ga0495653_0001520 | Ga0495653_0001520_16916_17164 | 67 |
| 81 | 3300046463 | Ga0495653_0193338 | Ga0495653_0193338_68_304 | 67 |
| 82 | 3300046511 | Ga0495608_0030576 | Ga0495608_0030576_855_1091 | 67 |
| 83 | 3300046514 | Ga0495618_0272343 | Ga0495618_0272343_772_1008 | 67 |
| 84 | 3300046516 | Ga0495628_0035424 | Ga0495628_0035424_797_1033 | 67 |
| 85 | 3300046517 | Ga0495630_0000440 | Ga0495630_0000440_24967_25215 | 67 |
| 86 | 3300046517 | Ga0495630_0424924 | Ga0495630_0424924_97_333 | 67 |
| 87 | 3300046517 | Ga0495630_0452476 | Ga0495630_0452476_78_314 | 67 |
| 88 | 3300046529 | Ga0495652_0133682 | Ga0495652_0133682_306_542 | 67 |
| 89 | 3300046531 | Ga0495665_0210128 | Ga0495665_0210128_705_941 | 67 |
| 90 | 3300046533 | Ga0495640_0025372 | Ga0495640_0025372_3930_4166 | 67 |
| 91 | 3300046536 | Ga0495587_0029604 | Ga0495587_0029604_2967_3203 | 67 |
| 92 | 3300046675 | Ga0495657_0000017 | Ga0495657_0000017_144112_144360 | 67 |
| 93 | 3300046679 | Ga0495623_0035669 | Ga0495623_0035669_2928_3164 | 67 |
| 94 | 3300046680 | Ga0495646_0162488 | Ga0495646_0162488_214_462 | 67 |
| 95 | 3300047317 | Ga0495604_0026854 | Ga0495604_0026854_2929_3165 | 67 |
| 96 | 3300047317 | Ga0495604_0212774 | Ga0495604_0212774_886_1122 | 67 |
| 97 | 3300047319 | Ga0495674_0080436 | Ga0495674_0080436_1067_1303 | 67 |
| 98 | 3300047471 | Ga0495684_0031055 | Ga0495684_0031055_1479_1727 | 67 |
| 99 | 3300048903 | Ga0496100_1109256 | Ga0496100_1109256_242_487 | 67 |
| 100 | 3300048905 | Ga0496102_0674265 | Ga0496102_0674265_589_825 | 67 |
| 101 | 3300048910 | Ga0496107_0602475 | Ga0496107_0602475_408_644 | 67 |
| 102 | 3300048911 | Ga0496108_0645877 | Ga0496108_0645877_450_686 | 67 |
| 103 | 3300048913 | Ga0496110_0060308 | Ga0496110_0060308_2480_2716 | 67 |
| 104 | 3300048916 | Ga0496113_0033872 | Ga0496113_0033872_1949_2185 | 67 |
| 105 | 3300048917 | Ga0496114_1443833 | Ga0496114_1443833_115_351 | 67 |
| 106 | 3300050512 | nmdc:mga0n895_832764_c1 | nmdc:mga0n895_832764_c1_519_764 | 67 |
| 107 | 3300053077 | Ga0495601_0089725 | Ga0495601_0089725_80_316 | 67 |
| 108 | 3300053078 | Ga0495612_0114726 | Ga0495612_0114726_658_894 | 67 |
| 109 | 3300053084 | Ga0495595_0248184 | Ga0495595_0248184_541_789 | 67 |
| 110 | 3300049587 | Ga0501071_0179415 | Ga0501071_0179415_718_945 | 68 |
| 111 | 3300049588 | Ga0501072_0599310 | Ga0501072_0599310_236_463 | 68 |
| 112 | 3300003373 | JGI25407J50210_10089020 | JGI25407J50210_100890202 | 70 |
| 113 | 3300003373 | JGI25407J50210_10095049 | JGI25407J50210_100950491 | 70 |
| 114 | 3300005329 | Ga0070683_100002001 | Ga0070683_10000200115 | 70 |
| 115 | 3300005458 | Ga0070681_10195313 | Ga0070681_101953132 | 70 |
| 116 | 3300005535 | Ga0070684_100175658 | Ga0070684_1001756583 | 70 |
| 117 | 3300005981 | Ga0081538_10000686 | Ga0081538_100006863 | 70 |
| 118 | 3300005981 | Ga0081538_10000796 | Ga0081538_100007967 | 70 |
| 119 | 3300013105 | Ga0157369_10675022 | Ga0157369_106750222 | 70 |
| 120 | 3300020070 | Ga0206356_11868250 | Ga0206356_118682502 | 70 |
| 121 | 3300020082 | Ga0206353_11609894 | Ga0206353_116098943 | 70 |
| 122 | 3300025912 | Ga0207707_10129810 | Ga0207707_101298101 | 70 |
| 123 | 3300025917 | Ga0207660_11158502 | Ga0207660_111585021 | 70 |
