F439221

General Info

Members Datasets Scaffolds Average Seq Length
418 230 836 135

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100162265|Ga0070670_1001622652
Length 149
Sequence MTKSRRDYIRLMAIELTQEVSERLSSDNYGWLTTVAKSGQPVPRLVWFYFDGTDVVVYSEPNAAKVRHIKNHPRVSLNLDSDGNGAGIIIIGGIATVDAQGIDPLADERYRAKYDELAASFGFSEEFLAAYNTRLKISIDKVWTTPTEG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
205 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
222 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
223 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
224 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
225 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
226 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
227 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
228 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
229 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
230 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.84
Nodule 0
Rhizoplane 11.48
Rhizosphere 52.39
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100162265 3300005331 Bacteria 1937
2 rootH2_10089003 3300003320 Bacteria 2771
3 Ga0055540_1001481 3300003792 Bacteria 13973
4 Ga0055540_1002635 3300003792 Bacteria 9303
5 Ga0055540_1004493 3300003792 Bacteria 6260
6 Ga0070658_10537355 3300005327 Bacteria 1011
7 Ga0068868_100275701 3300005338 Bacteria 1422
8 Ga0070689_100460108 3300005340 Bacteria 1084
9 Ga0070692_10715180 3300005345 Bacteria 675
10 Ga0070668_100004049 3300005347 Bacteria 10851
11 Ga0070668_101075797 3300005347 Bacteria 725
12 Ga0070669_100013274 3300005353 Bacteria 5855
13 Ga0070671_100028266 3300005355 Bacteria 4617
14 Ga0070674_100535920 3300005356 Bacteria 980
15 Ga0070674_100712825 3300005356 Bacteria 859
16 Ga0070673_100485351 3300005364 Bacteria 1116
17 Ga0070659_101025542 3300005366 Bacteria 725
18 Ga0070667_100000582 3300005367 Bacteria 36093
19 Ga0070667_100028841 3300005367 Bacteria 4621
20 Ga0070709_10267370 3300005434 Bacteria 1238
21 Ga0070714_101589967 3300005435 Bacteria 638
22 Ga0070713_100083930 3300005436 Bacteria 2724
23 Ga0070711_101167478 3300005439 Bacteria 665
24 Ga0070663_100170262 3300005455 Bacteria 1683
25 Ga0070678_100334652 3300005456 Bacteria 1297
26 Ga0070685_10010167 3300005466 Bacteria 4885
27 Ga0070679_101902205 3300005530 Bacteria 544
28 Ga0070684_100360763 3300005535 Bacteria 1337
29 Ga0068853_100064787 3300005539 Bacteria 3170
30 Ga0068853_100596285 3300005539 Bacteria 1049
31 Ga0070686_100140209 3300005544 Bacteria 1682
32 Ga0070686_100284971 3300005544 Bacteria 1220
33 Ga0070696_101381622 3300005546 Bacteria 600
34 Ga0070693_100061368 3300005547 Bacteria 2185
35 Ga0070665_100002795 3300005548 Bacteria 18921
36 Ga0070665_100105894 3300005548 Bacteria 2814
37 Ga0068855_100439401 3300005563 Bacteria 1425
38 Ga0068852_100767539 3300005616 Bacteria 977
39 Ga0068859_100003603 3300005617 Bacteria 15790
40 Ga0068864_100116925 3300005618 Bacteria 2380
41 Ga0068866_10730672 3300005718 Bacteria 682
42 Ga0068863_100002822 3300005841 Bacteria 17205
43 Ga0068863_100222342 3300005841 Bacteria 1819
44 Ga0068858_100005156 3300005842 Bacteria 12801
45 Ga0068858_100592500 3300005842 Bacteria 1075
46 Ga0068860_100000016 3300005843 Bacteria 310468
47 Ga0068860_100306007 3300005843 Bacteria 1558
48 Ga0068860_100619741 3300005843 Bacteria 1088
49 Ga0068860_100695642 3300005843 Bacteria 1026
50 Ga0068862_100000051 3300005844 Bacteria 145362
51 Ga0081455_10060197 3300005937 Bacteria 3203
52 Ga0081455_10079850 3300005937 Bacteria 2684
53 Ga0075365_10000705 3300006038 Bacteria 13444
54 Ga0075365_10015788 3300006038 Bacteria 4575
55 Ga0075365_10018736 3300006038 Bacteria 4262
56 Ga0075368_10015011 3300006042 Bacteria 2868
57 Ga0075363_100001263 3300006048 Bacteria 9407
58 Ga0075363_100003824 3300006048 Bacteria 6490
59 Ga0075363_100006656 3300006048 Bacteria 5268
60 Ga0075363_100016444 3300006048 Bacteria 3654
61 Ga0075363_100017873 3300006048 Bacteria 3524
62 Ga0075363_100027392 3300006048 Bacteria 2922
63 Ga0075363_100113376 3300006048 Bacteria 1509
64 Ga0075363_100165182 3300006048 Bacteria 1255
65 Ga0075363_100326346 3300006048 Bacteria 893
66 Ga0075363_100418604 3300006048 Bacteria 789
67 Ga0075364_10001139 3300006051 Bacteria 14196
68 Ga0075364_10014357 3300006051 Bacteria 4893
69 Ga0075364_10017459 3300006051 Bacteria 4484
70 Ga0075364_10048009 3300006051 Bacteria 2781
71 Ga0075364_10077092 3300006051 Bacteria 2200
72 Ga0075364_10170500 3300006051 Bacteria 1471
73 Ga0075364_10220557 3300006051 Bacteria 1287
74 Ga0075364_10468475 3300006051 Bacteria 861
75 Ga0075364_10497855 3300006051 Bacteria 833
76 Ga0070712_101031321 3300006175 Bacteria 712
77 Ga0075362_10006082 3300006177 Bacteria 4470
78 Ga0075362_10018252 3300006177 Bacteria 2900
79 Ga0075362_10022583 3300006177 Bacteria 2652
80 Ga0075362_10256608 3300006177 Bacteria 861
81 Ga0075367_10006553 3300006178 Bacteria 5892
82 Ga0075367_10233422 3300006178 Bacteria 1152
83 Ga0075367_10637133 3300006178 Bacteria 678
84 Ga0075369_10000381 3300006186 Bacteria 13317
85 Ga0075369_10044745 3300006186 Bacteria 1902
86 Ga0075369_10059683 3300006186 Bacteria 1662
87 Ga0075369_10061245 3300006186 Bacteria 1642
88 Ga0075369_10094727 3300006186 Bacteria 1335
89 Ga0075369_10113210 3300006186 Bacteria 1224
90 Ga0075369_10159713 3300006186 Bacteria 1033
91 Ga0075369_10162242 3300006186 Bacteria 1025
92 Ga0075369_10194374 3300006186 Bacteria 935
93 Ga0075366_10364306 3300006195 Bacteria 888
94 Ga0075370_10006823 3300006353 Bacteria 5772
95 Ga0075370_10026962 3300006353 Bacteria 3185
96 Ga0075370_10043723 3300006353 Bacteria 2532
97 Ga0075370_10206680 3300006353 Bacteria 1159
98 Ga0075370_10257339 3300006353 Bacteria 1035
99 Ga0075370_10271473 3300006353 Bacteria 1007
100 Ga0075428_100148796 3300006844 Bacteria 2544
101 Ga0075430_100009778 3300006846 Bacteria 8111
102 Ga0075430_100194012 3300006846 Bacteria 1687
103 Ga0075429_100388893 3300006880 Bacteria 1221
104 Ga0097620_100003604 3300006931 Bacteria 15790
105 Ga0099795_10061536 3300007788 Bacteria 1394
106 Ga0105250_10149916 3300009092 Bacteria 970
107 Ga0111539_10825307 3300009094 Bacteria 1079
108 Ga0105247_10000017 3300009101 Bacteria 260438
109 Ga0105247_10034435 3300009101 Bacteria 3084
110 Ga0114129_10004320 3300009147 Bacteria 20095
111 Ga0105242_11436224 3300009176 Bacteria 719
112 Ga0105248_10000025 3300009177 Bacteria 259691
113 Ga0105248_10043695 3300009177 Bacteria 5025
114 Ga0105237_10000745 3300009545 Bacteria 44856
115 Ga0105238_10212968 3300009551 Bacteria 1908
116 Ga0105238_11050933 3300009551 Bacteria 836
117 Ga0105249_10000021 3300009553 Bacteria 260448
118 Ga0105033_112250 3300009986 Bacteria 759
119 Ga0105239_10001328 3300010375 Bacteria 33299
120 Ga0105239_10165844 3300010375 Bacteria 2470
121 Ga0157371_10594035 3300013102 Unclassified 823
122 Ga0157374_10692247 3300013296 Bacteria 1032
123 Ga0163162_10059117 3300013306 Bacteria 3864
124 Ga0163162_12316661 3300013306 Bacteria 617
125 Ga0157375_10222070 3300013308 Bacteria 2048
126 Ga0163163_10139323 3300014325 Bacteria 2468
127 Ga0163163_10152180 3300014325 Bacteria 2357
128 Ga0157380_10459276 3300014326 Bacteria 1225
129 Ga0157380_11220379 3300014326 Bacteria 796
130 Ga0157377_10069783 3300014745 Bacteria 2028
131 Ga0157379_10273565 3300014968 Bacteria 1536
132 Ga0157379_10401136 3300014968 Bacteria 1261
133 Ga0163161_10241633 3300017792 Bacteria 1404
134 Ga0163161_10342039 3300017792 Bacteria 1187
135 Ga0163161_11387095 3300017792 Bacteria 613
136 Ga0213874_10066160 3300021377 Bacteria 1143
137 Ga0209051_1001752 3300025303 Bacteria 17263
138 Ga0209051_1002406 3300025303 Bacteria 13458
139 Ga0209051_1012294 3300025303 Bacteria 4150
140 Ga0207642_10078364 3300025899 Bacteria 1597
141 Ga0207710_10000033 3300025900 Bacteria 260531
142 Ga0207710_10021480 3300025900 Bacteria 2767
143 Ga0207680_10614711 3300025903 Bacteria 777
144 Ga0207705_10429812 3300025909 Bacteria 1023
145 Ga0207671_10013580 3300025914 Bacteria 6480
146 Ga0207693_10217196 3300025915 Bacteria 1502
147 Ga0207663_10578251 3300025916 Bacteria 881
148 Ga0207657_10525972 3300025919 Bacteria 925
149 Ga0207646_10345437 3300025922 Bacteria 1344
150 Ga0207681_10004635 3300025923 Bacteria 8457
151 Ga0207694_10396907 3300025924 Bacteria 1147
152 Ga0207694_10398584 3300025924 Bacteria 1144
153 Ga0207650_10103542 3300025925 Bacteria 2195
154 Ga0207700_10087887 3300025928 Bacteria 2445
155 Ga0207664_10108065 3300025929 Bacteria 2309
156 Ga0207664_10203698 3300025929 Bacteria 1709
157 Ga0207664_11190039 3300025929 Bacteria 680
158 Ga0207644_10120252 3300025931 Bacteria 1999
159 Ga0207644_10758372 3300025931 Bacteria 811
160 Ga0207690_10685673 3300025932 Bacteria 842
161 Ga0207686_11160377 3300025934 Bacteria 631
162 Ga0207709_10755793 3300025935 Bacteria 782
163 Ga0207669_10047865 3300025937 Bacteria 2536
164 Ga0207665_10143705 3300025939 Bacteria 1704
165 Ga0207711_10000390 3300025941 Bacteria 46512
166 Ga0207711_10069330 3300025941 Bacteria 3056
167 Ga0207667_10404514 3300025949 Bacteria 1390
168 Ga0207712_10000005 3300025961 Bacteria 608697
169 Ga0207668_10001360 3300025972 Bacteria 14447
170 Ga0207658_10001262 3300025986 Bacteria 19997
171 Ga0207658_10048040 3300025986 Bacteria 3127
172 Ga0207658_10408183 3300025986 Bacteria 1195
173 Ga0207703_10030925 3300026035 Bacteria 4232
174 Ga0207703_11215376 3300026035 Bacteria 725
175 Ga0207639_10044745 3300026041 Bacteria 3330
176 Ga0207639_10795011 3300026041 Bacteria 881
177 Ga0207678_10017171 3300026067 Bacteria 6353
178 Ga0207678_10843195 3300026067 Bacteria 810
179 Ga0207641_10001387 3300026088 Bacteria 23866
180 Ga0207641_10003222 3300026088 Bacteria 14583
181 Ga0207641_10303461 3300026088 Bacteria 1509
182 Ga0207676_10364583 3300026095 Bacteria 1340
183 Ga0207683_10355947 3300026121 Bacteria 1344
184 Ga0207683_10650546 3300026121 Bacteria 976
185 Ga0268266_10005558 3300028379 Bacteria 11732
186 Ga0268266_10083342 3300028379 Bacteria 2791
187 Ga0268265_10000022 3300028380 Bacteria 270788
188 Ga0268264_10000005 3300028381 Bacteria 934972
189 Ga0268264_10300980 3300028381 Bacteria 1510
190 Ga0268264_11891241 3300028381 Bacteria 606
191 Ga0307405_10301890 3300031731 Bacteria 1215
192 Ga0307410_10661584 3300031852 Bacteria 877
193 Ga0307410_10778608 3300031852 Bacteria 812
194 Ga0307409_102055095 3300031995 Bacteria 601
195 Ga0307416_100052549 3300032002 Bacteria 3263
196 Ga0307416_101051694 3300032002 Bacteria 918
197 Ga0307416_101140208 3300032002 Bacteria 885
198 Ga0307416_102012688 3300032002 Bacteria 680
199 Ga0307411_10627017 3300032005 Bacteria 928
200 Ga0307411_11066002 3300032005 Bacteria 727
201 Ga0307415_100278018 3300032126 Bacteria 1375
202 Ga0307415_101221246 3300032126 Bacteria 709
203 Ga0316583_10070569 3300032133 Bacteria 1222
204 Ga0316584_0292875 3300036712 Bacteria 1180
205 Ga0395905_1653741 3300037471 Bacteria 545
206 Ga0436365_0842203 3300039437 Bacteria 27860
207 Ga0436363_0273080 3300039450 Bacteria 2589
208 Ga0439461_0014014 3300041410 Bacteria 1518
209 Ga0439466_0008319 3300041411 Bacteria 3910
210 Ga0439466_0010701 3300041411 Bacteria 3408
211 Ga0439466_0018459 3300041411 Bacteria 2502
212 Ga0439465_0013636 3300041413 Bacteria 2532
213 Ga0451789_0507954 3300041443 Bacteria 1747
214 Ga0451793_0140214 3300041452 Bacteria 3381
215 Ga0451793_1750832 3300041452 Bacteria 1024
216 Ga0451797_1329587 3300041453 Bacteria 639
217 Ga0451795_1240608 3300041456 Bacteria 1110
218 Ga0451795_1577984 3300041456 Bacteria 688
219 Ga0451802_1395454 3300041460 Bacteria 888
220 Ga0451802_2023222 3300041460 Bacteria 983
221 Ga0451804_0054343 3300041463 Bacteria 587
222 Ga0451804_0472646 3300041463 Bacteria 696
223 Ga0451807_0725696 3300041486 Bacteria 662
224 Ga0451807_2286951 3300041486 Bacteria 864
225 Ga0451837_0771116 3300041494 Bacteria 724
226 Ga0451841_0745063 3300041498 Bacteria 658
227 Ga0451849_0724616 3300041505 Bacteria 866
228 Ga0451853_1833492 3300041512 Bacteria 850
229 Ga0439431_0022522 3300041997 Bacteria 1519
230 Ga0439431_0046634 3300041997 Bacteria 1115
231 Ga0439445_0009995 3300042004 Bacteria 2240
232 Ga0439445_0038468 3300042004 Bacteria 1265
233 Ga0439434_0008920 3300042435 Bacteria 2946
234 Ga0439434_0103082 3300042435 Bacteria 920
235 Ga0466972_0059163 3300044658 Bacteria 1839
236 Ga0466972_0253690 3300044658 Bacteria 822
237 Ga0466965_0012053 3300044683 Bacteria 4060
238 Ga0466966_0175981 3300044684 Bacteria 1299
239 Ga0466961_0006692 3300044693 Bacteria 7332
240 Ga0466963_0324860 3300044694 Bacteria 1083
241 Ga0466971_0061413 3300044719 Bacteria 1699
242 Ga0466968_0353064 3300044735 Bacteria 715
243 Ga0466968_0561364 3300044735 Bacteria 573
244 Ga0466970_0029435 3300044765 Bacteria 2891
245 Ga0466970_0166746 3300044765 Bacteria 1219
246 Ga0466957_0021395 3300044842 Bacteria 3810
247 Ga0466957_0064206 3300044842 Bacteria 2258
248 Ga0466957_0703052 3300044842 Bacteria 713
249 Ga0466960_0014243 3300044901 Bacteria 3399
250 Ga0466960_0108526 3300044901 Bacteria 1439
251 Ga0466959_0001602 3300045049 Bacteria 13955
252 Ga0466959_0020060 3300045049 Bacteria 4920
253 Ga0466958_0001984 3300045836 Bacteria 10057
254 Ga0466958_0044365 3300045836 Bacteria 2680
255 Ga0466958_0264967 3300045836 Bacteria 1100
256 Ga0466967_0225932 3300045976 Bacteria 1781
257 Ga0466967_0392341 3300045976 Bacteria 1349
258 Ga0466967_0655696 3300045976 Bacteria 1038
259 Ga0466967_1197784 3300045976 Bacteria 757
260 Ga0495638_0008424 3300046460 Bacteria 7314
261 Ga0495638_0034869 3300046460 Bacteria 3211
262 Ga0495606_0040835 3300046507 Bacteria 3115
263 Ga0495597_0280175 3300046542 Bacteria 650
264 Ga0495649_0465117 3300046694 Bacteria 631
265 Ga0495649_0597050 3300046694 Bacteria 545
266 Ga0495649_0651685 3300046694 Bacteria 518
267 Ga0495672_0050100 3300047320 Bacteria 2468
268 Ga0495672_0105235 3300047320 Bacteria 1523
269 Ga0495672_0210055 3300047320 Bacteria 967
270 Ga0495686_0002701 3300047472 Bacteria 16248
271 Ga0495626_0091864 3300048091 Bacteria 1334
272 Ga0496100_0001287 3300048903 Bacteria 12243
273 Ga0496100_0010237 3300048903 Bacteria 5303
274 Ga0496100_0487720 3300048903 Bacteria 948
275 Ga0496101_0000002 3300048904 Bacteria 410971
276 Ga0496101_0000933 3300048904 Bacteria 17243
277 Ga0496101_0026611 3300048904 Bacteria 4022
278 Ga0496101_0044913 3300048904 Bacteria 3163
279 Ga0496102_0000003 3300048905 Bacteria 592263
280 Ga0496102_0000449 3300048905 Bacteria 46890
281 Ga0496102_0051885 3300048905 Bacteria 3736
282 Ga0496102_0102925 3300048905 Bacteria 2655
283 Ga0496102_0266453 3300048905 Bacteria 1615
284 Ga0496103_0000014 3300048906 Bacteria 290397
285 Ga0496103_0000515 3300048906 Bacteria 31901
286 Ga0496104_0015477 3300048907 Bacteria 6908
287 Ga0496104_0026925 3300048907 Bacteria 5315
288 Ga0496105_0009653 3300048908 Bacteria 7555
289 Ga0496105_0080763 3300048908 Bacteria 2686
290 Ga0496106_0006137 3300048909 Bacteria 8888
291 Ga0496106_0137313 3300048909 Bacteria 1921
292 Ga0496107_0001748 3300048910 Bacteria 13670
293 Ga0496107_0011142 3300048910 Bacteria 6256
294 Ga0496108_0511535 3300048911 Bacteria 1048
295 Ga0496108_1388462 3300048911 Bacteria 588
296 Ga0496108_1763989 3300048911 Bacteria 508
297 Ga0496109_0011451 3300048912 Bacteria 7626
298 Ga0496109_0198744 3300048912 Bacteria 1885
299 Ga0496112_0125433 3300048915 Bacteria 2538
300 Ga0496112_1390818 3300048915 Bacteria 616
301 Ga0496113_0007237 3300048916 Bacteria 7115
302 Ga0496113_0168706 3300048916 Bacteria 1733
303 Ga0496113_0290173 3300048916 Bacteria 1309
304 Ga0496114_0000712 3300048917 Bacteria 24721
305 Ga0496115_0016508 3300048918 Bacteria 5624
306 Ga0496115_0280160 3300048918 Bacteria 1369
307 Ga0496115_0428946 3300048918 Bacteria 1070
308 Ga0496116_0000071 3300048919 Bacteria 244521
309 Ga0496116_0024374 3300048919 Bacteria 4477
310 Ga0496117_0000003 3300048920 Bacteria 1881097
311 Ga0496117_0000417 3300048920 Bacteria 71654
312 Ga0496117_0086444 3300048920 Bacteria 2037
313 Ga0496118_0000001 3300048921 Bacteria 1881100
314 Ga0496118_0000350 3300048921 Bacteria 78354
315 Ga0496118_0000604 3300048921 Bacteria 59356
316 Ga0496119_0003282 3300048922 Bacteria 16914
317 Ga0496119_0037686 3300048922 Bacteria 3136
318 Ga0496119_0060564 3300048922 Bacteria 2265
319 Ga0496120_0000157 3300048923 Bacteria 112786
320 Ga0496120_0073290 3300048923 Bacteria 1874
321 Ga0496121_0000019 3300048924 Bacteria 499976
322 Ga0496121_0008927 3300048924 Bacteria 11635
323 Ga0496121_0093145 3300048924 Bacteria 2347
324 Ga0496123_0009580 3300048926 Bacteria 8699
325 Ga0496124_0147534 3300048927 Bacteria 1849
326 Ga0496124_0218427 3300048927 Bacteria 1436
327 Ga0496124_0422504 3300048927 Bacteria 918
328 Ga0496125_0044866 3300048928 Bacteria 3730
329 Ga0496126_0000186 3300048929 Bacteria 140016
330 Ga0496126_0012171 3300048929 Bacteria 8831
331 Ga0496126_0015320 3300048929 Bacteria 7714
332 Ga0496126_0243470 3300048929 Bacteria 1501
333 Ga0496126_0256521 3300048929 Bacteria 1455
334 Ga0501032_0326092 3300049569 Bacteria 990
335 Ga0501033_0907432 3300049570 Bacteria 592
336 Ga0501034_0009569 3300049571 Bacteria 10141
337 Ga0501037_0000984 3300049573 Bacteria 21156
338 Ga0501038_0017689 3300049574 Bacteria 6442
339 Ga0501038_0524481 3300049574 Bacteria 903
340 Ga0501039_0001520 3300049575 Bacteria 17087
341 Ga0501040_0576659 3300049576 Bacteria 812
342 Ga0501043_0004771 3300049579 Bacteria 10986
343 Ga0501070_0008045 3300049586 Bacteria 8925
344 Ga0501070_1030070 3300049586 Bacteria 637
345 Ga0501070_1094516 3300049586 Bacteria 615
346 Ga0501073_0050796 3300049589 Bacteria 2905
347 Ga0501044_0012078 3300049823 Bacteria 9355
348 nmdc:mga03683_134570_c1 3300050489 Bacteria 1108
349 nmdc:mga03683_23353_c1 3300050489 Bacteria 2408
350 nmdc:mga03683_373957_c1 3300050489 Bacteria 677
351 nmdc:mga03683_54766_c1 3300050489 Bacteria 1673
352 nmdc:mga03n38_161210_c1 3300050490 Bacteria 1136
353 nmdc:mga03n38_225843_c1 3300050490 Bacteria 979
354 nmdc:mga03n38_25276_c1 3300050490 Bacteria 2437
355 nmdc:mga03n38_315051_c1 3300050490 Bacteria 843
356 nmdc:mga03n38_339310_c1 3300050490 Bacteria 815
357 nmdc:mga03n38_4282_c1 3300050490 Bacteria 4702
358 nmdc:mga03n38_4927_c1 3300050490 Bacteria 4483
359 nmdc:mga00v17_137325_c1 3300050491 Bacteria 1566
360 nmdc:mga00v17_166222_c1 3300050491 Bacteria 1421
361 nmdc:mga00v17_17921_c1 3300050491 Bacteria 4016
362 nmdc:mga00v17_196576_c1 3300050491 Bacteria 1303
363 nmdc:mga00v17_221830_c1 3300050491 Bacteria 1224
364 nmdc:mga00v17_44398_c1 3300050491 Bacteria 2680
365 nmdc:mga00v17_614_c1 3300050491 Bacteria 19754
366 nmdc:mga00v17_920_c1 3300050491 Bacteria 15828
367 nmdc:mga0yw44_13741_c1 3300050492 Bacteria 4274
368 nmdc:mga0yw44_852_c1 3300050492 Bacteria 11429
369 nmdc:mga0k408_337505_c1 3300050493 Bacteria 899
370 nmdc:mga06z11_226382_c1 3300050494 Bacteria 1094
371 nmdc:mga06z11_4992_c1 3300050494 Bacteria 5273
372 nmdc:mga06z11_534043_c1 3300050494 Bacteria 712
373 nmdc:mga07m45_43201_c1 3300050496 Bacteria 2527
374 nmdc:mga07m45_72153_c2 3300050496 Bacteria 1111
375 nmdc:mga07m45_763_c1 3300050496 Bacteria 13819
376 nmdc:mga05p37_6888_c1 3300050507 Bacteria 13395
377 nmdc:mga09592_337730_c1 3300050508 Bacteria 1304
378 nmdc:mga0qj67_93574_c1 3300050509 Bacteria 2417
379 nmdc:mga0sz30_100603_c1 3300050516 Bacteria 792
380 nmdc:mga0sz30_130966_c1 3300050516 Bacteria 1105
381 nmdc:mga0sz30_179064_c1 3300050516 Bacteria 940
382 nmdc:mga0sz30_184629_c1 3300050516 Bacteria 926
383 nmdc:mga0sz30_329714_c1 3300050516 Bacteria 682
384 nmdc:mga0sz30_343_c1 3300050516 Bacteria 17800
385 nmdc:mga0sz30_63200_c1 3300050516 Bacteria 1584
386 nmdc:mga0sz30_76406_c2 3300050516 Bacteria 809
387 Ga0500610_0053993 3300053079 Bacteria 2095
388 Ga0500635_0044293 3300053080 Bacteria 1500
389 Ga0495655_0017092 3300053083 Bacteria 1574
390 Ga0500643_016794 3300053087 Bacteria 2469
391 Ga0500643_032706 3300053087 Bacteria 1577
392 Ga0500644_0090982 3300053088 Bacteria 1142
393 Ga0500641_0176496 3300053096 Bacteria 918
394 Ga0500556_0011612 3300053104 Bacteria 2611
395 Ga0500562_029716 3300053108 Bacteria 1438
396 Ga0500652_001182 3300053131 Bacteria 8321
397 Ga0500652_074359 3300053131 Bacteria 1411
398 Ga0500652_208193 3300053131 Bacteria 791
399 Ga0500655_063077 3300053133 Bacteria 749
400 Ga0500568_0075804 3300053139 Bacteria 1282
401 Ga0500588_0191024 3300053146 Bacteria 756
402 Ga0500616_0011912 3300053153 Bacteria 5111
403 Ga0500627_0024961 3300053158 Bacteria 2452
404 Ga0500627_0282309 3300053158 Bacteria 728
405 Ga0500633_0093980 3300053160 Bacteria 1098
406 Ga0500645_000361 3300053730 Bacteria 32453
407 Ga0500645_010095 3300053730 Bacteria 3141
408 Ga0466962_0041122 3300061719 Bacteria 2212
409 2644489930 2643221687 Bacteria 6500351
410 2644635527 2643221715 Bacteria 6671032
411 2738707494 2738541274 Bacteria 6909446
412 2739333990 2738543028 Bacteria 6917070
413 2902793297 2902792274 Bacteria 7270173
414 2902802874 2902799365 Bacteria 5419524
415 2902813474 2902810491 Bacteria 6794147
416 2902841555 2902837492 Bacteria 6697721
417 2929213986 2929212328 Bacteria 7708288
418 2939587785 2939582691 Bacteria 7088898
419 Ga0070670_100162265
420 rootH2_10089003
421 Ga0055540_1001481
422 Ga0055540_1002635
423 Ga0055540_1004493
424 Ga0070658_10537355
425 Ga0068868_100275701
426 Ga0070689_100460108
427 Ga0070692_10715180
428 Ga0070668_100004049
429 Ga0070668_101075797
430 Ga0070669_100013274
431 Ga0070671_100028266
432 Ga0070674_100535920
433 Ga0070674_100712825
434 Ga0070673_100485351
435 Ga0070659_101025542
436 Ga0070667_100000582
437 Ga0070667_100028841
438 Ga0070709_10267370
439 Ga0070714_101589967
440 Ga0070713_100083930
441 Ga0070711_101167478
442 Ga0070663_100170262
443 Ga0070678_100334652
444 Ga0070685_10010167
445 Ga0070679_101902205
446 Ga0070684_100360763
447 Ga0068853_100064787
448 Ga0068853_100596285
449 Ga0070686_100140209
450 Ga0070686_100284971
451 Ga0070696_101381622
452 Ga0070693_100061368
453 Ga0070665_100002795
454 Ga0070665_100105894
455 Ga0068855_100439401
456 Ga0068852_100767539
457 Ga0068859_100003603
458 Ga0068864_100116925
459 Ga0068866_10730672
460 Ga0068863_100002822
461 Ga0068863_100222342
462 Ga0068858_100005156
463 Ga0068858_100592500
464 Ga0068860_100000016
465 Ga0068860_100306007
466 Ga0068860_100619741
467 Ga0068860_100695642
468 Ga0068862_100000051
469 Ga0081455_10060197
470 Ga0081455_10079850
471 Ga0075365_10000705
472 Ga0075365_10015788
473 Ga0075365_10018736
474 Ga0075368_10015011
475 Ga0075363_100001263
476 Ga0075363_100003824
477 Ga0075363_100006656
478 Ga0075363_100016444
479 Ga0075363_100017873
480 Ga0075363_100027392
481 Ga0075363_100113376
482 Ga0075363_100165182
483 Ga0075363_100326346
484 Ga0075363_100418604
485 Ga0075364_10001139
486 Ga0075364_10014357
487 Ga0075364_10017459
488 Ga0075364_10048009
489 Ga0075364_10077092
490 Ga0075364_10170500
491 Ga0075364_10220557
492 Ga0075364_10468475
493 Ga0075364_10497855
494 Ga0070712_101031321
495 Ga0075362_10006082
496 Ga0075362_10018252
497 Ga0075362_10022583
498 Ga0075362_10256608
499 Ga0075367_10006553
500 Ga0075367_10233422
501 Ga0075367_10637133
502 Ga0075369_10000381
503 Ga0075369_10044745
504 Ga0075369_10059683
505 Ga0075369_10061245
506 Ga0075369_10094727
507 Ga0075369_10113210
508 Ga0075369_10159713
509 Ga0075369_10162242
510 Ga0075369_10194374
511 Ga0075366_10364306
512 Ga0075370_10006823
513 Ga0075370_10026962
514 Ga0075370_10043723
515 Ga0075370_10206680
516 Ga0075370_10257339
517 Ga0075370_10271473
518 Ga0075428_100148796
519 Ga0075430_100009778
520 Ga0075430_100194012
521 Ga0075429_100388893
522 Ga0097620_100003604
523 Ga0099795_10061536
524 Ga0105250_10149916
525 Ga0111539_10825307
526 Ga0105247_10000017
527 Ga0105247_10034435
528 Ga0114129_10004320
529 Ga0105242_11436224
530 Ga0105248_10000025
531 Ga0105248_10043695
532 Ga0105237_10000745
533 Ga0105238_10212968
534 Ga0105238_11050933
535 Ga0105249_10000021
536 Ga0105033_112250
537 Ga0105239_10001328
538 Ga0105239_10165844
539 Ga0157371_10594035
540 Ga0157374_10692247
541 Ga0163162_10059117
542 Ga0163162_12316661
543 Ga0157375_10222070
544 Ga0163163_10139323
545 Ga0163163_10152180
546 Ga0157380_10459276
547 Ga0157380_11220379
548 Ga0157377_10069783
549 Ga0157379_10273565
550 Ga0157379_10401136
551 Ga0163161_10241633
552 Ga0163161_10342039
553 Ga0163161_11387095
554 Ga0213874_10066160
555 Ga0209051_1001752
556 Ga0209051_1002406
557 Ga0209051_1012294
558 Ga0207642_10078364
559 Ga0207710_10000033
560 Ga0207710_10021480
561 Ga0207680_10614711
562 Ga0207705_10429812
563 Ga0207671_10013580
564 Ga0207693_10217196
565 Ga0207663_10578251
566 Ga0207657_10525972
567 Ga0207646_10345437
568 Ga0207681_10004635
569 Ga0207694_10396907
570 Ga0207694_10398584
571 Ga0207650_10103542
572 Ga0207700_10087887
573 Ga0207664_10108065
574 Ga0207664_10203698
575 Ga0207664_11190039
576 Ga0207644_10120252
577 Ga0207644_10758372
578 Ga0207690_10685673
579 Ga0207686_11160377
580 Ga0207709_10755793
581 Ga0207669_10047865
582 Ga0207665_10143705
583 Ga0207711_10000390
584 Ga0207711_10069330
585 Ga0207667_10404514
586 Ga0207712_10000005
587 Ga0207668_10001360
588 Ga0207658_10001262
589 Ga0207658_10048040
590 Ga0207658_10408183
591 Ga0207703_10030925
592 Ga0207703_11215376
593 Ga0207639_10044745
594 Ga0207639_10795011
595 Ga0207678_10017171
596 Ga0207678_10843195
597 Ga0207641_10001387
598 Ga0207641_10003222
599 Ga0207641_10303461
600 Ga0207676_10364583
601 Ga0207683_10355947
602 Ga0207683_10650546
603 Ga0268266_10005558
604 Ga0268266_10083342
605 Ga0268265_10000022
606 Ga0268264_10000005
607 Ga0268264_10300980
608 Ga0268264_11891241
609 Ga0307405_10301890
610 Ga0307410_10661584
611 Ga0307410_10778608
612 Ga0307409_102055095
613 Ga0307416_100052549
614 Ga0307416_101051694
615 Ga0307416_101140208
616 Ga0307416_102012688
617 Ga0307411_10627017
618 Ga0307411_11066002
619 Ga0307415_100278018
620 Ga0307415_101221246
621 Ga0316583_10070569
622 Ga0316584_0292875
623 Ga0395905_1653741
624 Ga0436365_0842203
625 Ga0436363_0273080
626 Ga0439461_0014014
627 Ga0439466_0008319
628 Ga0439466_0010701
629 Ga0439466_0018459
630 Ga0439465_0013636
631 Ga0451789_0507954
632 Ga0451793_0140214
633 Ga0451793_1750832
634 Ga0451797_1329587
635 Ga0451795_1240608
636 Ga0451795_1577984
637 Ga0451802_1395454
638 Ga0451802_2023222
639 Ga0451804_0054343
640 Ga0451804_0472646
641 Ga0451807_0725696
642 Ga0451807_2286951
643 Ga0451837_0771116
644 Ga0451841_0745063
645 Ga0451849_0724616
646 Ga0451853_1833492
647 Ga0439431_0022522
648 Ga0439431_0046634
649 Ga0439445_0009995
650 Ga0439445_0038468
651 Ga0439434_0008920
652 Ga0439434_0103082
653 Ga0466972_0059163
654 Ga0466972_0253690
655 Ga0466965_0012053
656 Ga0466966_0175981
657 Ga0466961_0006692
658 Ga0466963_0324860
659 Ga0466971_0061413
660 Ga0466968_0353064
661 Ga0466968_0561364
662 Ga0466970_0029435
663 Ga0466970_0166746
664 Ga0466957_0021395
665 Ga0466957_0064206
666 Ga0466957_0703052
667 Ga0466960_0014243
668 Ga0466960_0108526
669 Ga0466959_0001602
670 Ga0466959_0020060
671 Ga0466958_0001984
672 Ga0466958_0044365
673 Ga0466958_0264967
674 Ga0466967_0225932
675 Ga0466967_0392341
676 Ga0466967_0655696
677 Ga0466967_1197784
678 Ga0495638_0008424
679 Ga0495638_0034869
680 Ga0495606_0040835
681 Ga0495597_0280175
682 Ga0495649_0465117
683 Ga0495649_0597050
684 Ga0495649_0651685
685 Ga0495672_0050100
686 Ga0495672_0105235
687 Ga0495672_0210055
688 Ga0495686_0002701
689 Ga0495626_0091864
690 Ga0496100_0001287
691 Ga0496100_0010237
692 Ga0496100_0487720
693 Ga0496101_0000002
694 Ga0496101_0000933
695 Ga0496101_0026611
696 Ga0496101_0044913
697 Ga0496102_0000003
698 Ga0496102_0000449
699 Ga0496102_0051885
700 Ga0496102_0102925
701 Ga0496102_0266453
702 Ga0496103_0000014
703 Ga0496103_0000515
704 Ga0496104_0015477
705 Ga0496104_0026925
706 Ga0496105_0009653
707 Ga0496105_0080763
708 Ga0496106_0006137
709 Ga0496106_0137313
710 Ga0496107_0001748
711 Ga0496107_0011142
712 Ga0496108_0511535
713 Ga0496108_1388462
714 Ga0496108_1763989
715 Ga0496109_0011451
716 Ga0496109_0198744
717 Ga0496112_0125433
718 Ga0496112_1390818
719 Ga0496113_0007237
720 Ga0496113_0168706
721 Ga0496113_0290173
722 Ga0496114_0000712
723 Ga0496115_0016508
724 Ga0496115_0280160
725 Ga0496115_0428946
726 Ga0496116_0000071
727 Ga0496116_0024374
728 Ga0496117_0000003
729 Ga0496117_0000417
730 Ga0496117_0086444
731 Ga0496118_0000001
732 Ga0496118_0000350
733 Ga0496118_0000604
734 Ga0496119_0003282
735 Ga0496119_0037686
736 Ga0496119_0060564
737 Ga0496120_0000157
738 Ga0496120_0073290
739 Ga0496121_0000019
740 Ga0496121_0008927
741 Ga0496121_0093145
742 Ga0496123_0009580
743 Ga0496124_0147534
744 Ga0496124_0218427
745 Ga0496124_0422504
746 Ga0496125_0044866
747 Ga0496126_0000186
748 Ga0496126_0012171
749 Ga0496126_0015320
750 Ga0496126_0243470
751 Ga0496126_0256521
752 Ga0501032_0326092
753 Ga0501033_0907432
754 Ga0501034_0009569
755 Ga0501037_0000984
756 Ga0501038_0017689
757 Ga0501038_0524481
758 Ga0501039_0001520
759 Ga0501040_0576659
760 Ga0501043_0004771
761 Ga0501070_0008045
762 Ga0501070_1030070
763 Ga0501070_1094516
764 Ga0501073_0050796
765 Ga0501044_0012078
766 nmdc:mga03683_134570_c1
767 nmdc:mga03683_23353_c1
768 nmdc:mga03683_373957_c1
769 nmdc:mga03683_54766_c1
770 nmdc:mga03n38_161210_c1
771 nmdc:mga03n38_225843_c1
772 nmdc:mga03n38_25276_c1
773 nmdc:mga03n38_315051_c1
774 nmdc:mga03n38_339310_c1
775 nmdc:mga03n38_4282_c1
776 nmdc:mga03n38_4927_c1
777 nmdc:mga00v17_137325_c1
778 nmdc:mga00v17_166222_c1
779 nmdc:mga00v17_17921_c1
780 nmdc:mga00v17_196576_c1
781 nmdc:mga00v17_221830_c1
782 nmdc:mga00v17_44398_c1
783 nmdc:mga00v17_614_c1
784 nmdc:mga00v17_920_c1
785 nmdc:mga0yw44_13741_c1
786 nmdc:mga0yw44_852_c1
787 nmdc:mga0k408_337505_c1
788 nmdc:mga06z11_226382_c1
789 nmdc:mga06z11_4992_c1
790 nmdc:mga06z11_534043_c1
791 nmdc:mga07m45_43201_c1
792 nmdc:mga07m45_72153_c2
793 nmdc:mga07m45_763_c1
794 nmdc:mga05p37_6888_c1
795 nmdc:mga09592_337730_c1
796 nmdc:mga0qj67_93574_c1
797 nmdc:mga0sz30_100603_c1
798 nmdc:mga0sz30_130966_c1
799 nmdc:mga0sz30_179064_c1
800 nmdc:mga0sz30_184629_c1
801 nmdc:mga0sz30_329714_c1
802 nmdc:mga0sz30_343_c1
803 nmdc:mga0sz30_63200_c1
804 nmdc:mga0sz30_76406_c2
805 Ga0500610_0053993
806 Ga0500635_0044293
807 Ga0495655_0017092
808 Ga0500643_016794
809 Ga0500643_032706
810 Ga0500644_0090982
811 Ga0500641_0176496
812 Ga0500556_0011612
813 Ga0500562_029716
814 Ga0500652_001182
815 Ga0500652_074359
816 Ga0500652_208193
817 Ga0500655_063077
818 Ga0500568_0075804
819 Ga0500588_0191024
820 Ga0500616_0011912
821 Ga0500627_0024961
822 Ga0500627_0282309
823 Ga0500633_0093980
824 Ga0500645_000361
825 Ga0500645_010095
826 Ga0466962_0041122
827 2644489930
828 2644635527
829 2738707494
830 2739333990
831 2902793297
832 2902802874
833 2902813474
834 2902841555
835 2929213986
836 2939587785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

16

101

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7369 4 121
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.7009 7 119
2hq9-assembly1.cif.gz_B crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 a resolution 0.6961 4 121
2hq9-assembly1.cif.gz_A crystal structure of a fad-binding protein (mll6688) from mesorhizobium loti at 1.95 a resolution 0.6868 8 121
6eci-assembly4.cif.gz_G structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.6847 4 121
ID Description Score Start End Superfamily
af_O50398_10_140_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9194 2 123 2.30.110.10
af_O50398_10_140_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8772 2 123 2.30.110.10
af_A0A2R8Q548_824_944_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7571 18 50 2.30.29.30
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7123 4 127 2.30.110.10
af_Q1L8U8_634_686_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7117 20 47 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A654U7F9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.911 1 127 GO:0005829
GO:0016627
GO:0070967
AF-A0A7I9WZE8-F1-model_v4 deleted 0.9051 3 127
AF-A0A654U7F9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9041 1 127 GO:0005829
GO:0016627
GO:0070967
AF-A0A5C7XLA6-F1-model_v4 TIGR03667 family PPOX class F420-dependent oxidoreductase 0.89 5 123 GO:0005829
GO:0016020
GO:0016627
GO:0070967
AF-A0A7I9WZE8-F1-model_v4 deleted 0.8845 3 127

Map