F439199

General Info

Members Datasets Scaffolds Average Seq Length
417 182 834 173

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3000865235|3000866196
Length 196
Sequence HHSMLDFGFGRVHHGGMKTASLALFGGIALSLLATPALAALNEGAKAPEFNTAGALAGKPFSFDLQKALKKGPVVLYFFPKAFTQGCTLESNAFAQAMGDFKKAGAQVIGLSADDLPTLKRFSTEECRDAFPVAQATPSIIKSYDVSMVMKGSATGLTDRTSYVIGQDGKIVMVHSDLDWRHHVSMTLKAVQALHH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
110 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
172 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
173 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
174 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
181 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
182 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0.48
Rhizoplane 0.24
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2790174 2162886007 Bacteria 1536
2 JGI24033J26618_1005993 3300002155 Bacteria 1355
3 JGI24751J29686_10008722 3300002459 Bacteria 2077
4 Ga0065715_10103031 3300005293 Bacteria 3063
5 Ga0070658_10000003 3300005327 Bacteria 465963
6 Ga0070676_10007472 3300005328 Bacteria 5868
7 Ga0070670_100031569 3300005331 Bacteria 4562
8 Ga0070670_100142801 3300005331 Bacteria 2070
9 Ga0070677_10000455 3300005333 Bacteria 14040
10 Ga0070677_10303399 3300005333 Bacteria 812
11 Ga0070666_10168047 3300005335 Bacteria 1535
12 Ga0070680_100000527 3300005336 Bacteria 26109
13 Ga0070660_100001590 3300005339 Bacteria 15625
14 Ga0070660_100006253 3300005339 Bacteria 8244
15 Ga0070660_100402113 3300005339 Bacteria 1133
16 Ga0070661_101152142 3300005344 Bacteria 647
17 Ga0070692_10004652 3300005345 Bacteria 5753
18 Ga0070692_10044302 3300005345 Bacteria 2291
19 Ga0070668_100008058 3300005347 Bacteria 7825
20 Ga0070668_100011031 3300005347 Bacteria 6726
21 Ga0070668_100209973 3300005347 Bacteria 1601
22 Ga0070668_100214377 3300005347 Bacteria 1585
23 Ga0070669_100002516 3300005353 Bacteria 13263
24 Ga0070669_100026915 3300005353 Bacteria 4138
25 Ga0070675_100010411 3300005354 Bacteria 7264
26 Ga0070671_100002790 3300005355 Bacteria 13569
27 Ga0070671_100190921 3300005355 Unclassified 1736
28 Ga0070671_100260830 3300005355 Bacteria 1473
29 Ga0070674_100596099 3300005356 Bacteria 933
30 Ga0070673_100030240 3300005364 Bacteria 4049
31 Ga0070659_100000005 3300005366 Bacteria 259902
32 Ga0070659_100001597 3300005366 Bacteria 16320
33 Ga0070659_100144440 3300005366 Bacteria 1938
34 Ga0070659_100373995 3300005366 Bacteria 1199
35 Ga0070667_100004818 3300005367 Bacteria 11306
36 Ga0070667_100011695 3300005367 Bacteria 7255
37 Ga0070701_10075589 3300005438 Bacteria 1811
38 Ga0070705_100126302 3300005440 Bacteria 1661
39 Ga0070700_100121011 3300005441 Bacteria 1754
40 Ga0070694_100013474 3300005444 Bacteria 5106
41 Ga0070663_100044143 3300005455 Bacteria 3141
42 Ga0070663_100062245 3300005455 Bacteria 2689
43 Ga0070678_100014431 3300005456 Bacteria 4986
44 Ga0070662_100001332 3300005457 Bacteria 15177
45 Ga0070662_100016128 3300005457 Bacteria 5012
46 Ga0070662_100081574 3300005457 Bacteria 2410
47 Ga0070681_10167991 3300005458 Bacteria 2116
48 Ga0070681_10200495 3300005458 Bacteria 1914
49 Ga0068867_100035813 3300005459 Bacteria 3601
50 Ga0070679_100000001 3300005530 Bacteria 764811
51 Ga0068853_100091801 3300005539 Bacteria 2671
52 Ga0068853_100100063 3300005539 Bacteria 2562
53 Ga0068853_101254599 3300005539 Bacteria 716
54 Ga0070672_100001248 3300005543 Bacteria 15651
55 Ga0070696_100003169 3300005546 Bacteria 10950
56 Ga0070665_100002297 3300005548 Bacteria 21236
57 Ga0070665_100891170 3300005548 Bacteria 902
58 Ga0070664_100034122 3300005564 Bacteria 4268
59 Ga0068857_100182430 3300005577 Bacteria 1910
60 Ga0068854_100166789 3300005578 Bacteria 1710
61 Ga0068854_100255219 3300005578 Bacteria 1402
62 Ga0070702_100220715 3300005615 Bacteria 1267
63 Ga0068859_100050835 3300005617 Bacteria 4164
64 Ga0068864_100519645 3300005618 Bacteria 1147
65 Ga0068861_100041194 3300005719 Bacteria 3459
66 Ga0068870_10066357 3300005840 Bacteria 1954
67 Ga0068863_100007418 3300005841 Bacteria 10732
68 Ga0068863_100242145 3300005841 Bacteria 1741
69 Ga0068858_100319309 3300005842 Bacteria 1484
70 Ga0068860_100050418 3300005843 Bacteria 3963
71 Ga0068860_100530714 3300005843 Bacteria 1177
72 Ga0068862_100001894 3300005844 Bacteria 18978
73 Ga0068862_100027290 3300005844 Bacteria 4805
74 Ga0068862_100036757 3300005844 Bacteria 4151
75 Ga0068862_100045436 3300005844 Bacteria 3748
76 Ga0068862_100058659 3300005844 Bacteria 3302
77 Ga0068862_100092655 3300005844 Bacteria 2634
78 Ga0068862_100412207 3300005844 Bacteria 1266
79 Ga0081539_10010505 3300005985 Bacteria 7508
80 Ga0081539_10163303 3300005985 Bacteria 1060
81 Ga0075428_100015835 3300006844 Bacteria 8347
82 Ga0075431_100005834 3300006847 Bacteria 12181
83 Ga0075433_10359549 3300006852 Bacteria 1286
84 Ga0068865_100503208 3300006881 Bacteria 1010
85 Ga0097620_100050835 3300006931 Bacteria 4164
86 Ga0079104_1030285 3300006946 Bacteria 1353
87 Ga0105251_10009916 3300009011 Bacteria 5575
88 Ga0111539_10013233 3300009094 Bacteria 10312
89 Ga0105245_11153809 3300009098 Bacteria 822
90 Ga0114129_10289861 3300009147 Bacteria 2185
91 Ga0105243_10021199 3300009148 Bacteria 4931
92 Ga0105241_10546879 3300009174 Bacteria 1039
93 Ga0105248_10044477 3300009177 Bacteria 4979
94 Ga0105249_10017768 3300009553 Bacteria 6318
95 Ga0105249_10081876 3300009553 Bacteria 3002
96 Ga0105249_10360358 3300009553 Bacteria 1475
97 Ga0157373_10000811 3300013100 Bacteria 24182
98 Ga0157373_10022697 3300013100 Bacteria 4551
99 Ga0157373_10039498 3300013100 Bacteria 3379
100 Ga0157371_10005811 3300013102 Bacteria 10323
101 Ga0157371_10128270 3300013102 Bacteria 1804
102 Ga0157375_10048124 3300013308 Bacteria 4169
103 Ga0157380_10008492 3300014326 Bacteria 7337
104 Ga0163161_10003850 3300017792 Bacteria 10520
105 Ga0163161_10081728 3300017792 Bacteria 2380
106 Ga0213873_10000016 3300021358 Bacteria 124829
107 Ga0213876_10000056 3300021384 Bacteria 135017
108 Ga0213876_10000292 3300021384 Bacteria 45485
109 Ga0207666_1003738 3300025271 Bacteria 1880
110 Ga0207673_1012116 3300025290 Bacteria 1121
111 Ga0207697_10005728 3300025315 Bacteria 5728
112 Ga0207713_1004092 3300025735 Bacteria 9610
113 Ga0207682_10000697 3300025893 Bacteria 15553
114 Ga0207645_10608220 3300025907 Bacteria 742
115 Ga0207643_10105820 3300025908 Bacteria 1653
116 Ga0207705_10000005 3300025909 Bacteria 673478
117 Ga0207660_10000421 3300025917 Bacteria 27931
118 Ga0207660_10489647 3300025917 Bacteria 997
119 Ga0207657_10000477 3300025919 Bacteria 42286
120 Ga0207657_10000695 3300025919 Bacteria 35770
121 Ga0207657_10007769 3300025919 Bacteria 10952
122 Ga0207657_10094574 3300025919 Bacteria 2488
123 Ga0207657_10898103 3300025919 Bacteria 682
124 Ga0207652_10000002 3300025921 Bacteria 878035
125 Ga0207681_10002860 3300025923 Bacteria 10909
126 Ga0207681_10199359 3300025923 Bacteria 1536
127 Ga0207650_10003709 3300025925 Bacteria 10444
128 Ga0207650_10043965 3300025925 Bacteria 3281
129 Ga0207659_10008393 3300025926 Bacteria 6410
130 Ga0207644_10000293 3300025931 Bacteria 32998
131 Ga0207644_10623868 3300025931 Bacteria 896
132 Ga0207690_10000002 3300025932 Bacteria 807473
133 Ga0207690_10000033 3300025932 Bacteria 149705
134 Ga0207690_10001568 3300025932 Bacteria 14323
135 Ga0207690_10121867 3300025932 Bacteria 1896
136 Ga0207690_10378922 3300025932 Unclassified 1124
137 Ga0207706_10000916 3300025933 Bacteria 30270
138 Ga0207706_10001052 3300025933 Bacteria 28061
139 Ga0207706_10037772 3300025933 Bacteria 4286
140 Ga0207709_10034919 3300025935 Bacteria 2968
141 Ga0207669_10189735 3300025937 Bacteria 1481
142 Ga0207669_10548068 3300025937 Bacteria 933
143 Ga0207704_10892499 3300025938 Bacteria 747
144 Ga0207691_10002743 3300025940 Bacteria 17178
145 Ga0207711_10018482 3300025941 Bacteria 5796
146 Ga0207679_10047260 3300025945 Bacteria 3125
147 Ga0207679_10112816 3300025945 Bacteria 2149
148 Ga0207667_10166021 3300025949 Bacteria 2270
149 Ga0207651_10004565 3300025960 Bacteria 7006
150 Ga0207712_10018276 3300025961 Bacteria 4565
151 Ga0207712_10178685 3300025961 Bacteria 1665
152 Ga0207668_10000853 3300025972 Bacteria 18375
153 Ga0207668_10014779 3300025972 Bacteria 4838
154 Ga0207668_10243100 3300025972 Bacteria 1457
155 Ga0207668_10276063 3300025972 Bacteria 1376
156 Ga0207640_10111181 3300025981 Bacteria 1942
157 Ga0207658_10003543 3300025986 Bacteria 11022
158 Ga0207677_10000043 3300026023 Bacteria 110161
159 Ga0207703_10044685 3300026035 Bacteria 3561
160 Ga0207639_10322629 3300026041 Bacteria 1372
161 Ga0207639_10632559 3300026041 Bacteria 989
162 Ga0207678_10031230 3300026067 Bacteria 4647
163 Ga0207678_10135242 3300026067 Bacteria 2103
164 Ga0207708_10365089 3300026075 Bacteria 1187
165 Ga0207648_10038698 3300026089 Bacteria 4196
166 Ga0207676_10039535 3300026095 Bacteria 3609
167 Ga0207674_10202286 3300026116 Bacteria 1935
168 Ga0207675_100022801 3300026118 Bacteria 5827
169 Ga0207683_10002799 3300026121 Bacteria 15228
170 Ga0209281_1026525 3300027111 Bacteria 1069
171 Ga0209982_1013200 3300027552 Unclassified 1244
172 Ga0209974_10008899 3300027876 Bacteria 3419
173 Ga0209974_10014813 3300027876 Bacteria 2589
174 Ga0209974_10075466 3300027876 Bacteria 1154
175 Ga0268266_10000471 3300028379 Bacteria 58314
176 Ga0268266_10126582 3300028379 Bacteria 2281
177 Ga0268266_11200893 3300028379 Bacteria 733
178 Ga0268265_10016013 3300028380 Bacteria 5145
179 Ga0268265_10016205 3300028380 Bacteria 5117
180 Ga0268265_10031115 3300028380 Bacteria 3852
181 Ga0268265_10119205 3300028380 Bacteria 2171
182 Ga0268265_10815521 3300028380 Bacteria 910
183 Ga0268264_10021356 3300028381 Bacteria 5285
184 Ga0316177_1186145 3300030731 Bacteria 1072
185 Ga0307408_100010246 3300031548 Bacteria 6183
186 Ga0307408_100025331 3300031548 Bacteria 4062
187 Ga0307408_100066826 3300031548 Bacteria 2642
188 Ga0307408_100104152 3300031548 Unclassified 2167
189 Ga0307408_100283120 3300031548 Bacteria 1381
190 Ga0307408_100327535 3300031548 Unclassified 1292
191 Ga0307408_100389787 3300031548 Bacteria 1193
192 Ga0307408_100521292 3300031548 Bacteria 1044
193 Ga0307408_101077813 3300031548 Bacteria 744
194 Ga0307408_101235721 3300031548 Bacteria 698
195 Ga0307405_10028139 3300031731 Bacteria 3269
196 Ga0307405_10052589 3300031731 Bacteria 2533
197 Ga0307405_10074959 3300031731 Bacteria 2190
198 Ga0307405_10090127 3300031731 Bacteria 2028
199 Ga0307405_10247901 3300031731 Unclassified 1323
200 Ga0307405_10426984 3300031731 Unclassified 1044
201 Ga0307405_10443547 3300031731 Bacteria 1027
202 Ga0307405_10739267 3300031731 Bacteria 818
203 Ga0307405_10756475 3300031731 Bacteria 810
204 Ga0307405_10843915 3300031731 Bacteria 771
205 Ga0307413_10003258 3300031824 Bacteria 6802
206 Ga0307413_10009430 3300031824 Bacteria 4672
207 Ga0307413_10012355 3300031824 Bacteria 4248
208 Ga0307413_10018255 3300031824 Bacteria 3675
209 Ga0307413_10019859 3300031824 Bacteria 3560
210 Ga0307413_10023647 3300031824 Bacteria 3333
211 Ga0307413_10065022 3300031824 Bacteria 2269
212 Ga0307413_10071212 3300031824 Bacteria 2190
213 Ga0307413_10071635 3300031824 Bacteria 2185
214 Ga0307413_10118034 3300031824 Bacteria 1790
215 Ga0307413_10133907 3300031824 Bacteria 1701
216 Ga0307413_10180770 3300031824 Unclassified 1503
217 Ga0307413_10268532 3300031824 Bacteria 1276
218 Ga0307413_10335705 3300031824 Bacteria 1160
219 Ga0307413_10421033 3300031824 Bacteria 1052
220 Ga0307410_10002972 3300031852 Bacteria 8363
221 Ga0307410_10008535 3300031852 Bacteria 5688
222 Ga0307410_10009319 3300031852 Bacteria 5500
223 Ga0307410_10012662 3300031852 Bacteria 4887
224 Ga0307410_10013973 3300031852 Bacteria 4706
225 Ga0307410_10019757 3300031852 Bacteria 4105
226 Ga0307410_10061194 3300031852 Bacteria 2576
227 Ga0307410_10068899 3300031852 Bacteria 2445
228 Ga0307410_10106985 3300031852 Bacteria 2016
229 Ga0307410_10120289 3300031852 Bacteria 1914
230 Ga0307410_10127625 3300031852 Bacteria 1864
231 Ga0307410_10162565 3300031852 Bacteria 1674
232 Ga0307410_10184868 3300031852 Bacteria 1581
233 Ga0307410_10617578 3300031852 Bacteria 906
234 Ga0307410_10933986 3300031852 Bacteria 745
235 Ga0307410_11032687 3300031852 Bacteria 710
236 Ga0307410_11146474 3300031852 Bacteria 675
237 Ga0307406_10006425 3300031901 Bacteria 6487
238 Ga0307406_10016665 3300031901 Bacteria 4276
239 Ga0307406_10070717 3300031901 Bacteria 2285
240 Ga0307406_10087414 3300031901 Bacteria 2089
241 Ga0307406_10122688 3300031901 Unclassified 1809
242 Ga0307406_10236901 3300031901 Bacteria 1366
243 Ga0307406_10596011 3300031901 Bacteria 910
244 Ga0307406_10645922 3300031901 Bacteria 878
245 Ga0307406_10945273 3300031901 Bacteria 736
246 Ga0307407_10010090 3300031903 Bacteria 4436
247 Ga0307407_10013762 3300031903 Bacteria 3939
248 Ga0307407_10019318 3300031903 Bacteria 3467
249 Ga0307407_10024139 3300031903 Bacteria 3184
250 Ga0307407_10087438 3300031903 Bacteria 1901
251 Ga0307407_10181965 3300031903 Bacteria 1394
252 Ga0307407_10184711 3300031903 Unclassified 1384
253 Ga0307407_10265939 3300031903 Bacteria 1181
254 Ga0307407_10339767 3300031903 Bacteria 1060
255 Ga0307407_11259831 3300031903 Bacteria 579
256 Ga0307412_10002013 3300031911 Bacteria 11281
257 Ga0307412_10009583 3300031911 Bacteria 5560
258 Ga0307412_10011366 3300031911 Bacteria 5155
259 Ga0307412_10016013 3300031911 Bacteria 4456
260 Ga0307412_10033724 3300031911 Bacteria 3256
261 Ga0307412_10039493 3300031911 Bacteria 3047
262 Ga0307412_10057783 3300031911 Bacteria 2591
263 Ga0307412_10062962 3300031911 Bacteria 2500
264 Ga0307412_10070602 3300031911 Bacteria 2381
265 Ga0307412_10093727 3300031911 Bacteria 2107
266 Ga0307412_10267355 3300031911 Bacteria 1336
267 Ga0307409_100017480 3300031995 Bacteria 4782
268 Ga0307409_100022113 3300031995 Bacteria 4377
269 Ga0307409_100029290 3300031995 Bacteria 3938
270 Ga0307409_100074954 3300031995 Bacteria 2706
271 Ga0307409_100082765 3300031995 Bacteria 2599
272 Ga0307409_100146396 3300031995 Bacteria 2043
273 Ga0307409_100147532 3300031995 Bacteria 2036
274 Ga0307409_100192365 3300031995 Bacteria 1817
275 Ga0307409_100217685 3300031995 Bacteria 1722
276 Ga0307409_100220151 3300031995 Bacteria 1713
277 Ga0307409_100258785 3300031995 Unclassified 1596
278 Ga0307409_100264585 3300031995 Bacteria 1580
279 Ga0307409_100268056 3300031995 Bacteria 1571
280 Ga0307409_100333638 3300031995 Unclassified 1424
281 Ga0307409_100422834 3300031995 Bacteria 1279
282 Ga0307409_100457353 3300031995 Bacteria 1233
283 Ga0307409_100579802 3300031995 Bacteria 1105
284 Ga0307409_101043424 3300031995 Bacteria 837
285 Ga0307409_101065771 3300031995 Bacteria 828
286 Ga0307416_100026318 3300032002 Bacteria 4285
287 Ga0307416_100030523 3300032002 Bacteria 4045
288 Ga0307416_100034906 3300032002 Bacteria 3834
289 Ga0307416_100037384 3300032002 Bacteria 3735
290 Ga0307416_100060541 3300032002 Bacteria 3084
291 Ga0307416_100090861 3300032002 Bacteria 2620
292 Ga0307416_100228746 3300032002 Bacteria 1791
293 Ga0307416_100423403 3300032002 Bacteria 1376
294 Ga0307416_100675970 3300032002 Bacteria 1119
295 Ga0307416_101484964 3300032002 Bacteria 783
296 Ga0307416_101563308 3300032002 Bacteria 765
297 Ga0307414_10003752 3300032004 Bacteria 8158
298 Ga0307414_10014103 3300032004 Bacteria 4777
299 Ga0307414_10018151 3300032004 Unclassified 4322
300 Ga0307414_10021599 3300032004 Bacteria 4044
301 Ga0307414_10029968 3300032004 Bacteria 3548
302 Ga0307414_10036186 3300032004 Bacteria 3293
303 Ga0307414_10049842 3300032004 Bacteria 2897
304 Ga0307414_10057423 3300032004 Bacteria 2735
305 Ga0307414_10064084 3300032004 Bacteria 2615
306 Ga0307414_10079719 3300032004 Bacteria 2391
307 Ga0307414_10099923 3300032004 Bacteria 2181
308 Ga0307414_10102791 3300032004 Bacteria 2154
309 Ga0307414_10116643 3300032004 Bacteria 2044
310 Ga0307414_10122509 3300032004 Bacteria 2002
311 Ga0307414_10134485 3300032004 Bacteria 1925
312 Ga0307414_10143894 3300032004 Bacteria 1870
313 Ga0307414_10267609 3300032004 Unclassified 1429
314 Ga0307414_10300267 3300032004 Bacteria 1358
315 Ga0307414_10395637 3300032004 Bacteria 1198
316 Ga0307414_10441341 3300032004 Bacteria 1139
317 Ga0307414_10526711 3300032004 Bacteria 1050
318 Ga0307414_10965368 3300032004 Bacteria 783
319 Ga0307414_11066838 3300032004 Unclassified 745
320 Ga0307411_10000251 3300032005 Bacteria 17662
321 Ga0307411_10003174 3300032005 Bacteria 7554
322 Ga0307411_10014595 3300032005 Bacteria 4378
323 Ga0307411_10019660 3300032005 Bacteria 3907
324 Ga0307411_10028323 3300032005 Bacteria 3404
325 Ga0307411_10029208 3300032005 Bacteria 3363
326 Ga0307411_10056146 3300032005 Bacteria 2594
327 Ga0307411_10072584 3300032005 Bacteria 2337
328 Ga0307411_10085461 3300032005 Bacteria 2185
329 Ga0307411_10115814 3300032005 Bacteria 1928
330 Ga0307411_10118749 3300032005 Bacteria 1908
331 Ga0307411_10261629 3300032005 Unclassified 1366
332 Ga0307411_10364052 3300032005 Bacteria 1183
333 Ga0307411_10650492 3300032005 Bacteria 912
334 Ga0307411_10660735 3300032005 Bacteria 906
335 Ga0307411_10693118 3300032005 Bacteria 886
336 Ga0307411_10741592 3300032005 Bacteria 859
337 Ga0307411_11237375 3300032005 Bacteria 678
338 Ga0307415_100007444 3300032126 Bacteria 5988
339 Ga0307415_100016246 3300032126 Bacteria 4432
340 Ga0307415_100059790 3300032126 Bacteria 2630
341 Ga0307415_100092205 3300032126 Bacteria 2196
342 Ga0307415_100127314 3300032126 Bacteria 1921
343 Ga0307415_100838007 3300032126 Bacteria 843
344 Ga0373941_0219227 3300035115 Bacteria 731
345 Ga0395899_0085856 3300037312 Bacteria 2287
346 Ga0395900_0000731 3300037418 Bacteria 43691
347 Ga0395900_0056659 3300037418 Bacteria 4034
348 Ga0395900_0137123 3300037418 Bacteria 2507
349 Ga0395898_0156384 3300037466 Bacteria 2181
350 Ga0395905_0000383 3300037471 Bacteria 63049
351 Ga0395905_0046281 3300037471 Bacteria 4079
352 Ga0395905_0510165 3300037471 Bacteria 1103
353 Ga0395905_1388819 3300037471 Bacteria 606
354 Ga0395901_0036165 3300038443 Bacteria 5102
355 Ga0395901_0156026 3300038443 Bacteria 2398
356 Ga0395901_0652954 3300038443 Bacteria 1055
357 Ga0436365_0029381 3300039437 Bacteria 85595
358 Ga0436365_0869628 3300039437 Bacteria 66366
359 Ga0436363_0003155 3300039450 Bacteria 1292
360 Ga0436363_0947179 3300039450 Bacteria 1235
361 Ga0436362_0580304 3300039453 Bacteria 124869
362 Ga0451837_0007063 3300041494 Bacteria 1283
363 Ga0450889_000070 3300042144 Bacteria 9180
364 Ga0439435_0016731 3300042436 Bacteria 1844
365 Ga0466970_0094152 3300044765 Bacteria 1628
366 Ga0466970_0230570 3300044765 Bacteria 1035
367 Ga0466960_0136030 3300044901 Bacteria 1301
368 Ga0466967_0260708 3300045976 Bacteria 1658
369 Ga0495638_0013555 3300046460 Bacteria 5542
370 Ga0495663_0004212 3300046525 Bacteria 4059
371 Ga0495663_0069627 3300046525 Bacteria 1118
372 Ga0495663_0210081 3300046525 Bacteria 681
373 Ga0495642_0061195 3300046528 Bacteria 1562
374 Ga0495621_0002366 3300046539 Bacteria 5067
375 Ga0495621_0003360 3300046539 Bacteria 4413
376 Ga0495668_0095522 3300046616 Bacteria 1627
377 Ga0495659_0043469 3300046664 Bacteria 1612
378 Ga0495670_0037509 3300046691 Bacteria 2416
379 Ga0495670_0080560 3300046691 Bacteria 1658
380 Ga0495636_0151725 3300047318 Bacteria 1040
381 Ga0495615_0000183 3300048090 Bacteria 15317
382 Ga0496103_0105183 3300048906 Bacteria 1789
383 Ga0496117_0078637 3300048920 Bacteria 2176
384 Ga0496118_0041561 3300048921 Bacteria 3638
385 Ga0496120_0165197 3300048923 Bacteria 1100
386 Ga0496121_0002997 3300048924 Bacteria 24524
387 Ga0496121_0009274 3300048924 Bacteria 11352
388 Ga0496122_0003311 3300048925 Bacteria 21313
389 Ga0496123_0001328 3300048926 Bacteria 34936
390 Ga0496123_0136338 3300048926 Bacteria 1350
391 Ga0496124_0036232 3300048927 Bacteria 4306
392 Ga0496124_0178688 3300048927 Bacteria 1635
393 Ga0496125_0031517 3300048928 Bacteria 4724
394 Ga0496125_0294935 3300048928 Bacteria 996
395 Ga0496126_0074460 3300048929 Bacteria 3016
396 Ga0501033_0590570 3300049570 Bacteria 762
397 Ga0501034_0096363 3300049571 Bacteria 2955
398 Ga0501034_0944088 3300049571 Bacteria 749
399 Ga0501042_0084474 3300049578 Bacteria 2276
400 Ga0501216_009048 3300049660 Unclassified 1582
401 Ga0501223_011804 3300049663 Bacteria 1753
402 Ga0501233_017967 3300049668 Unclassified 1482
403 Ga0501235_013586 3300049669 Unclassified 1793
404 Ga0501247_026601 3300049677 Unclassified 773
405 Ga0501221_008133 3300049704 Unclassified 1817
406 Ga0501263_015628 3300049760 Unclassified 982
407 Ga0501268_010960 3300049765 Bacteria 1422
408 Ga0501272_010396 3300049769 Unclassified 1039
409 Ga0501279_014536 3300049775 Unclassified 1085
410 nmdc:mga05p37_199183_c1 3300050507 Bacteria 2426
411 nmdc:mga09592_144457_c1 3300050508 Bacteria 2051
412 nmdc:mga06r32_1572_c1 3300050510 Bacteria 20565
413 nmdc:mga08y16_7043_c1 3300050511 Bacteria 11801
414 Ga0500616_0002307 3300053153 Bacteria 16144
415 3000866196 3000865235 Bacteria 3106258
416 2848299764 2848297114 Bacteria 3608511
417 8054307369 8054302542 Bacteria 5698134
418 SwRhRL2b_contig_2790174
419 JGI24033J26618_1005993
420 JGI24751J29686_10008722
421 Ga0065715_10103031
422 Ga0070658_10000003
423 Ga0070676_10007472
424 Ga0070670_100031569
425 Ga0070670_100142801
426 Ga0070677_10000455
427 Ga0070677_10303399
428 Ga0070666_10168047
429 Ga0070680_100000527
430 Ga0070660_100001590
431 Ga0070660_100006253
432 Ga0070660_100402113
433 Ga0070661_101152142
434 Ga0070692_10004652
435 Ga0070692_10044302
436 Ga0070668_100008058
437 Ga0070668_100011031
438 Ga0070668_100209973
439 Ga0070668_100214377
440 Ga0070669_100002516
441 Ga0070669_100026915
442 Ga0070675_100010411
443 Ga0070671_100002790
444 Ga0070671_100190921
445 Ga0070671_100260830
446 Ga0070674_100596099
447 Ga0070673_100030240
448 Ga0070659_100000005
449 Ga0070659_100001597
450 Ga0070659_100144440
451 Ga0070659_100373995
452 Ga0070667_100004818
453 Ga0070667_100011695
454 Ga0070701_10075589
455 Ga0070705_100126302
456 Ga0070700_100121011
457 Ga0070694_100013474
458 Ga0070663_100044143
459 Ga0070663_100062245
460 Ga0070678_100014431
461 Ga0070662_100001332
462 Ga0070662_100016128
463 Ga0070662_100081574
464 Ga0070681_10167991
465 Ga0070681_10200495
466 Ga0068867_100035813
467 Ga0070679_100000001
468 Ga0068853_100091801
469 Ga0068853_100100063
470 Ga0068853_101254599
471 Ga0070672_100001248
472 Ga0070696_100003169
473 Ga0070665_100002297
474 Ga0070665_100891170
475 Ga0070664_100034122
476 Ga0068857_100182430
477 Ga0068854_100166789
478 Ga0068854_100255219
479 Ga0070702_100220715
480 Ga0068859_100050835
481 Ga0068864_100519645
482 Ga0068861_100041194
483 Ga0068870_10066357
484 Ga0068863_100007418
485 Ga0068863_100242145
486 Ga0068858_100319309
487 Ga0068860_100050418
488 Ga0068860_100530714
489 Ga0068862_100001894
490 Ga0068862_100027290
491 Ga0068862_100036757
492 Ga0068862_100045436
493 Ga0068862_100058659
494 Ga0068862_100092655
495 Ga0068862_100412207
496 Ga0081539_10010505
497 Ga0081539_10163303
498 Ga0075428_100015835
499 Ga0075431_100005834
500 Ga0075433_10359549
501 Ga0068865_100503208
502 Ga0097620_100050835
503 Ga0079104_1030285
504 Ga0105251_10009916
505 Ga0111539_10013233
506 Ga0105245_11153809
507 Ga0114129_10289861
508 Ga0105243_10021199
509 Ga0105241_10546879
510 Ga0105248_10044477
511 Ga0105249_10017768
512 Ga0105249_10081876
513 Ga0105249_10360358
514 Ga0157373_10000811
515 Ga0157373_10022697
516 Ga0157373_10039498
517 Ga0157371_10005811
518 Ga0157371_10128270
519 Ga0157375_10048124
520 Ga0157380_10008492
521 Ga0163161_10003850
522 Ga0163161_10081728
523 Ga0213873_10000016
524 Ga0213876_10000056
525 Ga0213876_10000292
526 Ga0207666_1003738
527 Ga0207673_1012116
528 Ga0207697_10005728
529 Ga0207713_1004092
530 Ga0207682_10000697
531 Ga0207645_10608220
532 Ga0207643_10105820
533 Ga0207705_10000005
534 Ga0207660_10000421
535 Ga0207660_10489647
536 Ga0207657_10000477
537 Ga0207657_10000695
538 Ga0207657_10007769
539 Ga0207657_10094574
540 Ga0207657_10898103
541 Ga0207652_10000002
542 Ga0207681_10002860
543 Ga0207681_10199359
544 Ga0207650_10003709
545 Ga0207650_10043965
546 Ga0207659_10008393
547 Ga0207644_10000293
548 Ga0207644_10623868
549 Ga0207690_10000002
550 Ga0207690_10000033
551 Ga0207690_10001568
552 Ga0207690_10121867
553 Ga0207690_10378922
554 Ga0207706_10000916
555 Ga0207706_10001052
556 Ga0207706_10037772
557 Ga0207709_10034919
558 Ga0207669_10189735
559 Ga0207669_10548068
560 Ga0207704_10892499
561 Ga0207691_10002743
562 Ga0207711_10018482
563 Ga0207679_10047260
564 Ga0207679_10112816
565 Ga0207667_10166021
566 Ga0207651_10004565
567 Ga0207712_10018276
568 Ga0207712_10178685
569 Ga0207668_10000853
570 Ga0207668_10014779
571 Ga0207668_10243100
572 Ga0207668_10276063
573 Ga0207640_10111181
574 Ga0207658_10003543
575 Ga0207677_10000043
576 Ga0207703_10044685
577 Ga0207639_10322629
578 Ga0207639_10632559
579 Ga0207678_10031230
580 Ga0207678_10135242
581 Ga0207708_10365089
582 Ga0207648_10038698
583 Ga0207676_10039535
584 Ga0207674_10202286
585 Ga0207675_100022801
586 Ga0207683_10002799
587 Ga0209281_1026525
588 Ga0209982_1013200
589 Ga0209974_10008899
590 Ga0209974_10014813
591 Ga0209974_10075466
592 Ga0268266_10000471
593 Ga0268266_10126582
594 Ga0268266_11200893
595 Ga0268265_10016013
596 Ga0268265_10016205
597 Ga0268265_10031115
598 Ga0268265_10119205
599 Ga0268265_10815521
600 Ga0268264_10021356
601 Ga0316177_1186145
602 Ga0307408_100010246
603 Ga0307408_100025331
604 Ga0307408_100066826
605 Ga0307408_100104152
606 Ga0307408_100283120
607 Ga0307408_100327535
608 Ga0307408_100389787
609 Ga0307408_100521292
610 Ga0307408_101077813
611 Ga0307408_101235721
612 Ga0307405_10028139
613 Ga0307405_10052589
614 Ga0307405_10074959
615 Ga0307405_10090127
616 Ga0307405_10247901
617 Ga0307405_10426984
618 Ga0307405_10443547
619 Ga0307405_10739267
620 Ga0307405_10756475
621 Ga0307405_10843915
622 Ga0307413_10003258
623 Ga0307413_10009430
624 Ga0307413_10012355
625 Ga0307413_10018255
626 Ga0307413_10019859
627 Ga0307413_10023647
628 Ga0307413_10065022
629 Ga0307413_10071212
630 Ga0307413_10071635
631 Ga0307413_10118034
632 Ga0307413_10133907
633 Ga0307413_10180770
634 Ga0307413_10268532
635 Ga0307413_10335705
636 Ga0307413_10421033
637 Ga0307410_10002972
638 Ga0307410_10008535
639 Ga0307410_10009319
640 Ga0307410_10012662
641 Ga0307410_10013973
642 Ga0307410_10019757
643 Ga0307410_10061194
644 Ga0307410_10068899
645 Ga0307410_10106985
646 Ga0307410_10120289
647 Ga0307410_10127625
648 Ga0307410_10162565
649 Ga0307410_10184868
650 Ga0307410_10617578
651 Ga0307410_10933986
652 Ga0307410_11032687
653 Ga0307410_11146474
654 Ga0307406_10006425
655 Ga0307406_10016665
656 Ga0307406_10070717
657 Ga0307406_10087414
658 Ga0307406_10122688
659 Ga0307406_10236901
660 Ga0307406_10596011
661 Ga0307406_10645922
662 Ga0307406_10945273
663 Ga0307407_10010090
664 Ga0307407_10013762
665 Ga0307407_10019318
666 Ga0307407_10024139
667 Ga0307407_10087438
668 Ga0307407_10181965
669 Ga0307407_10184711
670 Ga0307407_10265939
671 Ga0307407_10339767
672 Ga0307407_11259831
673 Ga0307412_10002013
674 Ga0307412_10009583
675 Ga0307412_10011366
676 Ga0307412_10016013
677 Ga0307412_10033724
678 Ga0307412_10039493
679 Ga0307412_10057783
680 Ga0307412_10062962
681 Ga0307412_10070602
682 Ga0307412_10093727
683 Ga0307412_10267355
684 Ga0307409_100017480
685 Ga0307409_100022113
686 Ga0307409_100029290
687 Ga0307409_100074954
688 Ga0307409_100082765
689 Ga0307409_100146396
690 Ga0307409_100147532
691 Ga0307409_100192365
692 Ga0307409_100217685
693 Ga0307409_100220151
694 Ga0307409_100258785
695 Ga0307409_100264585
696 Ga0307409_100268056
697 Ga0307409_100333638
698 Ga0307409_100422834
699 Ga0307409_100457353
700 Ga0307409_100579802
701 Ga0307409_101043424
702 Ga0307409_101065771
703 Ga0307416_100026318
704 Ga0307416_100030523
705 Ga0307416_100034906
706 Ga0307416_100037384
707 Ga0307416_100060541
708 Ga0307416_100090861
709 Ga0307416_100228746
710 Ga0307416_100423403
711 Ga0307416_100675970
712 Ga0307416_101484964
713 Ga0307416_101563308
714 Ga0307414_10003752
715 Ga0307414_10014103
716 Ga0307414_10018151
717 Ga0307414_10021599
718 Ga0307414_10029968
719 Ga0307414_10036186
720 Ga0307414_10049842
721 Ga0307414_10057423
722 Ga0307414_10064084
723 Ga0307414_10079719
724 Ga0307414_10099923
725 Ga0307414_10102791
726 Ga0307414_10116643
727 Ga0307414_10122509
728 Ga0307414_10134485
729 Ga0307414_10143894
730 Ga0307414_10267609
731 Ga0307414_10300267
732 Ga0307414_10395637
733 Ga0307414_10441341
734 Ga0307414_10526711
735 Ga0307414_10965368
736 Ga0307414_11066838
737 Ga0307411_10000251
738 Ga0307411_10003174
739 Ga0307411_10014595
740 Ga0307411_10019660
741 Ga0307411_10028323
742 Ga0307411_10029208
743 Ga0307411_10056146
744 Ga0307411_10072584
745 Ga0307411_10085461
746 Ga0307411_10115814
747 Ga0307411_10118749
748 Ga0307411_10261629
749 Ga0307411_10364052
750 Ga0307411_10650492
751 Ga0307411_10660735
752 Ga0307411_10693118
753 Ga0307411_10741592
754 Ga0307411_11237375
755 Ga0307415_100007444
756 Ga0307415_100016246
757 Ga0307415_100059790
758 Ga0307415_100092205
759 Ga0307415_100127314
760 Ga0307415_100838007
761 Ga0373941_0219227
762 Ga0395899_0085856
763 Ga0395900_0000731
764 Ga0395900_0056659
765 Ga0395900_0137123
766 Ga0395898_0156384
767 Ga0395905_0000383
768 Ga0395905_0046281
769 Ga0395905_0510165
770 Ga0395905_1388819
771 Ga0395901_0036165
772 Ga0395901_0156026
773 Ga0395901_0652954
774 Ga0436365_0029381
775 Ga0436365_0869628
776 Ga0436363_0003155
777 Ga0436363_0947179
778 Ga0436362_0580304
779 Ga0451837_0007063
780 Ga0450889_000070
781 Ga0439435_0016731
782 Ga0466970_0094152
783 Ga0466970_0230570
784 Ga0466960_0136030
785 Ga0466967_0260708
786 Ga0495638_0013555
787 Ga0495663_0004212
788 Ga0495663_0069627
789 Ga0495663_0210081
790 Ga0495642_0061195
791 Ga0495621_0002366
792 Ga0495621_0003360
793 Ga0495668_0095522
794 Ga0495659_0043469
795 Ga0495670_0037509
796 Ga0495670_0080560
797 Ga0495636_0151725
798 Ga0495615_0000183
799 Ga0496103_0105183
800 Ga0496117_0078637
801 Ga0496118_0041561
802 Ga0496120_0165197
803 Ga0496121_0002997
804 Ga0496121_0009274
805 Ga0496122_0003311
806 Ga0496123_0001328
807 Ga0496123_0136338
808 Ga0496124_0036232
809 Ga0496124_0178688
810 Ga0496125_0031517
811 Ga0496125_0294935
812 Ga0496126_0074460
813 Ga0501033_0590570
814 Ga0501034_0096363
815 Ga0501034_0944088
816 Ga0501042_0084474
817 Ga0501216_009048
818 Ga0501223_011804
819 Ga0501233_017967
820 Ga0501235_013586
821 Ga0501247_026601
822 Ga0501221_008133
823 Ga0501263_015628
824 Ga0501268_010960
825 Ga0501272_010396
826 Ga0501279_014536
827 nmdc:mga05p37_199183_c1
828 nmdc:mga09592_144457_c1
829 nmdc:mga06r32_1572_c1
830 nmdc:mga08y16_7043_c1
831 Ga0500616_0002307
832 3000866196
833 2848299764
834 8054307369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

42

188

0.9

PF00578

AhpC-TSA

AhpC/TSA family

44

174

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9036 22 176
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.9012 24 175
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.893 21 175
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.8856 21 175
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.8845 19 175
ID Description Score Start End Superfamily
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.914 22 178 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9081 22 178 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9036 22 176 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9012 24 175 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8929 22 178 3.40.30.10
ID Description Score Start End GO Terms
AF-T0GKY6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.968 18 178 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A3D0W881-F1-model_v4 3-demethylubiquinone-9 3-O-methyltransferase 0.9576 22 178 GO:0010420
GO:0016209
GO:0016491
GO:0032259
GO:0061542
AF-A0A433BQA3-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9559 20 174 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A0A1H638-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9527 18 176 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A520JQ57-F1-model_v4 Peroxiredoxin 0.9483 65 178 GO:0016209
GO:0016491

Map