| 124 | 3300025944 | Ga0207661_10016432 | Ga0207661_100164325 | 70 |
| 125 | 3300045976 | Ga0466967_0032439 | Ga0466967_0032439_528_743 | 70 |
| 126 | 3300048924 | Ga0496121_0004160 | Ga0496121_0004160_18238_18450 | 70 |
| 127 | 3300049576 | Ga0501040_0719526 | Ga0501040_0719526_363_593 | 70 |
| 128 | 3300049592 | Ga0501076_0957631 | Ga0501076_0957631_428_658 | 70 |
| 129 | 3300049582 | Ga0501048_1374513 | Ga0501048_1374513_214_441 | 71 |
| 130 | 3300001990 | JGI24737J22298_10081084 | JGI24737J22298_100810842 | 72 |
| 131 | 3300001991 | JGI24743J22301_10004425 | JGI24743J22301_100044252 | 72 |
| 132 | 3300002073 | JGI24745J21846_1027597 | JGI24745J21846_10275972 | 72 |
| 133 | 3300002076 | JGI24749J21850_1070274 | JGI24749J21850_10702741 | 72 |
| 134 | 3300005327 | Ga0070658_11944093 | Ga0070658_119440931 | 72 |
| 135 | 3300005329 | Ga0070683_100045287 | Ga0070683_1000452875 | 72 |
| 136 | 3300005329 | Ga0070683_100089361 | Ga0070683_1000893613 | 72 |
| 137 | 3300005329 | Ga0070683_100124864 | Ga0070683_1001248643 | 72 |
| 138 | 3300005329 | Ga0070683_101276413 | Ga0070683_1012764132 | 72 |
| 139 | 3300005330 | Ga0070690_100203560 | Ga0070690_1002035602 | 72 |
| 140 | 3300005331 | Ga0070670_100290426 | Ga0070670_1002904262 | 72 |
| 141 | 3300005334 | Ga0068869_100354583 | Ga0068869_1003545832 | 72 |
| 142 | 3300005336 | Ga0070680_100000851 | Ga0070680_1000008515 | 72 |
| 143 | 3300005336 | Ga0070680_100459263 | Ga0070680_1004592632 | 72 |
| 144 | 3300005336 | Ga0070680_100820111 | Ga0070680_1008201112 | 72 |
| 145 | 3300005337 | Ga0070682_100065405 | Ga0070682_1000654054 | 72 |
| 146 | 3300005337 | Ga0070682_100219751 | Ga0070682_1002197512 | 72 |
| 147 | 3300005337 | Ga0070682_101811610 | Ga0070682_1018116102 | 72 |
| 148 | 3300005338 | Ga0068868_100047076 | Ga0068868_1000470762 | 72 |
| 149 | 3300005339 | Ga0070660_100038964 | Ga0070660_1000389642 | 72 |
| 150 | 3300005339 | Ga0070660_100133590 | Ga0070660_1001335902 | 72 |
| 151 | 3300005339 | Ga0070660_100443373 | Ga0070660_1004433732 | 72 |
| 152 | 3300005340 | Ga0070689_100283215 | Ga0070689_1002832152 | 72 |
| 153 | 3300005344 | Ga0070661_100029904 | Ga0070661_1000299042 | 72 |
| 154 | 3300005344 | Ga0070661_100253833 | Ga0070661_1002538332 | 72 |
| 155 | 3300005344 | Ga0070661_101319218 | Ga0070661_1013192181 | 72 |
| 156 | 3300005345 | Ga0070692_10028370 | Ga0070692_100283701 | 72 |
| 157 | 3300005353 | Ga0070669_100867871 | Ga0070669_1008678712 | 72 |
| 158 | 3300005354 | Ga0070675_100083284 | Ga0070675_1000832843 | 72 |
| 159 | 3300005355 | Ga0070671_100689119 | Ga0070671_1006891192 | 72 |
| 160 | 3300005355 | Ga0070671_101371284 | Ga0070671_1013712842 | 72 |
| 161 | 3300005364 | Ga0070673_100843481 | Ga0070673_1008434812 | 72 |
| 162 | 3300005366 | Ga0070659_100010365 | Ga0070659_1000103658 | 72 |
| 163 | 3300005366 | Ga0070659_100715112 | Ga0070659_1007151122 | 72 |
| 164 | 3300005366 | Ga0070659_101494446 | Ga0070659_1014944461 | 72 |
| 165 | 3300005434 | Ga0070709_11285282 | Ga0070709_112852822 | 72 |
| 166 | 3300005435 | Ga0070714_102165455 | Ga0070714_1021654552 | 72 |
| 167 | 3300005436 | Ga0070713_102367675 | Ga0070713_1023676752 | 72 |
| 168 | 3300005437 | Ga0070710_10045510 | Ga0070710_100455103 | 72 |
| 169 | 3300005437 | Ga0070710_10234598 | Ga0070710_102345981 | 72 |
| 170 | 3300005437 | Ga0070710_10462689 | Ga0070710_104626892 | 72 |
| 171 | 3300005438 | Ga0070701_10016821 | Ga0070701_100168213 | 72 |
| 172 | 3300005439 | Ga0070711_100000559 | Ga0070711_1000005593 | 72 |
| 173 | 3300005439 | Ga0070711_100126614 | Ga0070711_1001266142 | 72 |
| 174 | 3300005439 | Ga0070711_100256142 | Ga0070711_1002561422 | 72 |
| 175 | 3300005439 | Ga0070711_100348723 | Ga0070711_1003487232 | 72 |
| 176 | 3300005440 | Ga0070705_100064714 | Ga0070705_1000647142 | 72 |
| 177 | 3300005441 | Ga0070700_100076202 | Ga0070700_1000762022 | 72 |
| 178 | 3300005441 | Ga0070700_100873277 | Ga0070700_1008732772 | 72 |
| 179 | 3300005444 | Ga0070694_100813525 | Ga0070694_1008135252 | 72 |
| 180 | 3300005455 | Ga0070663_100193833 | Ga0070663_1001938332 | 72 |
| 181 | 3300005456 | Ga0070678_100511666 | Ga0070678_1005116662 | 72 |
| 182 | 3300005458 | Ga0070681_10019390 | Ga0070681_100193903 | 72 |
| 183 | 3300005458 | Ga0070681_10803032 | Ga0070681_108030322 | 72 |
| 184 | 3300005459 | Ga0068867_100071776 | Ga0068867_1000717763 | 72 |
| 185 | 3300005466 | Ga0070685_10231922 | Ga0070685_102319222 | 72 |
| 186 | 3300005467 | Ga0070706_102042126 | Ga0070706_1020421262 | 72 |
| 187 | 3300005530 | Ga0070679_100004554 | Ga0070679_1000045546 | 72 |
| 188 | 3300005530 | Ga0070679_100334393 | Ga0070679_1003343932 | 72 |
| 189 | 3300005530 | Ga0070679_100557504 | Ga0070679_1005575042 | 72 |
| 190 | 3300005535 | Ga0070684_100020205 | Ga0070684_1000202056 | 72 |
| 191 | 3300005535 | Ga0070684_100531909 | Ga0070684_1005319092 | 72 |
| 192 | 3300005535 | Ga0070684_101472306 | Ga0070684_1014723062 | 72 |
| 193 | 3300005539 | Ga0068853_100056122 | Ga0068853_1000561222 | 72 |
| 194 | 3300005539 | Ga0068853_101646386 | Ga0068853_1016463862 | 72 |
| 195 | 3300005544 | Ga0070686_100079761 | Ga0070686_1000797611 | 72 |
| 196 | 3300005547 | Ga0070693_100337315 | Ga0070693_1003373152 | 72 |
| 197 | 3300005549 | Ga0070704_100486954 | Ga0070704_1004869542 | 72 |
| 198 | 3300005564 | Ga0070664_100288217 | Ga0070664_1002882172 | 72 |
| 199 | 3300005564 | Ga0070664_101121085 | Ga0070664_1011210851 | 72 |
| 200 | 3300005577 | Ga0068857_100126484 | Ga0068857_1001264842 | 72 |
| 201 | 3300005577 | Ga0068857_100874500 | Ga0068857_1008745002 | 72 |
| 202 | 3300005578 | Ga0068854_100149559 | Ga0068854_1001495592 | 72 |
| 203 | 3300005578 | Ga0068854_100153738 | Ga0068854_1001537382 | 72 |
| 204 | 3300005614 | Ga0068856_100116126 | Ga0068856_1001161263 | 72 |
| 205 | 3300005614 | Ga0068856_100168149 | Ga0068856_1001681493 | 72 |
| 206 | 3300005616 | Ga0068852_100007442 | Ga0068852_1000074424 | 72 |
| 207 | 3300005616 | Ga0068852_100105917 | Ga0068852_1001059172 | 72 |
| 208 | 3300005617 | Ga0068859_100096276 | Ga0068859_1000962762 | 72 |
| 209 | 3300005618 | Ga0068864_100299982 | Ga0068864_1002999823 | 72 |
| 210 | 3300005719 | Ga0068861_100474352 | Ga0068861_1004743522 | 72 |
| 211 | 3300005719 | Ga0068861_100805246 | Ga0068861_1008052462 | 72 |
| 212 | 3300005834 | Ga0068851_10255791 | Ga0068851_102557911 | 72 |
| 213 | 3300005840 | Ga0068870_10014173 | Ga0068870_100141732 | 72 |
| 214 | 3300005842 | Ga0068858_100451759 | Ga0068858_1004517592 | 72 |
| 215 | 3300005843 | Ga0068860_100549826 | Ga0068860_1005498262 | 72 |
| 216 | 3300005981 | Ga0081538_10001548 | Ga0081538_1000154813 | 72 |
| 217 | 3300005981 | Ga0081538_10263093 | Ga0081538_102630932 | 72 |
| 218 | 3300006038 | Ga0075365_10212324 | Ga0075365_102123242 | 72 |
| 219 | 3300006163 | Ga0070715_11096972 | Ga0070715_110969722 | 72 |
| 220 | 3300006173 | Ga0070716_100296340 | Ga0070716_1002963402 | 72 |
| 221 | 3300006173 | Ga0070716_100487144 | Ga0070716_1004871442 | 72 |
| 222 | 3300006175 | Ga0070712_100112281 | Ga0070712_1001122813 | 72 |
| 223 | 3300006175 | Ga0070712_100138418 | Ga0070712_1001384182 | 72 |
| 224 | 3300006175 | Ga0070712_100139301 | Ga0070712_1001393013 | 72 |
| 225 | 3300006175 | Ga0070712_100617640 | Ga0070712_1006176402 | 72 |
| 226 | 3300006358 | Ga0068871_100619176 | Ga0068871_1006191762 | 72 |
| 227 | 3300006847 | Ga0075431_100013418 | Ga0075431_1000134185 | 72 |
| 228 | 3300006852 | Ga0075433_10067795 | Ga0075433_100677953 | 72 |
| 229 | 3300006852 | Ga0075433_11446382 | Ga0075433_114463821 | 72 |
| 230 | 3300006871 | Ga0075434_100207024 | Ga0075434_1002070242 | 72 |
| 231 | 3300006871 | Ga0075434_100254885 | Ga0075434_1002548852 | 72 |
| 232 | 3300006880 | Ga0075429_101034767 | Ga0075429_1010347672 | 72 |
| 233 | 3300006881 | Ga0068865_100223118 | Ga0068865_1002231182 | 72 |
| 234 | 3300006914 | Ga0075436_100199004 | Ga0075436_1001990042 | 72 |
| 235 | 3300006931 | Ga0097620_100096279 | Ga0097620_1000962794 | 72 |
| 236 | 3300007076 | Ga0075435_100028663 | Ga0075435_1000286635 | 72 |
| 237 | 3300009093 | Ga0105240_10058465 | Ga0105240_100584653 | 72 |
| 238 | 3300009094 | Ga0111539_10311544 | Ga0111539_103115443 | 72 |
| 239 | 3300009098 | Ga0105245_10045363 | Ga0105245_100453634 | 72 |
| 240 | 3300009098 | Ga0105245_12678610 | Ga0105245_126786102 | 72 |
| 241 | 3300009101 | Ga0105247_10427197 | Ga0105247_104271972 | 72 |
| 242 | 3300009147 | Ga0114129_10855171 | Ga0114129_108551712 | 72 |
| 243 | 3300009177 | Ga0105248_10450278 | Ga0105248_104502782 | 72 |
| 244 | 3300009545 | Ga0105237_10126131 | Ga0105237_101261312 | 72 |
| 245 | 3300009551 | Ga0105238_10021833 | Ga0105238_100218335 | 72 |
| 246 | 3300010375 | Ga0105239_10226306 | Ga0105239_102263062 | 72 |
| 247 | 3300013102 | Ga0157371_10284879 | Ga0157371_102848792 | 72 |
| 248 | 3300013104 | Ga0157370_10017809 | Ga0157370_100178095 | 72 |
| 249 | 3300013105 | Ga0157369_10064451 | Ga0157369_100644512 | 72 |
| 250 | 3300013105 | Ga0157369_11510627 | Ga0157369_115106272 | 72 |
| 251 | 3300013296 | Ga0157374_10148940 | Ga0157374_101489402 | 72 |
| 252 | 3300013306 | Ga0163162_10700006 | Ga0163162_107000062 | 72 |
| 253 | 3300013307 | Ga0157372_10469517 | Ga0157372_104695172 | 72 |
| 254 | 3300013307 | Ga0157372_10714581 | Ga0157372_107145812 | 72 |
| 255 | 3300014325 | Ga0163163_10041285 | Ga0163163_100412854 | 72 |
| 256 | 3300014326 | Ga0157380_10429789 | Ga0157380_104297892 | 72 |
| 257 | 3300014497 | Ga0182008_10231485 | Ga0182008_102314852 | 72 |
| 258 | 3300014745 | Ga0157377_11482773 | Ga0157377_114827732 | 72 |
| 259 | 3300020070 | Ga0206356_10446832 | Ga0206356_104468322 | 72 |
| 260 | 3300020081 | Ga0206354_11267508 | Ga0206354_112675081 | 72 |
| 261 | 3300020082 | Ga0206353_11619556 | Ga0206353_116195565 | 72 |
| 262 | 3300022467 | Ga0224712_10559569 | Ga0224712_105595692 | 72 |
| 263 | 3300025898 | Ga0207692_10076115 | Ga0207692_100761152 | 72 |
| 264 | 3300025898 | Ga0207692_10481280 | Ga0207692_104812802 | 72 |
| 265 | 3300025901 | Ga0207688_10041543 | Ga0207688_100415432 | 72 |
| 266 | 3300025903 | Ga0207680_10380944 | Ga0207680_103809442 | 72 |
| 267 | 3300025908 | Ga0207643_10014383 | Ga0207643_100143835 | 72 |
| 268 | 3300025909 | Ga0207705_10521295 | Ga0207705_105212952 | 72 |
| 269 | 3300025909 | Ga0207705_11378267 | Ga0207705_113782672 | 72 |
| 270 | 3300025912 | Ga0207707_10739715 | Ga0207707_107397152 | 72 |
| 271 | 3300025912 | Ga0207707_10831314 | Ga0207707_108313142 | 72 |
| 272 | 3300025913 | Ga0207695_10050185 | Ga0207695_100501853 | 72 |
| 273 | 3300025914 | Ga0207671_10069725 | Ga0207671_100697252 | 72 |
| 274 | 3300025915 | Ga0207693_10033646 | Ga0207693_100336465 | 72 |
| 275 | 3300025915 | Ga0207693_10119114 | Ga0207693_101191142 | 72 |
| 276 | 3300025915 | Ga0207693_10125584 | Ga0207693_101255844 | 72 |
| 277 | 3300025915 | Ga0207693_10310876 | Ga0207693_103108762 | 72 |
| 278 | 3300025915 | Ga0207693_10553389 | Ga0207693_105533892 | 72 |
| 279 | 3300025916 | Ga0207663_10217763 | Ga0207663_102177632 | 72 |
| 280 | 3300025916 | Ga0207663_10614694 | Ga0207663_106146942 | 72 |
| 281 | 3300025916 | Ga0207663_10732873 | Ga0207663_107328732 | 72 |
| 282 | 3300025917 | Ga0207660_10308793 | Ga0207660_103087932 | 72 |
| 283 | 3300025917 | Ga0207660_10994313 | Ga0207660_109943131 | 72 |
| 284 | 3300025917 | Ga0207660_11340763 | Ga0207660_113407632 | 72 |
| 285 | 3300025919 | Ga0207657_10041030 | Ga0207657_100410304 | 72 |
| 286 | 3300025919 | Ga0207657_10049094 | Ga0207657_100490942 | 72 |
| 287 | 3300025920 | Ga0207649_10316377 | Ga0207649_103163771 | 72 |
| 288 | 3300025920 | Ga0207649_10373456 | Ga0207649_103734562 | 72 |
| 289 | 3300025921 | Ga0207652_10113740 | Ga0207652_101137404 | 72 |
| 290 | 3300025921 | Ga0207652_10288221 | Ga0207652_102882212 | 72 |
| 291 | 3300025921 | Ga0207652_10698489 | Ga0207652_106984892 | 72 |
| 292 | 3300025925 | Ga0207650_10134938 | Ga0207650_101349383 | 72 |
| 293 | 3300025926 | Ga0207659_10040429 | Ga0207659_100404292 | 72 |
| 294 | 3300025927 | Ga0207687_10280840 | Ga0207687_102808402 | 72 |
| 295 | 3300025928 | Ga0207700_10684388 | Ga0207700_106843882 | 72 |
| 296 | 3300025929 | Ga0207664_10456928 | Ga0207664_104569282 | 72 |
| 297 | 3300025931 | Ga0207644_10510502 | Ga0207644_105105022 | 72 |
| 298 | 3300025935 | Ga0207709_10563421 | Ga0207709_105634212 | 72 |
| 299 | 3300025937 | Ga0207669_10292273 | Ga0207669_102922732 | 72 |
| 300 | 3300025938 | Ga0207704_10028448 | Ga0207704_100284484 | 72 |
| 301 | 3300025938 | Ga0207704_11678975 | Ga0207704_116789752 | 72 |
| 302 | 3300025939 | Ga0207665_10279725 | Ga0207665_102797252 | 72 |
| 303 | 3300025940 | Ga0207691_10448815 | Ga0207691_104488152 | 72 |
| 304 | 3300025941 | Ga0207711_10257185 | Ga0207711_102571854 | 72 |
| 305 | 3300025944 | Ga0207661_10004877 | Ga0207661_100048777 | 72 |
| 306 | 3300025944 | Ga0207661_10248670 | Ga0207661_102486701 | 72 |
| 307 | 3300025945 | Ga0207679_10371750 | Ga0207679_103717502 | 72 |
| 308 | 3300025949 | Ga0207667_11607330 | Ga0207667_116073302 | 72 |
| 309 | 3300025960 | Ga0207651_10651737 | Ga0207651_106517372 | 72 |
| 310 | 3300025972 | Ga0207668_10422120 | Ga0207668_104221202 | 72 |
| 311 | 3300025986 | Ga0207658_10192104 | Ga0207658_101921042 | 72 |
| 312 | 3300026023 | Ga0207677_10190609 | Ga0207677_101906092 | 72 |
| 313 | 3300026035 | Ga0207703_10588960 | Ga0207703_105889602 | 72 |
| 314 | 3300026041 | Ga0207639_10285498 | Ga0207639_102854982 | 72 |
| 315 | 3300026067 | Ga0207678_10073789 | Ga0207678_100737892 | 72 |
| 316 | 3300026075 | Ga0207708_10065923 | Ga0207708_100659234 | 72 |
| 317 | 3300026078 | Ga0207702_10295619 | Ga0207702_102956192 | 72 |
| 318 | 3300026078 | Ga0207702_10770471 | Ga0207702_107704712 | 72 |
| 319 | 3300026088 | Ga0207641_12133801 | Ga0207641_121338012 | 72 |
| 320 | 3300026095 | Ga0207676_10342118 | Ga0207676_103421182 | 72 |
| 321 | 3300026116 | Ga0207674_10223913 | Ga0207674_102239132 | 72 |
| 322 | 3300026116 | Ga0207674_10359153 | Ga0207674_103591532 | 72 |
| 323 | 3300026118 | Ga0207675_100564134 | Ga0207675_1005641342 | 72 |
| 324 | 3300026142 | Ga0207698_10919787 | Ga0207698_109197872 | 72 |
| 325 | 3300026142 | Ga0207698_12539305 | Ga0207698_125393051 | 72 |
| 326 | 3300027907 | Ga0207428_10026260 | Ga0207428_100262602 | 72 |
| 327 | 3300027907 | Ga0207428_10243867 | Ga0207428_102438672 | 72 |
| 328 | 3300028381 | Ga0268264_10026624 | Ga0268264_100266243 | 72 |
| 329 | 3300028563 | Ga0265319_1000118 | Ga0265319_100011851 | 72 |
| 330 | 3300028800 | Ga0265338_10779091 | Ga0265338_107790912 | 72 |
| 331 | 3300031235 | Ga0265330_10106191 | Ga0265330_101061913 | 72 |
| 332 | 3300031240 | Ga0265320_10038599 | Ga0265320_100385992 | 72 |
| 333 | 3300031548 | Ga0307408_100056853 | Ga0307408_1000568532 | 72 |
| 334 | 3300031824 | Ga0307413_10201145 | Ga0307413_102011451 | 72 |
| 335 | 3300031852 | Ga0307410_11639049 | Ga0307410_116390492 | 72 |
| 336 | 3300031889 | Ga0326468_10043548 | Ga0326468_100435482 | 72 |
| 337 | 3300031901 | Ga0307406_10849708 | Ga0307406_108497082 | 72 |
| 338 | 3300031995 | Ga0307409_100171784 | Ga0307409_1001717842 | 72 |
| 339 | 3300031995 | Ga0307409_101142661 | Ga0307409_1011426612 | 72 |
| 340 | 3300032002 | Ga0307416_100738820 | Ga0307416_1007388202 | 72 |
| 341 | 3300032004 | Ga0307414_11518719 | Ga0307414_115187192 | 72 |
| 342 | 3300032126 | Ga0307415_101479481 | Ga0307415_1014794812 | 72 |
| 343 | 3300032126 | Ga0307415_101548863 | Ga0307415_1015488632 | 72 |
| 344 | 3300041456 | Ga0451795_1013088 | Ga0451795_1013088_438_662 | 72 |
| 345 | 3300041459 | Ga0451800_1032958 | Ga0451800_1032958_213_431 | 72 |
| 346 | 3300044683 | Ga0466965_0393414 | Ga0466965_0393414_514_732 | 72 |
| 347 | 3300044684 | Ga0466966_0343809 | Ga0466966_0343809_139_363 | 72 |
| 348 | 3300044706 | Ga0466964_0233098 | Ga0466964_0233098_62_280 | 72 |
| 349 | 3300044842 | Ga0466957_0083399 | Ga0466957_0083399_170_394 | 72 |
| 350 | 3300044901 | Ga0466960_0034840 | Ga0466960_0034840_1666_1884 | 72 |
| 351 | 3300044901 | Ga0466960_0448892 | Ga0466960_0448892_253_480 | 72 |
| 352 | 3300045836 | Ga0466958_0728246 | Ga0466958_0728246_352_576 | 72 |
| 353 | 3300045976 | Ga0466967_0058619 | Ga0466967_0058619_2102_2320 | 72 |
| 354 | 3300045976 | Ga0466967_0087771 | Ga0466967_0087771_2232_2456 | 72 |
| 355 | 3300045976 | Ga0466967_0222522 | Ga0466967_0222522_789_1007 | 72 |
| 356 | 3300045976 | Ga0466967_1276725 | Ga0466967_1276725_401_619 | 72 |
| 357 | 3300045976 | Ga0466967_2566481 | Ga0466967_2566481_186_404 | 72 |
| 358 | 3300046455 | Ga0495603_0773432 | Ga0495603_0773432_252_470 | 72 |
| 359 | 3300046463 | Ga0495653_0385618 | Ga0495653_0385618_15_263 | 72 |
| 360 | 3300046477 | Ga0495664_0000025 | Ga0495664_0000025_7257_7505 | 72 |
| 361 | 3300046511 | Ga0495608_0065050 | Ga0495608_0065050_1426_1674 | 72 |
| 362 | 3300046529 | Ga0495652_0088765 | Ga0495652_0088765_721_969 | 72 |
| 363 | 3300046665 | Ga0495661_0299781 | Ga0495661_0299781_420_656 | 72 |
| 364 | 3300046809 | Ga0495600_0007859 | Ga0495600_0007859_1467_1715 | 72 |
| 365 | 3300047317 | Ga0495604_0000063 | Ga0495604_0000063_8695_8946 | 72 |
| 366 | 3300047321 | Ga0495676_0279915 | Ga0495676_0279915_295_537 | 72 |
| 367 | 3300048903 | Ga0496100_0177281 | Ga0496100_0177281_730_948 | 72 |
| 368 | 3300048903 | Ga0496100_0444110 | Ga0496100_0444110_660_878 | 72 |
| 369 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_125160_125408 | 72 |
| 370 | 3300048905 | Ga0496102_0172539 | Ga0496102_0172539_427_657 | 72 |
| 371 | 3300048905 | Ga0496102_0253727 | Ga0496102_0253727_752_970 | 72 |
| 372 | 3300048906 | Ga0496103_0000047 | Ga0496103_0000047_24594_24842 | 72 |
| 373 | 3300048906 | Ga0496103_0175082 | Ga0496103_0175082_727_945 | 72 |
| 374 | 3300048907 | Ga0496104_0967511 | Ga0496104_0967511_359_577 | 72 |
| 375 | 3300048907 | Ga0496104_1041375 | Ga0496104_1041375_438_668 | 72 |
| 376 | 3300048908 | Ga0496105_0005677 | Ga0496105_0005677_7334_7576 | 72 |
| 377 | 3300048908 | Ga0496105_0123090 | Ga0496105_0123090_640_858 | 72 |
| 378 | 3300048909 | Ga0496106_0185946 | Ga0496106_0185946_552_770 | 72 |
| 379 | 3300048909 | Ga0496106_1393112 | Ga0496106_1393112_17_235 | 72 |
| 380 | 3300048909 | Ga0496106_1477429 | Ga0496106_1477429_149_367 | 72 |
| 381 | 3300048910 | Ga0496107_0198896 | Ga0496107_0198896_1007_1225 | 72 |
| 382 | 3300048910 | Ga0496107_0584465 | Ga0496107_0584465_45_263 | 72 |
| 383 | 3300048911 | Ga0496108_0160513 | Ga0496108_0160513_182_400 | 72 |
| 384 | 3300048911 | Ga0496108_0504920 | Ga0496108_0504920_155_385 | 72 |
| 385 | 3300048913 | Ga0496110_0063284 | Ga0496110_0063284_2128_2346 | 72 |
| 386 | 3300048914 | Ga0496111_0098190 | Ga0496111_0098190_1414_1632 | 72 |
| 387 | 3300048915 | Ga0496112_0110443 | Ga0496112_0110443_445_675 | 72 |
| 388 | 3300048915 | Ga0496112_0316059 | Ga0496112_0316059_519_737 | 72 |
| 389 | 3300048915 | Ga0496112_0600785 | Ga0496112_0600785_261_491 | 72 |
| 390 | 3300048916 | Ga0496113_0067862 | Ga0496113_0067862_158_376 | 72 |
| 391 | 3300048916 | Ga0496113_0155318 | Ga0496113_0155318_300_518 | 72 |
| 392 | 3300048917 | Ga0496114_0257963 | Ga0496114_0257963_185_403 | 72 |
| 393 | 3300048918 | Ga0496115_0273784 | Ga0496115_0273784_930_1148 | 72 |
| 394 | 3300049568 | Ga0501031_0373009 | Ga0501031_0373009_59_295 | 72 |
| 395 | 3300049572 | Ga0501036_0061175 | Ga0501036_0061175_521_757 | 72 |
| 396 | 3300049573 | Ga0501037_0783830 | Ga0501037_0783830_83_319 | 72 |
| 397 | 3300049576 | Ga0501040_0073270 | Ga0501040_0073270_526_762 | 72 |
| 398 | 3300049578 | Ga0501042_0471159 | Ga0501042_0471159_198_428 | 72 |
| 399 | 3300049582 | Ga0501048_0162490 | Ga0501048_0162490_966_1202 | 72 |
| 400 | 3300049583 | Ga0501067_0868044 | Ga0501067_0868044_130_348 | 72 |
| 401 | 3300049584 | Ga0501068_0159854 | Ga0501068_0159854_209_433 | 72 |
| 402 | 3300049585 | Ga0501069_0181398 | Ga0501069_0181398_947_1171 | 72 |
| 403 | 3300049586 | Ga0501070_0624974 | Ga0501070_0624974_186_410 | 72 |
| 404 | 3300049586 | Ga0501070_1091073 | Ga0501070_1091073_101_364 | 72 |
| 405 | 3300049590 | Ga0501074_0039056 | Ga0501074_0039056_3073_3297 | 72 |
| 406 | 3300049708 | Ga0501245_149486 | Ga0501245_149486_129_347 | 72 |
| 407 | 3300049741 | Ga0501079_0067711 | Ga0501079_0067711_2024_2248 | 72 |
| 408 | 3300049741 | Ga0501079_0195452 | Ga0501079_0195452_96_332 | 72 |
| 409 | 3300049824 | Ga0501045_0017972 | Ga0501045_0017972_4392_4628 | 72 |
| 410 | 3300050492 | nmdc:mga0yw44_644390_c1 | nmdc:mga0yw44_644390_c1_98_322 | 72 |
| 411 | 3300050508 | nmdc:mga09592_401740_c1 | nmdc:mga09592_401740_c1_112_348 | 72 |
| 412 | 3300050511 | nmdc:mga08y16_71613_c1 | nmdc:mga08y16_71613_c1_1562_1780 | 72 |
| 413 | 3300050512 | nmdc:mga0n895_962092_c1 | nmdc:mga0n895_962092_c1_135_353 | 72 |
| 414 | 3300053123 | Ga0500614_081961 | Ga0500614_081961_59_289 | 72 |
| 415 | 3300060344 | Ga0587071_175907 | Ga0587071_175907_12_260 | 72 |
| 416 | 3300060353 | Ga0501082_0539927 | Ga0501082_0539927_449_685 | 72 |
| 417 | 3300061719 | Ga0466962_0303174 | Ga0466962_0303174_72_296 | 72 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6th6-assembly1.cif.gz_Bg | cryo-em structure of t. kodakarensis 70s ribosome | 0.9289 | 9 | 37 |
| 7pwo-assembly1.cif.gz_p2 | cryo-em structure of giardia lamblia ribosome at 2.75 a resolution | 0.9222 | 6 | 37 |
| 7pzy-assembly1.cif.gz_AQ | structure of the vacant candida albicans 80s ribosome | 0.9163 | 6 | 34 |
| 7zs5-assembly1.cif.gz_BB | structure of 60s ribosomal subunit from s. cerevisiae with eif6 and trna | 0.9117 | 6 | 36 |
| 4v8p-assembly2.cif.gz_CY | t.thermophila 60s ribosomal subunit in complex with initiation factor 6. | 0.9107 | 6 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IJU4_13_189_3.40.1000.30 | Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; | 0.9255 | 25 | 37 | 3.40.1000.30 |
| af_D4AAZ6_2_72_2.20.25.30 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.9132 | 6 | 34 | 2.20.25.30 |
| 4a17Y00 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.9107 | 6 | 37 | 2.20.25.30 |
| 1k8a100 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.853 | 8 | 34 | 2.20.25.30 |
| af_C6SXD2_1_92_2.20.25.30 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.8449 | 6 | 34 | 2.20.25.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4GSZ0-F1-model_v4 | Uncharacterized protein | 0.9675 | 7 | 37 |
|
| AF-A0A087KKQ3-F1-model_v4 | Transposase zinc-ribbon domain-containing protein | 0.9331 | 9 | 36 |
|
| AF-A0A811UJ77-F1-model_v4 | (Mediterranean fruit fly) hypothetical protein | 0.9296 | 6 | 37 |
GO:0003735
GO:0005840 GO:0006412 GO:0016020 GO:1990904 |
| AF-A0A538AP44-F1-model_v4 | Insertion element protein | 0.9247 | 9 | 38 |
|
| AF-A0A1G8W5N3-F1-model_v4 | Transposase zinc-ribbon domain-containing protein | 0.9036 | 6 | 36 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar