F439219
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 418 | 210 | 418 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100067416|Ga0070690_1000674161 |
| Length | 355 |
| Sequence | MAFAHHWQATLQRDIGLCLQSPDRSESDVKRAWMRYAIEDRRQMLIKRRWFAGACVAHALIAWDLSSLAPGARAQDIEPRAYSNAPVGVNFLIGGYAYTRGGIAFGAQLPITNPHLDTSSAVLAYARVLDLWGMSAKFDAIVPYTWLSGTAEYKGETVSRSVNGFANAAFRLSVNFYGAPALTLKEFTGWEQDLIVGASLRVIAPVGQYDDTRLVNIGNNRWSFKPEIGISKAIGPWTFEGTAGATFYTDNNNFFGGKMLSQNPIYSVQAHVIYGFASGVWTSFDATYFTGGRTTVDGVLNSDLQQNWRLGATLAVPVDRRNSIKFYASTGVASRTGNDFDLLGIAWQYRWGGGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 146 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 147 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 150 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 155 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 188 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 207 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 93.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_7592505 | 2162886011 | Bacteria | 1283 |
| 2 | Ga0065712_10103642 | 3300005290 | Bacteria | 1980 |
| 3 | Ga0065715_10126385 | 3300005293 | Bacteria | 2110 |
| 4 | Ga0065715_10159342 | 3300005293 | Bacteria | 1645 |
| 5 | Ga0070683_100007283 | 3300005329 | Bacteria | 9333 |
| 6 | Ga0070683_100007569 | 3300005329 | Bacteria | 9182 |
| 7 | Ga0070683_100021701 | 3300005329 | Bacteria | 5733 |
| 8 | Ga0070690_100067416 | 3300005330 | Bacteria | 2319 |
| 9 | Ga0070690_100149864 | 3300005330 | Bacteria | 1590 |
| 10 | Ga0070670_100271087 | 3300005331 | Bacteria | 1481 |
| 11 | Ga0070670_100275971 | 3300005331 | Bacteria | 1467 |
| 12 | Ga0070670_100277846 | 3300005331 | Bacteria | 1462 |
| 13 | Ga0068869_100070729 | 3300005334 | Bacteria | 2582 |
| 14 | Ga0070666_10009625 | 3300005335 | Bacteria | 6031 |
| 15 | Ga0070666_10009810 | 3300005335 | Bacteria | 5982 |
| 16 | Ga0070666_10080029 | 3300005335 | Unclassified | 2232 |
| 17 | Ga0070666_10092234 | 3300005335 | Bacteria | 2082 |
| 18 | Ga0068868_100019180 | 3300005338 | Bacteria | 5124 |
| 19 | Ga0068868_100221886 | 3300005338 | Bacteria | 1583 |
| 20 | Ga0070689_100194851 | 3300005340 | Bacteria | 1651 |
| 21 | Ga0070668_100122564 | 3300005347 | Bacteria | 2079 |
| 22 | Ga0070668_100179628 | 3300005347 | Bacteria | 1728 |
| 23 | Ga0070668_100412439 | 3300005347 | Bacteria | 1155 |
| 24 | Ga0070669_100026478 | 3300005353 | Bacteria | 4172 |
| 25 | Ga0070669_100351202 | 3300005353 | Unclassified | 1197 |
| 26 | Ga0070675_100002928 | 3300005354 | Bacteria | 12874 |
| 27 | Ga0070675_100099353 | 3300005354 | Bacteria | 2449 |
| 28 | Ga0070675_100193486 | 3300005354 | Unclassified | 1763 |
| 29 | Ga0070675_100207383 | 3300005354 | Bacteria | 1703 |
| 30 | Ga0070671_100020833 | 3300005355 | Bacteria | 5348 |
| 31 | Ga0070671_100045346 | 3300005355 | Bacteria | 3654 |
| 32 | Ga0070671_100068303 | 3300005355 | Bacteria | 2964 |
| 33 | Ga0070674_100006794 | 3300005356 | Bacteria | 6703 |
| 34 | Ga0070674_100028002 | 3300005356 | Bacteria | 3698 |
| 35 | Ga0070674_100037952 | 3300005356 | Bacteria | 3243 |
| 36 | Ga0070674_100165295 | 3300005356 | Unclassified | 1682 |
| 37 | Ga0070674_100243259 | 3300005356 | Bacteria | 1410 |
| 38 | Ga0070673_100123808 | 3300005364 | Bacteria | 2161 |
| 39 | Ga0070673_100370191 | 3300005364 | Unclassified | 1276 |
| 40 | Ga0070688_100357202 | 3300005365 | Bacteria | 1071 |
| 41 | Ga0070659_100003949 | 3300005366 | Bacteria | 10550 |
| 42 | Ga0070659_100045121 | 3300005366 | Bacteria | 3452 |
| 43 | Ga0070667_100019832 | 3300005367 | Bacteria | 5580 |
| 44 | Ga0070667_100019846 | 3300005367 | Bacteria | 5577 |
| 45 | Ga0070667_100076640 | 3300005367 | Bacteria | 2855 |
| 46 | Ga0070713_100000036 | 3300005436 | Bacteria | 85712 |
| 47 | Ga0070708_100020363 | 3300005445 | Bacteria | 5593 |
| 48 | Ga0070663_100012610 | 3300005455 | Bacteria | 5356 |
| 49 | Ga0070678_100000638 | 3300005456 | Bacteria | 17152 |
| 50 | Ga0070678_100247285 | 3300005456 | Bacteria | 1494 |
| 51 | Ga0070662_100002620 | 3300005457 | Bacteria | 11099 |
| 52 | Ga0070662_100428134 | 3300005457 | Unclassified | 1096 |
| 53 | Ga0070681_10315671 | 3300005458 | Unclassified | 1472 |
| 54 | Ga0068867_100131421 | 3300005459 | Bacteria | 1946 |
| 55 | Ga0068867_100177628 | 3300005459 | Bacteria | 1691 |
| 56 | Ga0070707_100286217 | 3300005468 | Bacteria | 1601 |
| 57 | Ga0070684_100009526 | 3300005535 | Bacteria | 7652 |
| 58 | Ga0070684_100017912 | 3300005535 | Bacteria | 5822 |
| 59 | Ga0070697_100016263 | 3300005536 | Bacteria | 5849 |
| 60 | Ga0068853_100052194 | 3300005539 | Bacteria | 3522 |
| 61 | Ga0068853_100287316 | 3300005539 | Bacteria | 1517 |
| 62 | Ga0070672_100002101 | 3300005543 | Bacteria | 12567 |
| 63 | Ga0070672_100031018 | 3300005543 | Bacteria | 4020 |
| 64 | Ga0070672_100251582 | 3300005543 | Bacteria | 1488 |
| 65 | Ga0070693_100014316 | 3300005547 | Bacteria | 4062 |
| 66 | Ga0070693_100091593 | 3300005547 | Bacteria | 1834 |
| 67 | Ga0070693_100103965 | 3300005547 | Bacteria | 1735 |
| 68 | Ga0070665_100381880 | 3300005548 | Unclassified | 1416 |
| 69 | Ga0070704_100022161 | 3300005549 | Unclassified | 4131 |
| 70 | Ga0070664_100024682 | 3300005564 | Bacteria | 4976 |
| 71 | Ga0070664_100036203 | 3300005564 | Bacteria | 4147 |
| 72 | Ga0070664_100070701 | 3300005564 | Bacteria | 2989 |
| 73 | Ga0070664_100085512 | 3300005564 | Bacteria | 2724 |
| 74 | Ga0070664_100319207 | 3300005564 | Unclassified | 1407 |
| 75 | Ga0068857_100004247 | 3300005577 | Bacteria | 12075 |
| 76 | Ga0068857_100045883 | 3300005577 | Bacteria | 3878 |
| 77 | Ga0068857_100130273 | 3300005577 | Bacteria | 2268 |
| 78 | Ga0068854_100393361 | 3300005578 | Bacteria | 1145 |
| 79 | Ga0068856_100073083 | 3300005614 | Plasmid | 3396 |
| 80 | Ga0068856_100179463 | 3300005614 | Bacteria | 2130 |
| 81 | Ga0070702_100013188 | 3300005615 | Bacteria | 4166 |
| 82 | Ga0068852_100001418 | 3300005616 | Bacteria | 16176 |
| 83 | Ga0068852_100168867 | 3300005616 | Bacteria | 2049 |
| 84 | Ga0068859_100007928 | 3300005617 | Bacteria | 10771 |
| 85 | Ga0068859_100022490 | 3300005617 | Bacteria | 6322 |
| 86 | Ga0068859_100229601 | 3300005617 | Bacteria | 1944 |
| 87 | Ga0068864_100003764 | 3300005618 | Bacteria | 12517 |
| 88 | Ga0068864_100036407 | 3300005618 | Bacteria | 4195 |
| 89 | Ga0068864_100075412 | 3300005618 | Bacteria | 2945 |
| 90 | Ga0068864_100096288 | 3300005618 | Bacteria | 2619 |
| 91 | Ga0068864_100155266 | 3300005618 | Bacteria | 2077 |
| 92 | Ga0068864_100370581 | 3300005618 | Bacteria | 1355 |
| 93 | Ga0068866_10007113 | 3300005718 | Bacteria | 4678 |
| 94 | Ga0068861_100171758 | 3300005719 | Bacteria | 1797 |
| 95 | Ga0068861_100389742 | 3300005719 | Unclassified | 1233 |
| 96 | Ga0068851_10010324 | 3300005834 | Bacteria | 4356 |
| 97 | Ga0068851_10017878 | 3300005834 | Bacteria | 3412 |
| 98 | Ga0068851_10099419 | 3300005834 | Bacteria | 1542 |
| 99 | Ga0068870_10055685 | 3300005840 | Bacteria | 2108 |
| 100 | Ga0068863_100073020 | 3300005841 | Bacteria | 3245 |
| 101 | Ga0068858_100024786 | 3300005842 | Bacteria | 5586 |
| 102 | Ga0068860_100003065 | 3300005843 | Bacteria | 17265 |
| 103 | Ga0068860_100061501 | 3300005843 | Bacteria | 3568 |
| 104 | Ga0068860_100075079 | 3300005843 | Unclassified | 3216 |
| 105 | Ga0068860_100093831 | 3300005843 | Bacteria | 2860 |
| 106 | Ga0068860_100270503 | 3300005843 | Unclassified | 1658 |
| 107 | Ga0068862_100091650 | 3300005844 | Bacteria | 2648 |
| 108 | Ga0081455_10268840 | 3300005937 | Bacteria | 1238 |
| 109 | Ga0097621_100009265 | 3300006237 | Bacteria | 7143 |
| 110 | Ga0097621_100010631 | 3300006237 | Bacteria | 6743 |
| 111 | Ga0097621_100010721 | 3300006237 | Bacteria | 6720 |
| 112 | Ga0097621_100029936 | 3300006237 | Bacteria | 4304 |
| 113 | Ga0097621_100030481 | 3300006237 | Bacteria | 4270 |
| 114 | Ga0097621_100096872 | 3300006237 | Bacteria | 2476 |
| 115 | Ga0097621_100356106 | 3300006237 | Bacteria | 1303 |
| 116 | Ga0068871_100012734 | 3300006358 | Bacteria | 6219 |
| 117 | Ga0068871_100062946 | 3300006358 | Bacteria | 3033 |
| 118 | Ga0068871_100077315 | 3300006358 | Bacteria | 2750 |
| 119 | Ga0075428_100101303 | 3300006844 | Bacteria | 3140 |
| 120 | Ga0075433_10274588 | 3300006852 | Bacteria | 1494 |
| 121 | Ga0075434_100254274 | 3300006871 | Unclassified | 1776 |
| 122 | Ga0075434_100353622 | 3300006871 | Bacteria | 1490 |
| 123 | Ga0075434_100559392 | 3300006871 | Unclassified | 1163 |
| 124 | Ga0068865_100018449 | 3300006881 | Bacteria | 4501 |
| 125 | Ga0068865_100025526 | 3300006881 | Bacteria | 3887 |
| 126 | Ga0068865_100133488 | 3300006881 | Unclassified | 1862 |
| 127 | Ga0097620_100007928 | 3300006931 | Bacteria | 10771 |
| 128 | Ga0097620_100022490 | 3300006931 | Bacteria | 6322 |
| 129 | Ga0097620_100229609 | 3300006931 | Bacteria | 1944 |
| 130 | Ga0099794_10000571 | 3300007265 | Bacteria | 12352 |
| 131 | Ga0105240_10010886 | 3300009093 | Bacteria | 12740 |
| 132 | Ga0105240_10043140 | 3300009093 | Bacteria | 5742 |
| 133 | Ga0111539_10164923 | 3300009094 | Bacteria | 2591 |
| 134 | Ga0111539_10218960 | 3300009094 | Bacteria | 2217 |
| 135 | Ga0105245_10010414 | 3300009098 | Bacteria | 8097 |
| 136 | Ga0114129_10994481 | 3300009147 | Unclassified | 1057 |
| 137 | Ga0105243_10159982 | 3300009148 | Bacteria | 1941 |
| 138 | Ga0105241_10010058 | 3300009174 | Bacteria | 6944 |
| 139 | Ga0105241_10207637 | 3300009174 | Bacteria | 1640 |
| 140 | Ga0105241_10343874 | 3300009174 | Bacteria | 1293 |
| 141 | Ga0105242_10000724 | 3300009176 | Bacteria | 25786 |
| 142 | Ga0105242_10001208 | 3300009176 | Bacteria | 20409 |
| 143 | Ga0105242_10015404 | 3300009176 | Bacteria | 5937 |
| 144 | Ga0105242_10180609 | 3300009176 | Bacteria | 1861 |
| 145 | Ga0105248_10000999 | 3300009177 | Bacteria | 31268 |
| 146 | Ga0105248_10042355 | 3300009177 | Bacteria | 5106 |
| 147 | Ga0105248_10043800 | 3300009177 | Bacteria | 5019 |
| 148 | Ga0105248_10072724 | 3300009177 | Bacteria | 3864 |
| 149 | Ga0105248_10081679 | 3300009177 | Bacteria | 3633 |
| 150 | Ga0105248_10286094 | 3300009177 | Bacteria | 1856 |
| 151 | Ga0105248_10359629 | 3300009177 | Unclassified | 1639 |
| 152 | Ga0105248_10373856 | 3300009177 | Bacteria | 1604 |
| 153 | Ga0105237_10007370 | 3300009545 | Bacteria | 12051 |
| 154 | Ga0105238_10001949 | 3300009551 | Bacteria | 20771 |
| 155 | Ga0105238_10008744 | 3300009551 | Bacteria | 10130 |
| 156 | Ga0105238_10017302 | 3300009551 | Bacteria | 7324 |
| 157 | Ga0105238_10247844 | 3300009551 | Bacteria | 1759 |
| 158 | Ga0105249_10047072 | 3300009553 | Bacteria | 3928 |
| 159 | Ga0105249_10047834 | 3300009553 | Bacteria | 3899 |
| 160 | Ga0105239_10009168 | 3300010375 | Bacteria | 11194 |
| 161 | Ga0105239_10393395 | 3300010375 | Bacteria | 1568 |
| 162 | Ga0105246_10008085 | 3300011119 | Bacteria | 6456 |
| 163 | Ga0157327_1002805 | 3300012512 | Bacteria | 1234 |
| 164 | Ga0157373_10014339 | 3300013100 | Bacteria | 5809 |
| 165 | Ga0157371_10051377 | 3300013102 | Bacteria | 2929 |
| 166 | Ga0157369_10028252 | 3300013105 | Bacteria | 6209 |
| 167 | Ga0157374_10021201 | 3300013296 | Bacteria | 5777 |
| 168 | Ga0157374_10068711 | 3300013296 | Bacteria | 3334 |
| 169 | Ga0157374_10153301 | 3300013296 | Bacteria | 2241 |
| 170 | Ga0157378_10042600 | 3300013297 | Bacteria | 4029 |
| 171 | Ga0157378_10323636 | 3300013297 | Bacteria | 1498 |
| 172 | Ga0163162_10010684 | 3300013306 | Bacteria | 8929 |
| 173 | Ga0163162_10196261 | 3300013306 | Bacteria | 2147 |
| 174 | Ga0163162_10237423 | 3300013306 | Unclassified | 1953 |
| 175 | Ga0163162_10357817 | 3300013306 | Bacteria | 1593 |
| 176 | Ga0163162_10413350 | 3300013306 | Bacteria | 1481 |
| 177 | Ga0157372_10024931 | 3300013307 | Bacteria | 6500 |
| 178 | Ga0157375_10000333 | 3300013308 | Bacteria | 42507 |
| 179 | Ga0157375_10001631 | 3300013308 | Bacteria | 19296 |
| 180 | Ga0157375_10076840 | 3300013308 | Bacteria | 3367 |
| 181 | Ga0157375_10299070 | 3300013308 | Bacteria | 1773 |
| 182 | Ga0157375_10389428 | 3300013308 | Bacteria | 1560 |
| 183 | Ga0163163_10001829 | 3300014325 | Bacteria | 17965 |
| 184 | Ga0163163_10006388 | 3300014325 | Bacteria | 10297 |
| 185 | Ga0163163_10277857 | 3300014325 | Bacteria | 1726 |
| 186 | Ga0157380_10037036 | 3300014326 | Bacteria | 3779 |
| 187 | Ga0157380_10064571 | 3300014326 | Bacteria | 2939 |
| 188 | Ga0157377_10004817 | 3300014745 | Bacteria | 6267 |
| 189 | Ga0157377_10049667 | 3300014745 | Bacteria | 2359 |
| 190 | Ga0157379_10005400 | 3300014968 | Bacteria | 10975 |
| 191 | Ga0157379_10012597 | 3300014968 | Bacteria | 7386 |
| 192 | Ga0157379_10031090 | 3300014968 | Bacteria | 4757 |
| 193 | Ga0157379_10114355 | 3300014968 | Bacteria | 2426 |
| 194 | Ga0157379_10307829 | 3300014968 | Bacteria | 1445 |
| 195 | Ga0157376_10006341 | 3300014969 | Bacteria | 8355 |
| 196 | Ga0157376_10009396 | 3300014969 | Bacteria | 7103 |
| 197 | Ga0157376_10020704 | 3300014969 | Bacteria | 5096 |
| 198 | Ga0157376_10034904 | 3300014969 | Unclassified | 4064 |
| 199 | Ga0157376_10068164 | 3300014969 | Bacteria | 3012 |
| 200 | Ga0163161_10024912 | 3300017792 | Bacteria | 4229 |
| 201 | Ga0163161_10216737 | 3300017792 | Bacteria | 1481 |
| 202 | Ga0207673_1001939 | 3300025290 | Bacteria | 2312 |
| 203 | Ga0207697_10000636 | 3300025315 | Bacteria | 20008 |
| 204 | Ga0207656_10012219 | 3300025321 | Bacteria | 3260 |
| 205 | Ga0207682_10009735 | 3300025893 | Bacteria | 3787 |
| 206 | Ga0207682_10095649 | 3300025893 | Bacteria | 1293 |
| 207 | Ga0207688_10032713 | 3300025901 | Bacteria | 2875 |
| 208 | Ga0207688_10054921 | 3300025901 | Bacteria | 2235 |
| 209 | Ga0207680_10051144 | 3300025903 | Unclassified | 2470 |
| 210 | Ga0207680_10093057 | 3300025903 | Unclassified | 1922 |
| 211 | Ga0207645_10010753 | 3300025907 | Bacteria | 6273 |
| 212 | Ga0207643_10026448 | 3300025908 | Bacteria | 3212 |
| 213 | Ga0207684_10050242 | 3300025910 | Bacteria | 3537 |
| 214 | Ga0207654_10027282 | 3300025911 | Plasmid | 3103 |
| 215 | Ga0207695_10189744 | 3300025913 | Unclassified | 1973 |
| 216 | Ga0207671_10008897 | 3300025914 | Bacteria | 8454 |
| 217 | Ga0207693_10232272 | 3300025915 | Bacteria | 1448 |
| 218 | Ga0207662_10058738 | 3300025918 | Bacteria | 2303 |
| 219 | Ga0207657_10128742 | 3300025919 | Bacteria | 2077 |
| 220 | Ga0207649_10255874 | 3300025920 | Bacteria | 1263 |
| 221 | Ga0207646_10175364 | 3300025922 | Bacteria | 1936 |
| 222 | Ga0207681_10146981 | 3300025923 | Bacteria | 1762 |
| 223 | Ga0207694_10007299 | 3300025924 | Bacteria | 8386 |
| 224 | Ga0207694_10084727 | 3300025924 | Bacteria | 2493 |
| 225 | Ga0207694_10107013 | 3300025924 | Bacteria | 2221 |
| 226 | Ga0207694_10147658 | 3300025924 | Bacteria | 1893 |
| 227 | Ga0207650_10002128 | 3300025925 | Bacteria | 13846 |
| 228 | Ga0207650_10187019 | 3300025925 | Bacteria | 1653 |
| 229 | Ga0207659_10000664 | 3300025926 | Bacteria | 20333 |
| 230 | Ga0207659_10021996 | 3300025926 | Bacteria | 4241 |
| 231 | Ga0207659_10034836 | 3300025926 | Bacteria | 3475 |
| 232 | Ga0207659_10036134 | 3300025926 | Bacteria | 3420 |
| 233 | Ga0207687_10047296 | 3300025927 | Bacteria | 2982 |
| 234 | Ga0207700_10000062 | 3300025928 | Bacteria | 66509 |
| 235 | Ga0207644_10000233 | 3300025931 | Bacteria | 38178 |
| 236 | Ga0207644_10023972 | 3300025931 | Bacteria | 4184 |
| 237 | Ga0207644_10048631 | 3300025931 | Bacteria | 3034 |
| 238 | Ga0207686_10003009 | 3300025934 | Bacteria | 9079 |
| 239 | Ga0207686_10020173 | 3300025934 | Bacteria | 3804 |
| 240 | Ga0207686_10020539 | 3300025934 | Bacteria | 3775 |
| 241 | Ga0207670_10303837 | 3300025936 | Bacteria | 1250 |
| 242 | Ga0207669_10003255 | 3300025937 | Bacteria | 7022 |
| 243 | Ga0207669_10031578 | 3300025937 | Bacteria | 2961 |
| 244 | Ga0207704_10002246 | 3300025938 | Bacteria | 8672 |
| 245 | Ga0207704_10006594 | 3300025938 | Bacteria | 5431 |
| 246 | Ga0207704_10058093 | 3300025938 | Unclassified | 2380 |
| 247 | Ga0207704_10098255 | 3300025938 | Bacteria | 1944 |
| 248 | Ga0207691_10003840 | 3300025940 | Bacteria | 14579 |
| 249 | Ga0207691_10003969 | 3300025940 | Bacteria | 14365 |
| 250 | Ga0207691_10320333 | 3300025940 | Bacteria | 1329 |
| 251 | Ga0207711_10004733 | 3300025941 | Bacteria | 11570 |
| 252 | Ga0207711_10031230 | 3300025941 | Bacteria | 4496 |
| 253 | Ga0207711_10031241 | 3300025941 | Bacteria | 4495 |
| 254 | Ga0207711_10052634 | 3300025941 | Bacteria | 3490 |
| 255 | Ga0207689_10003781 | 3300025942 | Bacteria | 13791 |
| 256 | Ga0207689_10011125 | 3300025942 | Bacteria | 7724 |
| 257 | Ga0207661_10025233 | 3300025944 | Bacteria | 4516 |
| 258 | Ga0207661_10038672 | 3300025944 | Bacteria | 3741 |
| 259 | Ga0207661_10237695 | 3300025944 | Bacteria | 1615 |
| 260 | Ga0207679_10008845 | 3300025945 | Bacteria | 6420 |
| 261 | Ga0207667_10361797 | 3300025949 | Bacteria | 1479 |
| 262 | Ga0207667_10540345 | 3300025949 | Unclassified | 1179 |
| 263 | Ga0207651_10430513 | 3300025960 | Bacteria | 1128 |
| 264 | Ga0207712_10143477 | 3300025961 | Unclassified | 1835 |
| 265 | Ga0207668_10007881 | 3300025972 | Bacteria | 6332 |
| 266 | Ga0207668_10053961 | 3300025972 | Bacteria | 2788 |
| 267 | Ga0207668_10116163 | 3300025972 | Bacteria | 2017 |
| 268 | Ga0207640_10340225 | 3300025981 | Bacteria | 1201 |
| 269 | Ga0207658_10006346 | 3300025986 | Bacteria | 8072 |
| 270 | Ga0207658_10015011 | 3300025986 | Bacteria | 5311 |
| 271 | Ga0207658_10142852 | 3300025986 | Bacteria | 1940 |
| 272 | Ga0207658_10249127 | 3300025986 | Bacteria | 1508 |
| 273 | Ga0207658_10394240 | 3300025986 | Bacteria | 1215 |
| 274 | Ga0207677_10021186 | 3300026023 | Bacteria | 3965 |
| 275 | Ga0207677_10188116 | 3300026023 | Bacteria | 1631 |
| 276 | Ga0207703_10008093 | 3300026035 | Bacteria | 8310 |
| 277 | Ga0207703_10122351 | 3300026035 | Bacteria | 2235 |
| 278 | Ga0207639_10061422 | 3300026041 | Bacteria | 2902 |
| 279 | Ga0207639_10133194 | 3300026041 | Bacteria | 2060 |
| 280 | Ga0207678_10023230 | 3300026067 | Bacteria | 5424 |
| 281 | Ga0207678_10075367 | 3300026067 | Unclassified | 2890 |
| 282 | Ga0207678_10107031 | 3300026067 | Bacteria | 2385 |
| 283 | Ga0207678_10128312 | 3300026067 | Bacteria | 2163 |
| 284 | Ga0207708_10035715 | 3300026075 | Bacteria | 3782 |
| 285 | Ga0207708_10280698 | 3300026075 | Bacteria | 1350 |
| 286 | Ga0207702_10124601 | 3300026078 | Unclassified | 2311 |
| 287 | Ga0207641_10056162 | 3300026088 | Bacteria | 3345 |
| 288 | Ga0207641_10079776 | 3300026088 | Bacteria | 2838 |
| 289 | Ga0207641_10480308 | 3300026088 | Unclassified | 1204 |
| 290 | Ga0207648_10007183 | 3300026089 | Bacteria | 10980 |
| 291 | Ga0207648_10012816 | 3300026089 | Bacteria | 7832 |
| 292 | Ga0207648_10017961 | 3300026089 | Bacteria | 6415 |
| 293 | Ga0207648_10131370 | 3300026089 | Bacteria | 2204 |
| 294 | Ga0207648_10183735 | 3300026089 | Bacteria | 1851 |
| 295 | Ga0207648_10216323 | 3300026089 | Bacteria | 1702 |
| 296 | Ga0207648_10309248 | 3300026089 | Unclassified | 1418 |
| 297 | Ga0207676_10039185 | 3300026095 | Bacteria | 3623 |
| 298 | Ga0207676_10057673 | 3300026095 | Bacteria | 3060 |
| 299 | Ga0207676_10089527 | 3300026095 | Bacteria | 2522 |
| 300 | Ga0207674_10001186 | 3300026116 | Bacteria | 33879 |
| 301 | Ga0207674_10009808 | 3300026116 | Bacteria | 10905 |
| 302 | Ga0207674_10032329 | 3300026116 | Bacteria | 5489 |
| 303 | Ga0207675_100227245 | 3300026118 | Bacteria | 1800 |
| 304 | Ga0207683_10006420 | 3300026121 | Bacteria | 10070 |
| 305 | Ga0207683_10010862 | 3300026121 | Bacteria | 7765 |
| 306 | Ga0207683_10014853 | 3300026121 | Bacteria | 6630 |
| 307 | Ga0207698_10214510 | 3300026142 | Bacteria | 1734 |
| 308 | Ga0207698_10400457 | 3300026142 | Bacteria | 1312 |
| 309 | Ga0209588_1015076 | 3300027671 | Bacteria | 2374 |
| 310 | Ga0209974_10004157 | 3300027876 | Bacteria | 5175 |
| 311 | Ga0209974_10075478 | 3300027876 | Bacteria | 1154 |
| 312 | Ga0268266_10021684 | 3300028379 | Bacteria | 5474 |
| 313 | Ga0268266_10030419 | 3300028379 | Bacteria | 4587 |
| 314 | Ga0268266_10046881 | 3300028379 | Unclassified | 3700 |
| 315 | Ga0268265_10055773 | 3300028380 | Bacteria | 3004 |
| 316 | Ga0268265_10112440 | 3300028380 | Bacteria | 2226 |
| 317 | Ga0268264_10030417 | 3300028381 | Bacteria | 4425 |
| 318 | Ga0268264_10113878 | 3300028381 | Bacteria | 2374 |
| 319 | Ga0268264_10340952 | 3300028381 | Unclassified | 1424 |
| 320 | Ga0316579_10082015 | 3300031691 | Bacteria | 1536 |
| 321 | Ga0316576_10207425 | 3300031727 | Bacteria | 1475 |
| 322 | Ga0316578_10028651 | 3300031728 | Bacteria | 3155 |
| 323 | Ga0307415_100339032 | 3300032126 | Bacteria | 1261 |
| 324 | Ga0316583_10029768 | 3300032133 | Bacteria | 1946 |
| 325 | Ga0316583_10058517 | 3300032133 | Bacteria | 1352 |
| 326 | Ga0316585_10037739 | 3300032137 | Bacteria | 1534 |
| 327 | Ga0373942_0020889 | 3300035207 | Bacteria | 1648 |
| 328 | Ga0316574_0005072 | 3300035398 | Bacteria | 6995 |
| 329 | Ga0316574_0008289 | 3300035398 | Bacteria | 5762 |
| 330 | Ga0316574_0165325 | 3300035398 | Bacteria | 1425 |
| 331 | Ga0373937_0003233 | 3300036401 | Bacteria | 13655 |
| 332 | Ga0373937_0089518 | 3300036401 | Bacteria | 2850 |
| 333 | Ga0373937_0106919 | 3300036401 | Bacteria | 2601 |
| 334 | Ga0316582_0062026 | 3300036647 | Bacteria | 2400 |
| 335 | Ga0316582_0176218 | 3300036647 | Bacteria | 1453 |
| 336 | Ga0316584_0105527 | 3300036712 | Bacteria | 2108 |
| 337 | Ga0373925_0001480 | 3300037068 | Bacteria | 20166 |
| 338 | Ga0373925_0037519 | 3300037068 | Bacteria | 3578 |
| 339 | Ga0373925_0052701 | 3300037068 | Bacteria | 3040 |
| 340 | Ga0395905_0002034 | 3300037471 | Bacteria | 23113 |
| 341 | Ga0395901_0063846 | 3300038443 | Bacteria | 3833 |
| 342 | Ga0451576_0004712 | 3300045051 | Bacteria | 17529 |
| 343 | Ga0451576_0246908 | 3300045051 | Bacteria | 1865 |
| 344 | Ga0451576_0279598 | 3300045051 | Bacteria | 1745 |
| 345 | Ga0495629_0031239 | 3300046459 | Bacteria | 3772 |
| 346 | Ga0495580_0057270 | 3300046472 | Bacteria | 2743 |
| 347 | Ga0495582_0000764 | 3300046473 | Bacteria | 17782 |
| 348 | Ga0495582_0020045 | 3300046473 | Bacteria | 3658 |
| 349 | Ga0495665_0002433 | 3300046531 | Bacteria | 10061 |
| 350 | Ga0495621_0004102 | 3300046539 | Bacteria | 4058 |
| 351 | Ga0495621_0013084 | 3300046539 | Bacteria | 2602 |
| 352 | Ga0495621_0021322 | 3300046539 | Bacteria | 2136 |
| 353 | Ga0495621_0030729 | 3300046539 | Bacteria | 1838 |
| 354 | Ga0495656_0000764 | 3300046615 | Bacteria | 10377 |
| 355 | Ga0495656_0019838 | 3300046615 | Bacteria | 2600 |
| 356 | Ga0495635_0019328 | 3300046663 | Bacteria | 4751 |
| 357 | Ga0495647_0001707 | 3300046681 | Bacteria | 6801 |
| 358 | Ga0495658_0002717 | 3300046683 | Bacteria | 8902 |
| 359 | Ga0495658_0057370 | 3300046683 | Unclassified | 2224 |
| 360 | Ga0495658_0076807 | 3300046683 | Bacteria | 1953 |
| 361 | Ga0495658_0148962 | 3300046683 | Unclassified | 1436 |
| 362 | Ga0495600_0122092 | 3300046809 | Bacteria | 1694 |
| 363 | Ga0495581_0012742 | 3300047315 | Bacteria | 4870 |
| 364 | Ga0495636_0000187 | 3300047318 | Bacteria | 24622 |
| 365 | Ga0495636_0002043 | 3300047318 | Bacteria | 7741 |
| 366 | Ga0495636_0067855 | 3300047318 | Bacteria | 1518 |
| 367 | Ga0495677_0038851 | 3300047445 | Bacteria | 1739 |
| 368 | Ga0495685_039058 | 3300047447 | Bacteria | 1625 |
| 369 | Ga0495684_0002042 | 3300047471 | Bacteria | 16246 |
| 370 | Ga0496100_0032732 | 3300048903 | Bacteria | 3246 |
| 371 | Ga0496100_0219627 | 3300048903 | Bacteria | 1394 |
| 372 | Ga0496101_0062410 | 3300048904 | Bacteria | 2709 |
| 373 | Ga0496102_0332183 | 3300048905 | Bacteria | 1432 |
| 374 | Ga0496104_0000058 | 3300048907 | Bacteria | 118768 |
| 375 | Ga0496104_0286036 | 3300048907 | Bacteria | 1561 |
| 376 | Ga0496105_0000048 | 3300048908 | Bacteria | 96832 |
| 377 | Ga0496106_0139314 | 3300048909 | Bacteria | 1907 |
| 378 | Ga0496106_0164674 | 3300048909 | Bacteria | 1755 |
| 379 | Ga0496107_0058866 | 3300048910 | Bacteria | 2779 |
| 380 | Ga0496107_0159383 | 3300048910 | Bacteria | 1672 |
| 381 | Ga0496107_0226286 | 3300048910 | Bacteria | 1392 |
| 382 | Ga0496108_0020280 | 3300048911 | Bacteria | 5463 |
| 383 | Ga0496109_0078508 | 3300048912 | Bacteria | 3040 |
| 384 | Ga0496110_0018092 | 3300048913 | Bacteria | 5904 |
| 385 | Ga0496110_0189352 | 3300048913 | Bacteria | 1868 |
| 386 | Ga0496112_0008262 | 3300048915 | Bacteria | 9314 |
| 387 | Ga0496112_0366646 | 3300048915 | Bacteria | 1382 |
| 388 | Ga0496112_0605053 | 3300048915 | Unclassified | 1028 |
| 389 | Ga0496113_0009939 | 3300048916 | Bacteria | 6268 |
| 390 | Ga0496114_0171856 | 3300048917 | Bacteria | 1889 |
| 391 | Ga0496114_0348966 | 3300048917 | Bacteria | 1309 |
| 392 | Ga0496114_0447780 | 3300048917 | Unclassified | 1144 |
| 393 | Ga0496115_0340092 | 3300048918 | Bacteria | 1225 |
| 394 | Ga0501033_0206122 | 3300049570 | Bacteria | 1403 |
| 395 | Ga0501037_0144507 | 3300049573 | Bacteria | 1702 |
| 396 | Ga0501038_0021316 | 3300049574 | Bacteria | 5818 |
| 397 | Ga0501041_0008327 | 3300049577 | Bacteria | 6102 |
| 398 | Ga0501042_0037591 | 3300049578 | Bacteria | 3436 |
| 399 | Ga0501046_0024118 | 3300049580 | Bacteria | 4995 |
| 400 | Ga0501071_0278530 | 3300049587 | Bacteria | 1266 |
| 401 | Ga0501072_0124264 | 3300049588 | Bacteria | 2056 |
| 402 | Ga0501075_0038812 | 3300049591 | Bacteria | 3561 |
| 403 | Ga0501075_0467638 | 3300049591 | Bacteria | 962 |
| 404 | Ga0501076_0000182 | 3300049592 | Bacteria | 37306 |
| 405 | Ga0501077_0002097 | 3300049593 | Bacteria | 12018 |
| 406 | Ga0501079_0074432 | 3300049741 | Bacteria | 2625 |
| 407 | Ga0501081_0000080 | 3300049743 | Bacteria | 38313 |
| 408 | Ga0501045_0022180 | 3300049824 | Bacteria | 4544 |
| 409 | nmdc:mga08y16_312272_c1 | 3300050511 | Unclassified | 1619 |
| 410 | nmdc:mga08y16_89318_c1 | 3300050511 | Bacteria | 3211 |
| 411 | nmdc:mga0n895_396765_c1 | 3300050512 | Bacteria | 1395 |
| 412 | Ga0495601_0163585 | 3300053077 | Bacteria | 1454 |
| 413 | Ga0500572_000409 | 3300053111 | Bacteria | 15071 |
| 414 | Ga0500570_074442 | 3300053724 | Bacteria | 1566 |
| 415 | Ga0501084_0010056 | 3300054114 | Bacteria | 7819 |
| 416 | Ga0501084_0439084 | 3300054114 | Bacteria | 1103 |
| 417 | Ga0501082_0010107 | 3300060353 | Bacteria | 8129 |
| 418 | Ga0530510_0003291 | 3300061734 | Bacteria | 11118 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100559392 | Ga0075434_1005593922 | 274 |
| 2 | 3300045051 | Ga0451576_0004712 | Ga0451576_0004712_14639_15565 | 280 |
| 3 | 3300049570 | Ga0501033_0206122 | Ga0501033_0206122_245_1147 | 280 |
| 4 | 3300049573 | Ga0501037_0144507 | Ga0501037_0144507_404_1306 | 280 |
| 5 | 3300049574 | Ga0501038_0021316 | Ga0501038_0021316_2172_3074 | 280 |
| 6 | 3300049577 | Ga0501041_0008327 | Ga0501041_0008327_388_1290 | 280 |
| 7 | 3300049578 | Ga0501042_0037591 | Ga0501042_0037591_900_1802 | 280 |
| 8 | 3300049580 | Ga0501046_0024118 | Ga0501046_0024118_1482_2384 | 280 |
| 9 | 3300049588 | Ga0501072_0124264 | Ga0501072_0124264_135_1037 | 280 |
| 10 | 3300049591 | Ga0501075_0038812 | Ga0501075_0038812_2523_3425 | 280 |
| 11 | 3300049592 | Ga0501076_0000182 | Ga0501076_0000182_25110_26012 | 280 |
| 12 | 3300049593 | Ga0501077_0002097 | Ga0501077_0002097_5337_6239 | 280 |
| 13 | 3300049741 | Ga0501079_0074432 | Ga0501079_0074432_710_1612 | 280 |
| 14 | 3300049743 | Ga0501081_0000080 | Ga0501081_0000080_32567_33469 | 280 |
| 15 | 3300049824 | Ga0501045_0022180 | Ga0501045_0022180_2413_3315 | 280 |
| 16 | 3300054114 | Ga0501084_0010056 | Ga0501084_0010056_430_1332 | 280 |
| 17 | 3300060353 | Ga0501082_0010107 | Ga0501082_0010107_3795_4697 | 280 |
| 18 | 3300061734 | Ga0530510_0003291 | Ga0530510_0003291_9220_10122 | 280 |
| 19 | 3300006852 | Ga0075433_10274588 | Ga0075433_102745882 | 282 |
| 20 | 3300005353 | Ga0070669_100351202 | Ga0070669_1003512021 | 283 |
| 21 | 3300005445 | Ga0070708_100020363 | Ga0070708_1000203636 | 283 |
| 22 | 3300005536 | Ga0070697_100016263 | Ga0070697_1000162634 | 283 |
| 23 | 3300005719 | Ga0068861_100389742 | Ga0068861_1003897421 | 283 |
| 24 | 3300025910 | Ga0207684_10050242 | Ga0207684_100502425 | 283 |
| 25 | 3300025922 | Ga0207646_10175364 | Ga0207646_101753643 | 283 |
| 26 | 3300050511 | nmdc:mga08y16_312272_c1 | nmdc:mga08y16_312272_c1_304_1188 | 283 |
| 27 | 3300005331 | Ga0070670_100271087 | Ga0070670_1002710872 | 284 |
| 28 | 3300005355 | Ga0070671_100068303 | Ga0070671_1000683032 | 284 |
| 29 | 3300005617 | Ga0068859_100007928 | Ga0068859_1000079286 | 284 |
| 30 | 3300006931 | Ga0097620_100007928 | Ga0097620_1000079286 | 284 |
| 31 | 3300009093 | Ga0105240_10043140 | Ga0105240_100431406 | 284 |
| 32 | 3300009094 | Ga0111539_10164923 | Ga0111539_101649232 | 284 |
| 33 | 3300009174 | Ga0105241_10207637 | Ga0105241_102076371 | 284 |
| 34 | 3300009177 | Ga0105248_10286094 | Ga0105248_102860942 | 284 |
| 35 | 3300009551 | Ga0105238_10008744 | Ga0105238_100087449 | 284 |
| 36 | 3300010375 | Ga0105239_10393395 | Ga0105239_103933952 | 284 |
| 37 | 3300025901 | Ga0207688_10054921 | Ga0207688_100549212 | 284 |
| 38 | 3300025911 | Ga0207654_10027282 | Ga0207654_100272826 | 284 |
| 39 | 3300025927 | Ga0207687_10047296 | Ga0207687_100472962 | 284 |
| 40 | 3300025931 | Ga0207644_10023972 | Ga0207644_100239723 | 284 |
| 41 | 3300025961 | Ga0207712_10143477 | Ga0207712_101434772 | 284 |
| 42 | 3300025972 | Ga0207668_10007881 | Ga0207668_100078812 | 284 |
| 43 | 3300035398 | Ga0316574_0005072 | Ga0316574_0005072_5589_6458 | 284 |
| 44 | 3300036401 | Ga0373937_0003233 | Ga0373937_0003233_2326_3204 | 284 |
| 45 | 3300037068 | Ga0373925_0037519 | Ga0373925_0037519_2408_3268 | 284 |
| 46 | 3300037068 | Ga0373925_0052701 | Ga0373925_0052701_2038_2907 | 284 |
| 47 | 3300046539 | Ga0495621_0013084 | Ga0495621_0013084_434_1318 | 284 |
| 48 | 3300048903 | Ga0496100_0219627 | Ga0496100_0219627_396_1280 | 284 |
| 49 | 3300048904 | Ga0496101_0062410 | Ga0496101_0062410_1294_2178 | 284 |
| 50 | 3300048912 | Ga0496109_0078508 | Ga0496109_0078508_1293_2177 | 284 |
| 51 | 3300048915 | Ga0496112_0008262 | Ga0496112_0008262_1702_2586 | 284 |
| 52 | 3300048916 | Ga0496113_0009939 | Ga0496113_0009939_5080_5964 | 284 |
| 53 | 3300049591 | Ga0501075_0467638 | Ga0501075_0467638_84_950 | 284 |
| 54 | 3300050511 | nmdc:mga08y16_89318_c1 | nmdc:mga08y16_89318_c1_1223_2107 | 284 |
| 55 | 3300009553 | Ga0105249_10047072 | Ga0105249_100470722 | 286 |
| 56 | 3300031728 | Ga0316578_10028651 | Ga0316578_100286512 | 286 |
| 57 | 3300005331 | Ga0070670_100277846 | Ga0070670_1002778462 | 287 |
| 58 | 3300005354 | Ga0070675_100207383 | Ga0070675_1002073832 | 287 |
| 59 | 3300005365 | Ga0070688_100357202 | Ga0070688_1003572021 | 287 |
| 60 | 3300005367 | Ga0070667_100076640 | Ga0070667_1000766402 | 287 |
| 61 | 3300005543 | Ga0070672_100251582 | Ga0070672_1002515822 | 287 |
| 62 | 3300013308 | Ga0157375_10299070 | Ga0157375_102990703 | 287 |
| 63 | 3300025926 | Ga0207659_10021996 | Ga0207659_100219963 | 287 |
| 64 | 3300025940 | Ga0207691_10320333 | Ga0207691_103203331 | 287 |
| 65 | 3300046539 | Ga0495621_0021322 | Ga0495621_0021322_932_1825 | 287 |
| 66 | 3300053111 | Ga0500572_000409 | Ga0500572_000409_2241_3170 | 287 |
| 67 | 3300005338 | Ga0068868_100221886 | Ga0068868_1002218862 | 288 |
| 68 | 3300005356 | Ga0070674_100243259 | Ga0070674_1002432592 | 288 |
| 69 | 3300005459 | Ga0068867_100177628 | Ga0068867_1001776282 | 288 |
| 70 | 3300013306 | Ga0163162_10196261 | Ga0163162_101962612 | 288 |
| 71 | 3300026089 | Ga0207648_10183735 | Ga0207648_101837352 | 288 |
| 72 | 3300026095 | Ga0207676_10039185 | Ga0207676_100391852 | 288 |
| 73 | 3300005329 | Ga0070683_100007283 | Ga0070683_1000072837 | 289 |
| 74 | 3300005347 | Ga0070668_100412439 | Ga0070668_1004124391 | 289 |
| 75 | 3300005354 | Ga0070675_100002928 | Ga0070675_1000029282 | 289 |
| 76 | 3300005355 | Ga0070671_100045346 | Ga0070671_1000453462 | 289 |
| 77 | 3300005356 | Ga0070674_100037952 | Ga0070674_1000379523 | 289 |
| 78 | 3300005366 | Ga0070659_100003949 | Ga0070659_1000039495 | 289 |
| 79 | 3300005535 | Ga0070684_100009526 | Ga0070684_1000095264 | 289 |
| 80 | 3300005539 | Ga0068853_100287316 | Ga0068853_1002873161 | 289 |
| 81 | 3300005547 | Ga0070693_100014316 | Ga0070693_1000143161 | 289 |
| 82 | 3300005549 | Ga0070704_100022161 | Ga0070704_1000221613 | 289 |
| 83 | 3300005577 | Ga0068857_100004247 | Ga0068857_1000042476 | 289 |
| 84 | 3300005614 | Ga0068856_100073083 | Ga0068856_1000730832 | 289 |
| 85 | 3300005618 | Ga0068864_100003764 | Ga0068864_1000037642 | 289 |
| 86 | 3300005834 | Ga0068851_10010324 | Ga0068851_100103242 | 289 |
| 87 | 3300006871 | Ga0075434_100254274 | Ga0075434_1002542742 | 289 |
| 88 | 3300009176 | Ga0105242_10180609 | Ga0105242_101806092 | 289 |
| 89 | 3300013306 | Ga0163162_10237423 | Ga0163162_102374233 | 289 |
| 90 | 3300014325 | Ga0163163_10001829 | Ga0163163_100018298 | 289 |
| 91 | 3300017792 | Ga0163161_10024912 | Ga0163161_100249123 | 289 |
| 92 | 3300025924 | Ga0207694_10147658 | Ga0207694_101476582 | 289 |
| 93 | 3300025926 | Ga0207659_10036134 | Ga0207659_100361342 | 289 |
| 94 | 3300025934 | Ga0207686_10020539 | Ga0207686_100205393 | 289 |
| 95 | 3300025937 | Ga0207669_10031578 | Ga0207669_100315782 | 289 |
| 96 | 3300025938 | Ga0207704_10058093 | Ga0207704_100580933 | 289 |
| 97 | 3300025942 | Ga0207689_10003781 | Ga0207689_1000378113 | 289 |
| 98 | 3300025944 | Ga0207661_10038672 | Ga0207661_100386723 | 289 |
| 99 | 3300025949 | Ga0207667_10361797 | Ga0207667_103617971 | 289 |
| 100 | 3300025972 | Ga0207668_10053961 | Ga0207668_100539611 | 289 |
| 101 | 3300026023 | Ga0207677_10021186 | Ga0207677_100211862 | 289 |
| 102 | 3300026067 | Ga0207678_10128312 | Ga0207678_101283122 | 289 |
| 103 | 3300026078 | Ga0207702_10124601 | Ga0207702_101246012 | 289 |
| 104 | 3300026116 | Ga0207674_10001186 | Ga0207674_1000118623 | 289 |
| 105 | 3300026142 | Ga0207698_10214510 | Ga0207698_102145102 | 289 |
| 106 | 3300048905 | Ga0496102_0332183 | Ga0496102_0332183_177_1100 | 289 |
| 107 | 3300048910 | Ga0496107_0159383 | Ga0496107_0159383_240_1163 | 289 |
| 108 | 3300048917 | Ga0496114_0348966 | Ga0496114_0348966_311_1234 | 289 |
| 109 | 3300050512 | nmdc:mga0n895_396765_c1 | nmdc:mga0n895_396765_c1_220_1128 | 289 |
| 110 | 3300005356 | Ga0070674_100165295 | Ga0070674_1001652952 | 290 |
| 111 | 3300006871 | Ga0075434_100353622 | Ga0075434_1003536222 | 290 |
| 112 | 3300012512 | Ga0157327_1002805 | Ga0157327_10028051 | 290 |
| 113 | 3300027876 | Ga0209974_10075478 | Ga0209974_100754782 | 290 |
| 114 | 3300046683 | Ga0495658_0148962 | Ga0495658_0148962_347_1249 | 290 |
| 115 | 3300009176 | Ga0105242_10000724 | Ga0105242_1000072424 | 291 |
| 116 | 3300013308 | Ga0157375_10000333 | Ga0157375_100003338 | 291 |
| 117 | 3300032126 | Ga0307415_100339032 | Ga0307415_1003390321 | 291 |
| 118 | 3300046539 | Ga0495621_0030729 | Ga0495621_0030729_46_951 | 291 |
| 119 | 3300048907 | Ga0496104_0000058 | Ga0496104_0000058_44555_45466 | 291 |
| 120 | 3300048908 | Ga0496105_0000048 | Ga0496105_0000048_84688_85599 | 291 |
| 121 | 3300005436 | Ga0070713_100000036 | Ga0070713_10000003620 | 292 |
| 122 | 3300005937 | Ga0081455_10268840 | Ga0081455_102688402 | 292 |
| 123 | 3300009147 | Ga0114129_10994481 | Ga0114129_109944811 | 292 |
| 124 | 3300025915 | Ga0207693_10232272 | Ga0207693_102322722 | 292 |
| 125 | 3300025928 | Ga0207700_10000062 | Ga0207700_100000627 | 292 |
| 126 | 3300026142 | Ga0207698_10400457 | Ga0207698_104004572 | 292 |
| 127 | 3300053077 | Ga0495601_0163585 | Ga0495601_0163585_75_983 | 292 |
| 128 | 3300005347 | Ga0070668_100122564 | Ga0070668_1001225643 | 293 |
| 129 | 3300005354 | Ga0070675_100099353 | Ga0070675_1000993532 | 293 |
| 130 | 3300005457 | Ga0070662_100428134 | Ga0070662_1004281341 | 293 |
| 131 | 3300005564 | Ga0070664_100319207 | Ga0070664_1003192071 | 293 |
| 132 | 3300005578 | Ga0068854_100393361 | Ga0068854_1003933611 | 293 |
| 133 | 3300005616 | Ga0068852_100168867 | Ga0068852_1001688672 | 293 |
| 134 | 3300005617 | Ga0068859_100022490 | Ga0068859_1000224907 | 293 |
| 135 | 3300005618 | Ga0068864_100155266 | Ga0068864_1001552662 | 293 |
| 136 | 3300005618 | Ga0068864_100370581 | Ga0068864_1003705812 | 293 |
| 137 | 3300005834 | Ga0068851_10099419 | Ga0068851_100994191 | 293 |
| 138 | 3300005842 | Ga0068858_100024786 | Ga0068858_1000247863 | 293 |
| 139 | 3300006931 | Ga0097620_100022490 | Ga0097620_1000224903 | 293 |
| 140 | 3300009176 | Ga0105242_10015404 | Ga0105242_100154045 | 293 |
| 141 | 3300009551 | Ga0105238_10017302 | Ga0105238_100173026 | 293 |
| 142 | 3300014968 | Ga0157379_10114355 | Ga0157379_101143553 | 293 |
| 143 | 3300025924 | Ga0207694_10107013 | Ga0207694_101070133 | 293 |
| 144 | 3300025934 | Ga0207686_10020173 | Ga0207686_100201734 | 293 |
| 145 | 3300025972 | Ga0207668_10116163 | Ga0207668_101161631 | 293 |
| 146 | 3300026035 | Ga0207703_10008093 | Ga0207703_100080938 | 293 |
| 147 | 3300026067 | Ga0207678_10107031 | Ga0207678_101070312 | 293 |
| 148 | 3300026089 | Ga0207648_10131370 | Ga0207648_101313703 | 293 |
| 149 | 3300026089 | Ga0207648_10309248 | Ga0207648_103092481 | 293 |
| 150 | 3300026095 | Ga0207676_10057673 | Ga0207676_100576733 | 293 |
| 151 | 3300028381 | Ga0268264_10113878 | Ga0268264_101138781 | 293 |
| 152 | 3300028381 | Ga0268264_10340952 | Ga0268264_103409521 | 293 |
| 153 | 3300035207 | Ga0373942_0020889 | Ga0373942_0020889_668_1579 | 293 |
| 154 | 3300048909 | Ga0496106_0164674 | Ga0496106_0164674_636_1544 | 293 |
| 155 | 3300048913 | Ga0496110_0189352 | Ga0496110_0189352_451_1359 | 293 |
| 156 | 3300048915 | Ga0496112_0605053 | Ga0496112_0605053_54_962 | 293 |
| 157 | 3300005329 | Ga0070683_100007569 | Ga0070683_1000075697 | 294 |
| 158 | 3300005340 | Ga0070689_100194851 | Ga0070689_1001948512 | 294 |
| 159 | 3300005356 | Ga0070674_100028002 | Ga0070674_1000280022 | 294 |
| 160 | 3300005539 | Ga0068853_100052194 | Ga0068853_1000521943 | 294 |
| 161 | 3300005543 | Ga0070672_100031018 | Ga0070672_1000310184 | 294 |
| 162 | 3300005547 | Ga0070693_100103965 | Ga0070693_1001039652 | 294 |
| 163 | 3300005564 | Ga0070664_100070701 | Ga0070664_1000707011 | 294 |
| 164 | 3300005616 | Ga0068852_100001418 | Ga0068852_1000014182 | 294 |
| 165 | 3300005718 | Ga0068866_10007113 | Ga0068866_100071132 | 294 |
| 166 | 3300005840 | Ga0068870_10055685 | Ga0068870_100556852 | 294 |
| 167 | 3300005843 | Ga0068860_100093831 | Ga0068860_1000938312 | 294 |
| 168 | 3300005844 | Ga0068862_100091650 | Ga0068862_1000916502 | 294 |
| 169 | 3300006237 | Ga0097621_100009265 | Ga0097621_1000092654 | 294 |
| 170 | 3300006237 | Ga0097621_100096872 | Ga0097621_1000968722 | 294 |
| 171 | 3300006358 | Ga0068871_100077315 | Ga0068871_1000773152 | 294 |
| 172 | 3300006881 | Ga0068865_100018449 | Ga0068865_1000184492 | 294 |
| 173 | 3300013297 | Ga0157378_10042600 | Ga0157378_100426003 | 294 |
| 174 | 3300013306 | Ga0163162_10357817 | Ga0163162_103578172 | 294 |
| 175 | 3300014326 | Ga0157380_10037036 | Ga0157380_100370362 | 294 |
| 176 | 3300025893 | Ga0207682_10095649 | Ga0207682_100956492 | 294 |
| 177 | 3300025907 | Ga0207645_10010753 | Ga0207645_100107533 | 294 |
| 178 | 3300025908 | Ga0207643_10026448 | Ga0207643_100264483 | 294 |
| 179 | 3300025926 | Ga0207659_10034836 | Ga0207659_100348362 | 294 |
| 180 | 3300025938 | Ga0207704_10098255 | Ga0207704_100982551 | 294 |
| 181 | 3300025940 | Ga0207691_10003840 | Ga0207691_100038405 | 294 |
| 182 | 3300025942 | Ga0207689_10011125 | Ga0207689_100111254 | 294 |
| 183 | 3300025960 | Ga0207651_10430513 | Ga0207651_104305131 | 294 |
| 184 | 3300025986 | Ga0207658_10142852 | Ga0207658_101428522 | 294 |
| 185 | 3300026075 | Ga0207708_10035715 | Ga0207708_100357153 | 294 |
| 186 | 3300026088 | Ga0207641_10056162 | Ga0207641_100561622 | 294 |
| 187 | 3300026089 | Ga0207648_10017961 | Ga0207648_100179614 | 294 |
| 188 | 3300026121 | Ga0207683_10006420 | Ga0207683_100064206 | 294 |
| 189 | 3300028380 | Ga0268265_10112440 | Ga0268265_101124402 | 294 |
| 190 | 3300031691 | Ga0316579_10082015 | Ga0316579_100820152 | 294 |
| 191 | 3300031727 | Ga0316576_10207425 | Ga0316576_102074252 | 294 |
| 192 | 3300032133 | Ga0316583_10058517 | Ga0316583_100585172 | 294 |
| 193 | 3300032137 | Ga0316585_10037739 | Ga0316585_100377391 | 294 |
| 194 | 3300035398 | Ga0316574_0165325 | Ga0316574_0165325_167_1084 | 294 |
| 195 | 3300036647 | Ga0316582_0176218 | Ga0316582_0176218_90_1007 | 294 |
| 196 | 3300036712 | Ga0316584_0105527 | Ga0316584_0105527_381_1298 | 294 |
| 197 | 3300046615 | Ga0495656_0000764 | Ga0495656_0000764_2514_3428 | 294 |
| 198 | 3300047318 | Ga0495636_0067855 | Ga0495636_0067855_355_1269 | 294 |
| 199 | 3300036401 | Ga0373937_0089518 | Ga0373937_0089518_514_1449 | 295 |
| 200 | 3300049587 | Ga0501071_0278530 | Ga0501071_0278530_302_1237 | 295 |
| 201 | 3300032133 | Ga0316583_10029768 | Ga0316583_100297682 | 296 |
| 202 | 3300005331 | Ga0070670_100275971 | Ga0070670_1002759712 | 297 |
| 203 | 3300005335 | Ga0070666_10080029 | Ga0070666_100800292 | 297 |
| 204 | 3300005354 | Ga0070675_100193486 | Ga0070675_1001934862 | 297 |
| 205 | 3300005355 | Ga0070671_100020833 | Ga0070671_1000208335 | 297 |
| 206 | 3300005367 | Ga0070667_100019832 | Ga0070667_1000198324 | 297 |
| 207 | 3300005548 | Ga0070665_100381880 | Ga0070665_1003818802 | 297 |
| 208 | 3300005564 | Ga0070664_100036203 | Ga0070664_1000362032 | 297 |
| 209 | 3300005618 | Ga0068864_100075412 | Ga0068864_1000754124 | 297 |
| 210 | 3300006237 | Ga0097621_100029936 | Ga0097621_1000299363 | 297 |
| 211 | 3300006358 | Ga0068871_100012734 | Ga0068871_1000127346 | 297 |
| 212 | 3300007265 | Ga0099794_10000571 | Ga0099794_100005711 | 297 |
| 213 | 3300009177 | Ga0105248_10042355 | Ga0105248_100423554 | 297 |
| 214 | 3300009177 | Ga0105248_10373856 | Ga0105248_103738562 | 297 |
| 215 | 3300009551 | Ga0105238_10247844 | Ga0105238_102478441 | 297 |
| 216 | 3300013307 | Ga0157372_10024931 | Ga0157372_100249312 | 297 |
| 217 | 3300014325 | Ga0163163_10006388 | Ga0163163_100063886 | 297 |
| 218 | 3300014325 | Ga0163163_10277857 | Ga0163163_102778572 | 297 |
| 219 | 3300014745 | Ga0157377_10049667 | Ga0157377_100496672 | 297 |
| 220 | 3300025903 | Ga0207680_10093057 | Ga0207680_100930572 | 297 |
| 221 | 3300025931 | Ga0207644_10000233 | Ga0207644_1000023317 | 297 |
| 222 | 3300025941 | Ga0207711_10031230 | Ga0207711_100312302 | 297 |
| 223 | 3300025941 | Ga0207711_10031241 | Ga0207711_100312416 | 297 |
| 224 | 3300025945 | Ga0207679_10008845 | Ga0207679_100088455 | 297 |
| 225 | 3300025986 | Ga0207658_10006346 | Ga0207658_100063464 | 297 |
| 226 | 3300026088 | Ga0207641_10480308 | Ga0207641_104803082 | 297 |
| 227 | 3300026095 | Ga0207676_10089527 | Ga0207676_100895273 | 297 |
| 228 | 3300027671 | Ga0209588_1015076 | Ga0209588_10150761 | 297 |
| 229 | 3300028379 | Ga0268266_10046881 | Ga0268266_100468812 | 297 |
| 230 | 3300037471 | Ga0395905_0002034 | Ga0395905_0002034_8166_9113 | 297 |
| 231 | 3300038443 | Ga0395901_0063846 | Ga0395901_0063846_468_1415 | 297 |
| 232 | 3300047445 | Ga0495677_0038851 | Ga0495677_0038851_465_1388 | 297 |
| 233 | 3300048910 | Ga0496107_0058866 | Ga0496107_0058866_1722_2717 | 297 |
| 234 | 3300048911 | Ga0496108_0020280 | Ga0496108_0020280_4057_5052 | 297 |
| 235 | 3300005293 | Ga0065715_10159342 | Ga0065715_101593423 | 298 |
| 236 | 3300005841 | Ga0068863_100073020 | Ga0068863_1000730203 | 298 |
| 237 | 3300006237 | Ga0097621_100030481 | Ga0097621_1000304813 | 298 |
| 238 | 3300014969 | Ga0157376_10009396 | Ga0157376_100093963 | 298 |
| 239 | 3300048910 | Ga0496107_0226286 | Ga0496107_0226286_101_1057 | 298 |
| 240 | 3300048918 | Ga0496115_0340092 | Ga0496115_0340092_174_1130 | 298 |
| 241 | 3300054114 | Ga0501084_0439084 | Ga0501084_0439084_88_1017 | 298 |
| 242 | 3300005843 | Ga0068860_100061501 | Ga0068860_1000615012 | 299 |
| 243 | 3300005843 | Ga0068860_100075079 | Ga0068860_1000750792 | 299 |
| 244 | 3300013306 | Ga0163162_10010684 | Ga0163162_100106843 | 299 |
| 245 | 3300014969 | Ga0157376_10034904 | Ga0157376_100349043 | 299 |
| 246 | 3300025934 | Ga0207686_10003009 | Ga0207686_100030095 | 299 |
| 247 | 3300025938 | Ga0207704_10002246 | Ga0207704_100022463 | 299 |
| 248 | 3300027876 | Ga0209974_10004157 | Ga0209974_100041575 | 299 |
| 249 | 3300028380 | Ga0268265_10055773 | Ga0268265_100557732 | 299 |
| 250 | 3300036647 | Ga0316582_0062026 | Ga0316582_0062026_1044_1994 | 299 |
| 251 | 3300046473 | Ga0495582_0020045 | Ga0495582_0020045_414_1394 | 299 |
| 252 | 3300046615 | Ga0495656_0019838 | Ga0495656_0019838_789_1727 | 299 |
| 253 | 3300046683 | Ga0495658_0057370 | Ga0495658_0057370_1200_2153 | 299 |
| 254 | 3300047318 | Ga0495636_0000187 | Ga0495636_0000187_1578_2516 | 299 |
| 255 | 3300047318 | Ga0495636_0002043 | Ga0495636_0002043_3395_4333 | 299 |
| 256 | 3300047447 | Ga0495685_039058 | Ga0495685_039058_434_1372 | 299 |
| 257 | 3300048917 | Ga0496114_0447780 | Ga0496114_0447780_184_1113 | 299 |
| 258 | 3300053724 | Ga0500570_074442 | Ga0500570_074442_505_1464 | 299 |
| 259 | 3300005364 | Ga0070673_100370191 | Ga0070673_1003701911 | 300 |
| 260 | 3300005458 | Ga0070681_10315671 | Ga0070681_103156712 | 300 |
| 261 | 3300005535 | Ga0070684_100017912 | Ga0070684_1000179126 | 300 |
| 262 | 3300005543 | Ga0070672_100002101 | Ga0070672_1000021018 | 300 |
| 263 | 3300005577 | Ga0068857_100045883 | Ga0068857_1000458832 | 300 |
| 264 | 3300005617 | Ga0068859_100229601 | Ga0068859_1002296012 | 300 |
| 265 | 3300005618 | Ga0068864_100036407 | Ga0068864_1000364074 | 300 |
| 266 | 3300005843 | Ga0068860_100270503 | Ga0068860_1002705032 | 300 |
| 267 | 3300006237 | Ga0097621_100010721 | Ga0097621_1000107217 | 300 |
| 268 | 3300006358 | Ga0068871_100062946 | Ga0068871_1000629464 | 300 |
| 269 | 3300006881 | Ga0068865_100133488 | Ga0068865_1001334882 | 300 |
| 270 | 3300006931 | Ga0097620_100229609 | Ga0097620_1002296092 | 300 |
| 271 | 3300009093 | Ga0105240_10010886 | Ga0105240_1001088610 | 300 |
| 272 | 3300009098 | Ga0105245_10010414 | Ga0105245_100104148 | 300 |
| 273 | 3300009174 | Ga0105241_10010058 | Ga0105241_100100586 | 300 |
| 274 | 3300009176 | Ga0105242_10001208 | Ga0105242_1000120813 | 300 |
| 275 | 3300009177 | Ga0105248_10000999 | Ga0105248_1000099921 | 300 |
| 276 | 3300009177 | Ga0105248_10359629 | Ga0105248_103596292 | 300 |
| 277 | 3300009545 | Ga0105237_10007370 | Ga0105237_100073707 | 300 |
| 278 | 3300009551 | Ga0105238_10001949 | Ga0105238_1000194912 | 300 |
| 279 | 3300010375 | Ga0105239_10009168 | Ga0105239_100091686 | 300 |
| 280 | 3300011119 | Ga0105246_10008085 | Ga0105246_100080854 | 300 |
| 281 | 3300013296 | Ga0157374_10021201 | Ga0157374_100212014 | 300 |
| 282 | 3300013306 | Ga0163162_10413350 | Ga0163162_104133501 | 300 |
| 283 | 3300013308 | Ga0157375_10001631 | Ga0157375_1000163112 | 300 |
| 284 | 3300014969 | Ga0157376_10020704 | Ga0157376_100207042 | 300 |
| 285 | 3300025913 | Ga0207695_10189744 | Ga0207695_101897442 | 300 |
| 286 | 3300025914 | Ga0207671_10008897 | Ga0207671_100088978 | 300 |
| 287 | 3300025924 | Ga0207694_10007299 | Ga0207694_100072996 | 300 |
| 288 | 3300025938 | Ga0207704_10006594 | Ga0207704_100065945 | 300 |
| 289 | 3300025940 | Ga0207691_10003969 | Ga0207691_100039697 | 300 |
| 290 | 3300025941 | Ga0207711_10004733 | Ga0207711_100047334 | 300 |
| 291 | 3300025949 | Ga0207667_10540345 | Ga0207667_105403452 | 300 |
| 292 | 3300026023 | Ga0207677_10188116 | Ga0207677_101881162 | 300 |
| 293 | 3300026088 | Ga0207641_10079776 | Ga0207641_100797762 | 300 |
| 294 | 3300026089 | Ga0207648_10007183 | Ga0207648_100071838 | 300 |
| 295 | 3300026116 | Ga0207674_10009808 | Ga0207674_100098086 | 300 |
| 296 | 3300005334 | Ga0068869_100070729 | Ga0068869_1000707292 | 303 |
| 297 | 3300005366 | Ga0070659_100045121 | Ga0070659_1000451212 | 303 |
| 298 | 3300005457 | Ga0070662_100002620 | Ga0070662_1000026203 | 303 |
| 299 | 3300005547 | Ga0070693_100091593 | Ga0070693_1000915932 | 303 |
| 300 | 3300005564 | Ga0070664_100085512 | Ga0070664_1000855121 | 303 |
| 301 | 3300005615 | Ga0070702_100013188 | Ga0070702_1000131882 | 303 |
| 302 | 3300005843 | Ga0068860_100003065 | Ga0068860_1000030655 | 303 |
| 303 | 3300013100 | Ga0157373_10014339 | Ga0157373_100143395 | 303 |
| 304 | 3300013105 | Ga0157369_10028252 | Ga0157369_100282527 | 303 |
| 305 | 3300025920 | Ga0207649_10255874 | Ga0207649_102558742 | 303 |
| 306 | 3300025924 | Ga0207694_10084727 | Ga0207694_100847272 | 303 |
| 307 | 3300025941 | Ga0207711_10052634 | Ga0207711_100526342 | 303 |
| 308 | 3300025944 | Ga0207661_10237695 | Ga0207661_102376952 | 303 |
| 309 | 3300026035 | Ga0207703_10122351 | Ga0207703_101223512 | 303 |
| 310 | 3300026041 | Ga0207639_10133194 | Ga0207639_101331942 | 303 |
| 311 | 3300026116 | Ga0207674_10032329 | Ga0207674_100323294 | 303 |
| 312 | 3300028381 | Ga0268264_10030417 | Ga0268264_100304174 | 303 |
| 313 | 3300035398 | Ga0316574_0008289 | Ga0316574_0008289_388_1332 | 303 |
| 314 | 3300046683 | Ga0495658_0076807 | Ga0495658_0076807_760_1746 | 303 |
| 315 | 3300009177 | Ga0105248_10081679 | Ga0105248_100816792 | 304 |
| 316 | 3300025931 | Ga0207644_10048631 | Ga0207644_100486312 | 304 |
| 317 | 3300005468 | Ga0070707_100286217 | Ga0070707_1002862173 | 305 |
| 318 | 3300006844 | Ga0075428_100101303 | Ga0075428_1001013034 | 307 |
| 319 | 3300026067 | Ga0207678_10075367 | Ga0207678_100753673 | 308 |
| 320 | 3300036401 | Ga0373937_0106919 | Ga0373937_0106919_262_1257 | 309 |
| 321 | 3300037068 | Ga0373925_0001480 | Ga0373925_0001480_16182_17177 | 309 |
| 322 | 3300046459 | Ga0495629_0031239 | Ga0495629_0031239_1082_2077 | 309 |
| 323 | 3300046472 | Ga0495580_0057270 | Ga0495580_0057270_176_1171 | 309 |
| 324 | 3300046473 | Ga0495582_0000764 | Ga0495582_0000764_9061_10056 | 309 |
| 325 | 3300046531 | Ga0495665_0002433 | Ga0495665_0002433_1436_2431 | 309 |
| 326 | 3300046663 | Ga0495635_0019328 | Ga0495635_0019328_1564_2559 | 309 |
| 327 | 3300046681 | Ga0495647_0001707 | Ga0495647_0001707_1888_2883 | 309 |
| 328 | 3300046683 | Ga0495658_0002717 | Ga0495658_0002717_4341_5336 | 309 |
| 329 | 3300046809 | Ga0495600_0122092 | Ga0495600_0122092_263_1258 | 309 |
| 330 | 3300047315 | Ga0495581_0012742 | Ga0495581_0012742_1730_2725 | 309 |
| 331 | 3300047471 | Ga0495684_0002042 | Ga0495684_0002042_1185_2180 | 309 |
| 332 | 3300005330 | Ga0070690_100149864 | Ga0070690_1001498642 | 311 |
| 333 | 3300005335 | Ga0070666_10092234 | Ga0070666_100922341 | 311 |
| 334 | 3300005614 | Ga0068856_100179463 | Ga0068856_1001794632 | 311 |
| 335 | 3300005834 | Ga0068851_10017878 | Ga0068851_100178782 | 311 |
| 336 | 3300009177 | Ga0105248_10043800 | Ga0105248_100438002 | 311 |
| 337 | 3300013102 | Ga0157371_10051377 | Ga0157371_100513772 | 311 |
| 338 | 3300013308 | Ga0157375_10076840 | Ga0157375_100768403 | 311 |
| 339 | 3300014745 | Ga0157377_10004817 | Ga0157377_100048171 | 311 |
| 340 | 3300014968 | Ga0157379_10031090 | Ga0157379_100310902 | 311 |
| 341 | 3300025321 | Ga0207656_10012219 | Ga0207656_100122193 | 311 |
| 342 | 3300025918 | Ga0207662_10058738 | Ga0207662_100587382 | 311 |
| 343 | 3300025923 | Ga0207681_10146981 | Ga0207681_101469812 | 311 |
| 344 | 3300025926 | Ga0207659_10000664 | Ga0207659_100006642 | 311 |
| 345 | 3300025981 | Ga0207640_10340225 | Ga0207640_103402252 | 311 |
| 346 | 3300025986 | Ga0207658_10249127 | Ga0207658_102491271 | 311 |
| 347 | 3300045051 | Ga0451576_0279598 | Ga0451576_0279598_304_1302 | 311 |
| 348 | 3300048909 | Ga0496106_0139314 | Ga0496106_0139314_644_1642 | 311 |
| 349 | 3300048915 | Ga0496112_0366646 | Ga0496112_0366646_121_1116 | 311 |
| 350 | 3300048917 | Ga0496114_0171856 | Ga0496114_0171856_852_1817 | 311 |
| 351 | 3300005335 | Ga0070666_10009810 | Ga0070666_100098106 | 312 |
| 352 | 3300005338 | Ga0068868_100019180 | Ga0068868_1000191805 | 312 |
| 353 | 3300005356 | Ga0070674_100006794 | Ga0070674_1000067946 | 312 |
| 354 | 3300005367 | Ga0070667_100019846 | Ga0070667_1000198465 | 312 |
| 355 | 3300005456 | Ga0070678_100000638 | Ga0070678_10000063815 | 312 |
| 356 | 3300005459 | Ga0068867_100131421 | Ga0068867_1001314211 | 312 |
| 357 | 3300006237 | Ga0097621_100010631 | Ga0097621_1000106314 | 312 |
| 358 | 3300013296 | Ga0157374_10068711 | Ga0157374_100687111 | 312 |
| 359 | 3300014969 | Ga0157376_10006341 | Ga0157376_100063412 | 312 |
| 360 | 3300025903 | Ga0207680_10051144 | Ga0207680_100511442 | 312 |
| 361 | 3300025937 | Ga0207669_10003255 | Ga0207669_100032553 | 312 |
| 362 | 3300025986 | Ga0207658_10015011 | Ga0207658_100150113 | 312 |
| 363 | 3300026089 | Ga0207648_10216323 | Ga0207648_102163231 | 312 |
| 364 | 3300026121 | Ga0207683_10010862 | Ga0207683_100108626 | 312 |
| 365 | 3300028379 | Ga0268266_10030419 | Ga0268266_100304192 | 312 |
| 366 | 3300026041 | Ga0207639_10061422 | Ga0207639_100614222 | 313 |
| 367 | 3300005329 | Ga0070683_100021701 | Ga0070683_1000217016 | 316 |
| 368 | 3300005455 | Ga0070663_100012610 | Ga0070663_1000126102 | 316 |
| 369 | 3300005564 | Ga0070664_100024682 | Ga0070664_1000246824 | 316 |
| 370 | 3300005577 | Ga0068857_100130273 | Ga0068857_1001302732 | 316 |
| 371 | 3300005719 | Ga0068861_100171758 | Ga0068861_1001717581 | 316 |
| 372 | 3300006881 | Ga0068865_100025526 | Ga0068865_1000255261 | 316 |
| 373 | 3300009174 | Ga0105241_10343874 | Ga0105241_103438741 | 316 |
| 374 | 3300013297 | Ga0157378_10323636 | Ga0157378_103236361 | 316 |
| 375 | 3300014968 | Ga0157379_10012597 | Ga0157379_100125977 | 316 |
| 376 | 3300025315 | Ga0207697_10000636 | Ga0207697_100006367 | 316 |
| 377 | 3300025893 | Ga0207682_10009735 | Ga0207682_100097353 | 316 |
| 378 | 3300025944 | Ga0207661_10025233 | Ga0207661_100252332 | 316 |
| 379 | 3300026067 | Ga0207678_10023230 | Ga0207678_100232304 | 316 |
| 380 | 3300026075 | Ga0207708_10280698 | Ga0207708_102806981 | 316 |
| 381 | 3300026089 | Ga0207648_10012816 | Ga0207648_100128163 | 316 |
| 382 | 3300026118 | Ga0207675_100227245 | Ga0207675_1002272451 | 316 |
| 383 | 3300026121 | Ga0207683_10014853 | Ga0207683_100148531 | 316 |
| 384 | 3300046539 | Ga0495621_0004102 | Ga0495621_0004102_441_1421 | 316 |
| 385 | 3300014326 | Ga0157380_10064571 | Ga0157380_100645712 | 322 |
| 386 | 3300014968 | Ga0157379_10005400 | Ga0157379_1000540010 | 322 |
| 387 | 3300025986 | Ga0207658_10394240 | Ga0207658_103942402 | 322 |
| 388 | 3300045051 | Ga0451576_0246908 | Ga0451576_0246908_644_1684 | 322 |
| 389 | 3300005293 | Ga0065715_10126385 | Ga0065715_101263852 | 323 |
| 390 | 3300005364 | Ga0070673_100123808 | Ga0070673_1001238082 | 323 |
| 391 | 3300005456 | Ga0070678_100247285 | Ga0070678_1002472851 | 323 |
| 392 | 3300006237 | Ga0097621_100356106 | Ga0097621_1003561062 | 323 |
| 393 | 3300017792 | Ga0163161_10216737 | Ga0163161_102167371 | 323 |
| 394 | 3300025925 | Ga0207650_10187019 | Ga0207650_101870191 | 323 |
| 395 | 3300028379 | Ga0268266_10021684 | Ga0268266_100216841 | 323 |
| 396 | 3300005330 | Ga0070690_100067416 | Ga0070690_1000674161 | 326 |
| 397 | 3300005347 | Ga0070668_100179628 | Ga0070668_1001796282 | 326 |
| 398 | 3300005353 | Ga0070669_100026478 | Ga0070669_1000264784 | 326 |
| 399 | 3300005618 | Ga0068864_100096288 | Ga0068864_1000962882 | 326 |
| 400 | 3300009148 | Ga0105243_10159982 | Ga0105243_101599822 | 326 |
| 401 | 3300009177 | Ga0105248_10072724 | Ga0105248_100727243 | 326 |
| 402 | 3300009553 | Ga0105249_10047834 | Ga0105249_100478342 | 326 |
| 403 | 3300013308 | Ga0157375_10389428 | Ga0157375_103894281 | 326 |
| 404 | 3300014968 | Ga0157379_10307829 | Ga0157379_103078292 | 326 |
| 405 | 3300014969 | Ga0157376_10068164 | Ga0157376_100681642 | 326 |
| 406 | 2162886011 | MRS1b_contig_7592505 | MRS1b_0308.00002950 | 330 |
| 407 | 3300005290 | Ga0065712_10103642 | Ga0065712_101036422 | 330 |
| 408 | 3300005335 | Ga0070666_10009625 | Ga0070666_100096256 | 330 |
| 409 | 3300009094 | Ga0111539_10218960 | Ga0111539_102189602 | 330 |
| 410 | 3300013296 | Ga0157374_10153301 | Ga0157374_101533012 | 330 |
| 411 | 3300025290 | Ga0207673_1001939 | Ga0207673_10019392 | 330 |
| 412 | 3300025901 | Ga0207688_10032713 | Ga0207688_100327132 | 330 |
| 413 | 3300025919 | Ga0207657_10128742 | Ga0207657_101287422 | 330 |
| 414 | 3300025925 | Ga0207650_10002128 | Ga0207650_1000212814 | 330 |
| 415 | 3300025936 | Ga0207670_10303837 | Ga0207670_103038372 | 330 |
| 416 | 3300048903 | Ga0496100_0032732 | Ga0496100_0032732_1737_2759 | 330 |
| 417 | 3300048907 | Ga0496104_0286036 | Ga0496104_0286036_365_1387 | 330 |
| 418 | 3300048913 | Ga0496110_0018092 | Ga0496110_0018092_4371_5393 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rl8-assembly2.cif.gz_B | crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 | 0.8305 | 51 | 326 |
| 4rl8-assembly2.cif.gz_B | crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 | 0.8275 | 51 | 326 |
| 5o68-assembly2.cif.gz_F | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.8045 | 63 | 326 |
| 5o68-assembly4.cif.gz_L | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.8033 | 63 | 326 |
| 5o68-assembly3.cif.gz_I | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.7986 | 63 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nrfA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.768 | 282 | 324 | 3.40.710.10 |
| 4k00B00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.7396 | 280 | 327 | 3.10.129.10 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.7035 | 70 | 326 | 2.40.160.40 |
| af_A0A178V9P2_1_118_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7005 | 288 | 323 | 3.10.450.50 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6938 | 70 | 326 | 2.40.160.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A011NYG0-F1-model_v4 | Protein involved in meta-pathway of phenol degradation | 0.9745 | 53 | 330 |
|
| AF-A0A523N781-F1-model_v4 | Transporter | 0.972 | 102 | 327 |
|
| AF-A0A011NYG0-F1-model_v4 | Protein involved in meta-pathway of phenol degradation | 0.9676 | 53 | 330 |
|
| AF-A0A523N781-F1-model_v4 | Transporter | 0.9554 | 102 | 327 |
|
| AF-A0A3D3CVQ8-F1-model_v4 | Transporter | 0.9549 | 183 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar