F439224
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 418 | 207 | 418 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10052512|Ga0070666_100525123 |
| Length | 174 |
| Sequence | MLLDPASRDVRLHFRDMPKLSHYDRAGRATMVDVSTKSVSKREAEASAFIELTPEVLRALPANPKGDPLEVARLAGIMAAKKTSDLIPMCHPLPLSHVDVSIRLCENGVAISSRVTTTAVTGVEMEALVAVSVAALTVYDMCKALDKGIRIREIKLERKSGGKSGDYVRRRKKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 94 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 95 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 96 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 97 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 206 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 4.31 |
| Rhizosphere | 94.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000348 | 3300000546 | Bacteria | 8112 |
| 2 | Ga0065712_10215342 | 3300005290 | Bacteria | 1059 |
| 3 | Ga0065715_10258067 | 3300005293 | Bacteria | 1138 |
| 4 | Ga0070658_10822693 | 3300005327 | Unclassified | 807 |
| 5 | Ga0070683_100059686 | 3300005329 | Bacteria | 3544 |
| 6 | Ga0070683_100087964 | 3300005329 | Bacteria | 2914 |
| 7 | Ga0070683_100127344 | 3300005329 | Unclassified | 2408 |
| 8 | Ga0070670_100008469 | 3300005331 | Bacteria | 8772 |
| 9 | Ga0070670_100157013 | 3300005331 | Unclassified | 1971 |
| 10 | Ga0068869_100012737 | 3300005334 | Bacteria | 5562 |
| 11 | Ga0070666_10052512 | 3300005335 | Unclassified | 2747 |
| 12 | Ga0070680_100117874 | 3300005336 | Bacteria | 2214 |
| 13 | Ga0070682_100176724 | 3300005337 | Bacteria | 1488 |
| 14 | Ga0068868_100000465 | 3300005338 | Bacteria | 26992 |
| 15 | Ga0068868_100021153 | 3300005338 | Unclassified | 4899 |
| 16 | Ga0068868_100043091 | 3300005338 | Bacteria | 3525 |
| 17 | Ga0068868_100871388 | 3300005338 | Bacteria | 817 |
| 18 | Ga0068868_100968611 | 3300005338 | Unclassified | 777 |
| 19 | Ga0070660_100094089 | 3300005339 | Bacteria | 2367 |
| 20 | Ga0070689_100159591 | 3300005340 | Bacteria | 1822 |
| 21 | Ga0070691_10142028 | 3300005341 | Bacteria | 1224 |
| 22 | Ga0070687_100236072 | 3300005343 | Bacteria | 1128 |
| 23 | Ga0070661_100101340 | 3300005344 | Bacteria | 2142 |
| 24 | Ga0070661_100555002 | 3300005344 | Bacteria | 924 |
| 25 | Ga0070675_100619410 | 3300005354 | Bacteria | 982 |
| 26 | Ga0070671_100188748 | 3300005355 | Bacteria | 1747 |
| 27 | Ga0070674_100263349 | 3300005356 | Bacteria | 1359 |
| 28 | Ga0070673_100070923 | 3300005364 | Bacteria | 2798 |
| 29 | Ga0070673_100261146 | 3300005364 | Bacteria | 1513 |
| 30 | Ga0070659_100033114 | 3300005366 | Bacteria | 4012 |
| 31 | Ga0070659_100413315 | 3300005366 | Bacteria | 1140 |
| 32 | Ga0070667_100183324 | 3300005367 | Unclassified | 1852 |
| 33 | Ga0070709_10007937 | 3300005434 | Bacteria | 5830 |
| 34 | Ga0070709_10091456 | 3300005434 | Bacteria | 2008 |
| 35 | Ga0070709_10243369 | 3300005434 | Bacteria | 1293 |
| 36 | Ga0070709_10635496 | 3300005434 | Bacteria | 825 |
| 37 | Ga0070714_100006205 | 3300005435 | Bacteria | 9194 |
| 38 | Ga0070714_100020493 | 3300005435 | Bacteria | 5399 |
| 39 | Ga0070714_100025754 | 3300005435 | Bacteria | 4857 |
| 40 | Ga0070714_100115241 | 3300005435 | Bacteria | 2385 |
| 41 | Ga0070714_100364892 | 3300005435 | Bacteria | 1358 |
| 42 | Ga0070714_100779911 | 3300005435 | Bacteria | 925 |
| 43 | Ga0070714_101155990 | 3300005435 | Bacteria | 755 |
| 44 | Ga0070714_101963190 | 3300005435 | Bacteria | 571 |
| 45 | Ga0070713_100003749 | 3300005436 | Bacteria | 10058 |
| 46 | Ga0070713_100014838 | 3300005436 | Bacteria | 5800 |
| 47 | Ga0070713_100120188 | 3300005436 | Bacteria | 2303 |
| 48 | Ga0070713_100898977 | 3300005436 | Bacteria | 852 |
| 49 | Ga0070710_10012248 | 3300005437 | Bacteria | 4254 |
| 50 | Ga0070710_10077609 | 3300005437 | Unclassified | 1931 |
| 51 | Ga0070711_100000476 | 3300005439 | Bacteria | 20852 |
| 52 | Ga0070711_100629258 | 3300005439 | Bacteria | 898 |
| 53 | Ga0070708_100010243 | 3300005445 | Bacteria | 7590 |
| 54 | Ga0070708_100153292 | 3300005445 | Bacteria | 2144 |
| 55 | Ga0070708_101209148 | 3300005445 | Bacteria | 707 |
| 56 | Ga0070662_100463396 | 3300005457 | Bacteria | 1053 |
| 57 | Ga0070681_10001481 | 3300005458 | Bacteria | 20738 |
| 58 | Ga0070681_10016075 | 3300005458 | Bacteria | 7459 |
| 59 | Ga0070681_10044122 | 3300005458 | Bacteria | 4463 |
| 60 | Ga0070681_10596760 | 3300005458 | Bacteria | 1018 |
| 61 | Ga0068867_100008997 | 3300005459 | Bacteria | 7046 |
| 62 | Ga0070685_10332705 | 3300005466 | Unclassified | 1033 |
| 63 | Ga0070706_100155333 | 3300005467 | Bacteria | 2136 |
| 64 | Ga0070707_100224641 | 3300005468 | Bacteria | 1828 |
| 65 | Ga0070707_100424782 | 3300005468 | Bacteria | 1289 |
| 66 | Ga0070707_100942009 | 3300005468 | Unclassified | 828 |
| 67 | Ga0070698_100090191 | 3300005471 | Bacteria | 3049 |
| 68 | Ga0070699_100005316 | 3300005518 | Bacteria | 11297 |
| 69 | Ga0070679_100002345 | 3300005530 | Bacteria | 17137 |
| 70 | Ga0070679_100033636 | 3300005530 | Bacteria | 5076 |
| 71 | Ga0070679_100039861 | 3300005530 | Bacteria | 4670 |
| 72 | Ga0070679_100063618 | 3300005530 | Bacteria | 3677 |
| 73 | Ga0070679_100242194 | 3300005530 | Unclassified | 1761 |
| 74 | Ga0070679_100275045 | 3300005530 | Bacteria | 1637 |
| 75 | Ga0070684_100083958 | 3300005535 | Unclassified | 2823 |
| 76 | Ga0070684_100138728 | 3300005535 | Bacteria | 2198 |
| 77 | Ga0070697_100001591 | 3300005536 | Bacteria | 17329 |
| 78 | Ga0070697_100006458 | 3300005536 | Bacteria | 9078 |
| 79 | Ga0070697_100011237 | 3300005536 | Bacteria | 6998 |
| 80 | Ga0070697_100023052 | 3300005536 | Bacteria | 4950 |
| 81 | Ga0070697_100032036 | 3300005536 | Bacteria | 4228 |
| 82 | Ga0068853_100911873 | 3300005539 | Unclassified | 844 |
| 83 | Ga0070686_100730248 | 3300005544 | Bacteria | 792 |
| 84 | Ga0070695_100225086 | 3300005545 | Bacteria | 1353 |
| 85 | Ga0070693_100030183 | 3300005547 | Bacteria | 2962 |
| 86 | Ga0070693_100050772 | 3300005547 | Bacteria | 2372 |
| 87 | Ga0068855_100000477 | 3300005563 | Bacteria | 49253 |
| 88 | Ga0068855_100000664 | 3300005563 | Bacteria | 41988 |
| 89 | Ga0068855_100019350 | 3300005563 | Bacteria | 8181 |
| 90 | Ga0068855_100049672 | 3300005563 | Bacteria | 4946 |
| 91 | Ga0068855_101854371 | 3300005563 | Bacteria | 612 |
| 92 | Ga0070664_100000304 | 3300005564 | Bacteria | 35664 |
| 93 | Ga0070664_100211723 | 3300005564 | Bacteria | 1732 |
| 94 | Ga0070664_100278840 | 3300005564 | Bacteria | 1507 |
| 95 | Ga0068857_100008491 | 3300005577 | Bacteria | 8879 |
| 96 | Ga0068857_100021111 | 3300005577 | Bacteria | 5730 |
| 97 | Ga0068857_100072671 | 3300005577 | Unclassified | 3065 |
| 98 | Ga0068854_100023308 | 3300005578 | Unclassified | 4227 |
| 99 | Ga0068854_100028477 | 3300005578 | Bacteria | 3861 |
| 100 | Ga0068854_100029396 | 3300005578 | Bacteria | 3804 |
| 101 | Ga0068856_100000334 | 3300005614 | Bacteria | 51590 |
| 102 | Ga0068856_100000667 | 3300005614 | Bacteria | 37242 |
| 103 | Ga0068856_100001991 | 3300005614 | Bacteria | 21304 |
| 104 | Ga0068856_100250121 | 3300005614 | Bacteria | 1788 |
| 105 | Ga0068856_100561729 | 3300005614 | Bacteria | 1162 |
| 106 | Ga0068852_100027791 | 3300005616 | Bacteria | 4617 |
| 107 | Ga0068852_100088147 | 3300005616 | Bacteria | 2771 |
| 108 | Ga0068852_100203012 | 3300005616 | Unclassified | 1876 |
| 109 | Ga0068852_100693047 | 3300005616 | Bacteria | 1028 |
| 110 | Ga0068859_100023059 | 3300005617 | Bacteria | 6242 |
| 111 | Ga0068864_100012672 | 3300005618 | Bacteria | 6970 |
| 112 | Ga0068864_100264071 | 3300005618 | Bacteria | 1602 |
| 113 | Ga0068866_10001555 | 3300005718 | Bacteria | 9752 |
| 114 | Ga0068866_10199642 | 3300005718 | Unclassified | 1194 |
| 115 | Ga0068861_100269581 | 3300005719 | Bacteria | 1461 |
| 116 | Ga0068870_10015894 | 3300005840 | Bacteria | 3583 |
| 117 | Ga0068863_100044379 | 3300005841 | Bacteria | 4220 |
| 118 | Ga0068863_100287811 | 3300005841 | Bacteria | 1593 |
| 119 | Ga0068863_101277826 | 3300005841 | Bacteria | 741 |
| 120 | Ga0068858_100003363 | 3300005842 | Bacteria | 15926 |
| 121 | Ga0068858_100025554 | 3300005842 | Bacteria | 5495 |
| 122 | Ga0068858_100063571 | 3300005842 | Unclassified | 3415 |
| 123 | Ga0068860_100008186 | 3300005843 | Bacteria | 10409 |
| 124 | Ga0068860_100057629 | 3300005843 | Unclassified | 3693 |
| 125 | Ga0068860_100146847 | 3300005843 | Bacteria | 2269 |
| 126 | Ga0070717_10000800 | 3300006028 | Bacteria | 20687 |
| 127 | Ga0070717_10008127 | 3300006028 | Bacteria | 7829 |
| 128 | Ga0070717_10291519 | 3300006028 | Bacteria | 1449 |
| 129 | Ga0070717_11140892 | 3300006028 | Bacteria | 710 |
| 130 | Ga0070715_10011807 | 3300006163 | Unclassified | 3156 |
| 131 | Ga0070716_100270910 | 3300006173 | Unclassified | 1167 |
| 132 | Ga0070716_100527649 | 3300006173 | Bacteria | 876 |
| 133 | Ga0070712_100003881 | 3300006175 | Bacteria | 9207 |
| 134 | Ga0070712_100319653 | 3300006175 | Bacteria | 1262 |
| 135 | Ga0097621_100000153 | 3300006237 | Bacteria | 42702 |
| 136 | Ga0097621_100000415 | 3300006237 | Bacteria | 29789 |
| 137 | Ga0097621_100000992 | 3300006237 | Bacteria | 19954 |
| 138 | Ga0097621_100021499 | 3300006237 | Bacteria | 4993 |
| 139 | Ga0068871_100000565 | 3300006358 | Bacteria | 25303 |
| 140 | Ga0068871_100000712 | 3300006358 | Bacteria | 22517 |
| 141 | Ga0068871_100000931 | 3300006358 | Bacteria | 19542 |
| 142 | Ga0075428_100762843 | 3300006844 | Bacteria | 1029 |
| 143 | Ga0075434_100002949 | 3300006871 | Bacteria | 15125 |
| 144 | Ga0068865_100009486 | 3300006881 | Bacteria | 6037 |
| 145 | Ga0068865_100291754 | 3300006881 | Unclassified | 1302 |
| 146 | Ga0075436_100160249 | 3300006914 | Bacteria | 1586 |
| 147 | Ga0075436_100587951 | 3300006914 | Bacteria | 819 |
| 148 | Ga0097620_100023059 | 3300006931 | Bacteria | 6242 |
| 149 | Ga0099795_10051319 | 3300007788 | Unclassified | 1503 |
| 150 | Ga0105240_10075270 | 3300009093 | Unclassified | 4164 |
| 151 | Ga0105240_10100353 | 3300009093 | Bacteria | 3522 |
| 152 | Ga0105240_10209712 | 3300009093 | Bacteria | 2277 |
| 153 | Ga0105240_10216677 | 3300009093 | Bacteria | 2233 |
| 154 | Ga0105240_12566410 | 3300009093 | Bacteria | 527 |
| 155 | Ga0105245_10000384 | 3300009098 | Bacteria | 41154 |
| 156 | Ga0105245_10917890 | 3300009098 | Bacteria | 918 |
| 157 | Ga0114129_10064252 | 3300009147 | Bacteria | 5122 |
| 158 | Ga0105241_10057374 | 3300009174 | Bacteria | 2987 |
| 159 | Ga0105241_10086147 | 3300009174 | Unclassified | 2470 |
| 160 | Ga0105241_10087087 | 3300009174 | Unclassified | 2457 |
| 161 | Ga0105241_10330057 | 3300009174 | Unclassified | 1318 |
| 162 | Ga0105241_10751425 | 3300009174 | Bacteria | 894 |
| 163 | Ga0105242_10084569 | 3300009176 | Bacteria | 2659 |
| 164 | Ga0105248_10008650 | 3300009177 | Bacteria | 11183 |
| 165 | Ga0105248_10078001 | 3300009177 | Unclassified | 3725 |
| 166 | Ga0105248_10090708 | 3300009177 | Bacteria | 3441 |
| 167 | Ga0105248_10259934 | 3300009177 | Unclassified | 1954 |
| 168 | Ga0105248_10315374 | 3300009177 | Bacteria | 1761 |
| 169 | Ga0105237_10032816 | 3300009545 | Bacteria | 5257 |
| 170 | Ga0105237_10113017 | 3300009545 | Bacteria | 2708 |
| 171 | Ga0105237_10276364 | 3300009545 | Bacteria | 1682 |
| 172 | Ga0105237_11475351 | 3300009545 | Bacteria | 687 |
| 173 | Ga0105238_10000219 | 3300009551 | Bacteria | 63043 |
| 174 | Ga0105238_10016350 | 3300009551 | Bacteria | 7510 |
| 175 | Ga0105238_10381801 | 3300009551 | Bacteria | 1400 |
| 176 | Ga0099796_10018343 | 3300010159 | Bacteria | 2100 |
| 177 | Ga0105239_10037386 | 3300010375 | Bacteria | 5322 |
| 178 | Ga0105239_10093575 | 3300010375 | Unclassified | 3319 |
| 179 | Ga0105239_10116582 | 3300010375 | Unclassified | 2964 |
| 180 | Ga0105239_11735372 | 3300010375 | Bacteria | 723 |
| 181 | Ga0157373_10070944 | 3300013100 | Bacteria | 2462 |
| 182 | Ga0157373_10092736 | 3300013100 | Bacteria | 2127 |
| 183 | Ga0157373_10120707 | 3300013100 | Unclassified | 1842 |
| 184 | Ga0157369_10000565 | 3300013105 | Bacteria | 48680 |
| 185 | Ga0157369_10035102 | 3300013105 | Bacteria | 5500 |
| 186 | Ga0157369_10039889 | 3300013105 | Bacteria | 5130 |
| 187 | Ga0157369_10078981 | 3300013105 | Unclassified | 3525 |
| 188 | Ga0157369_10561215 | 3300013105 | Bacteria | 1180 |
| 189 | Ga0157374_10000280 | 3300013296 | Bacteria | 47309 |
| 190 | Ga0157374_10000702 | 3300013296 | Bacteria | 29423 |
| 191 | Ga0157374_10002230 | 3300013296 | Bacteria | 16325 |
| 192 | Ga0157374_10025967 | 3300013296 | Bacteria | 5266 |
| 193 | Ga0157374_10223212 | 3300013296 | Bacteria | 1849 |
| 194 | Ga0157378_10000157 | 3300013297 | Bacteria | 64384 |
| 195 | Ga0157378_10000229 | 3300013297 | Bacteria | 54489 |
| 196 | Ga0157378_10000992 | 3300013297 | Bacteria | 26009 |
| 197 | Ga0157378_10015156 | 3300013297 | Bacteria | 6749 |
| 198 | Ga0157378_10041243 | 3300013297 | Bacteria | 4094 |
| 199 | Ga0163162_10055181 | 3300013306 | Bacteria | 3999 |
| 200 | Ga0163162_10302099 | 3300013306 | Bacteria | 1733 |
| 201 | Ga0157372_10001179 | 3300013307 | Bacteria | 28254 |
| 202 | Ga0157372_10002008 | 3300013307 | Bacteria | 22106 |
| 203 | Ga0157372_10003049 | 3300013307 | Bacteria | 18055 |
| 204 | Ga0157372_10034628 | 3300013307 | Bacteria | 5554 |
| 205 | Ga0157372_10040580 | 3300013307 | Bacteria | 5141 |
| 206 | Ga0157372_10269165 | 3300013307 | Bacteria | 1979 |
| 207 | Ga0163163_10198807 | 3300014325 | Bacteria | 2053 |
| 208 | Ga0182008_10041902 | 3300014497 | Bacteria | 2282 |
| 209 | Ga0157377_10196744 | 3300014745 | Bacteria | 1277 |
| 210 | Ga0157379_10142729 | 3300014968 | Bacteria | 2159 |
| 211 | Ga0157376_10170557 | 3300014969 | Unclassified | 1981 |
| 212 | Ga0157376_10195437 | 3300014969 | Bacteria | 1858 |
| 213 | Ga0157376_10778524 | 3300014969 | Bacteria | 968 |
| 214 | Ga0182006_1022385 | 3300015261 | Unclassified | 2628 |
| 215 | Ga0182007_10037286 | 3300015262 | Bacteria | 1633 |
| 216 | Ga0213874_10095823 | 3300021377 | Bacteria | 981 |
| 217 | Ga0224569_100278 | 3300022732 | Bacteria | 4306 |
| 218 | Ga0224571_100383 | 3300022734 | Bacteria | 2390 |
| 219 | Ga0224572_1010833 | 3300024225 | Bacteria | 1719 |
| 220 | Ga0228598_1001050 | 3300024227 | Bacteria | 6073 |
| 221 | Ga0228598_1003343 | 3300024227 | Bacteria | 3455 |
| 222 | Ga0207682_10180495 | 3300025893 | Bacteria | 964 |
| 223 | Ga0207692_10532569 | 3300025898 | Bacteria | 749 |
| 224 | Ga0207642_10097782 | 3300025899 | Bacteria | 1466 |
| 225 | Ga0207680_10080054 | 3300025903 | Unclassified | 2051 |
| 226 | Ga0207647_10050774 | 3300025904 | Bacteria | 2566 |
| 227 | Ga0207699_10067113 | 3300025906 | Bacteria | 2180 |
| 228 | Ga0207699_10474653 | 3300025906 | Bacteria | 900 |
| 229 | Ga0207643_10045293 | 3300025908 | Bacteria | 2484 |
| 230 | Ga0207705_11096505 | 3300025909 | Unclassified | 613 |
| 231 | Ga0207684_10034641 | 3300025910 | Bacteria | 4290 |
| 232 | Ga0207684_10227598 | 3300025910 | Bacteria | 1609 |
| 233 | Ga0207684_10528918 | 3300025910 | Bacteria | 1009 |
| 234 | Ga0207654_10084661 | 3300025911 | Unclassified | 1917 |
| 235 | Ga0207654_10339907 | 3300025911 | Bacteria | 1031 |
| 236 | Ga0207654_10427210 | 3300025911 | Unclassified | 925 |
| 237 | Ga0207707_10000681 | 3300025912 | Bacteria | 33712 |
| 238 | Ga0207707_10027950 | 3300025912 | Bacteria | 4932 |
| 239 | Ga0207695_10007887 | 3300025913 | Bacteria | 13438 |
| 240 | Ga0207695_10153236 | 3300025913 | Bacteria | 2242 |
| 241 | Ga0207695_10395467 | 3300025913 | Bacteria | 1267 |
| 242 | Ga0207671_10031184 | 3300025914 | Bacteria | 3972 |
| 243 | Ga0207671_10040340 | 3300025914 | Unclassified | 3456 |
| 244 | Ga0207693_10163232 | 3300025915 | Bacteria | 1753 |
| 245 | Ga0207663_10393927 | 3300025916 | Bacteria | 1058 |
| 246 | Ga0207660_10049324 | 3300025917 | Bacteria | 2983 |
| 247 | Ga0207657_10033756 | 3300025919 | Bacteria | 4609 |
| 248 | Ga0207649_10126719 | 3300025920 | Bacteria | 1729 |
| 249 | Ga0207652_10020957 | 3300025921 | Bacteria | 5391 |
| 250 | Ga0207652_10021846 | 3300025921 | Bacteria | 5286 |
| 251 | Ga0207652_10027833 | 3300025921 | Unclassified | 4714 |
| 252 | Ga0207652_10235299 | 3300025921 | Bacteria | 1651 |
| 253 | Ga0207646_10075610 | 3300025922 | Unclassified | 3009 |
| 254 | Ga0207694_10001905 | 3300025924 | Bacteria | 17287 |
| 255 | Ga0207694_10146764 | 3300025924 | Bacteria | 1899 |
| 256 | Ga0207694_11529033 | 3300025924 | Bacteria | 563 |
| 257 | Ga0207650_10006405 | 3300025925 | Bacteria | 8018 |
| 258 | Ga0207659_10477189 | 3300025926 | Bacteria | 1053 |
| 259 | Ga0207687_10004670 | 3300025927 | Bacteria | 9113 |
| 260 | Ga0207687_11001026 | 3300025927 | Bacteria | 717 |
| 261 | Ga0207700_10020596 | 3300025928 | Bacteria | 4483 |
| 262 | Ga0207700_10091323 | 3300025928 | Bacteria | 2405 |
| 263 | Ga0207700_10213407 | 3300025928 | Bacteria | 1633 |
| 264 | Ga0207700_10258161 | 3300025928 | Bacteria | 1491 |
| 265 | Ga0207700_10530147 | 3300025928 | Bacteria | 1044 |
| 266 | Ga0207664_10010781 | 3300025929 | Bacteria | 6466 |
| 267 | Ga0207664_10217660 | 3300025929 | Bacteria | 1655 |
| 268 | Ga0207664_10241552 | 3300025929 | Bacteria | 1573 |
| 269 | Ga0207664_10695321 | 3300025929 | Bacteria | 914 |
| 270 | Ga0207644_10478172 | 3300025931 | Bacteria | 1026 |
| 271 | Ga0207690_11059622 | 3300025932 | Bacteria | 675 |
| 272 | Ga0207706_10007827 | 3300025933 | Bacteria | 9863 |
| 273 | Ga0207706_10387448 | 3300025933 | Bacteria | 1212 |
| 274 | Ga0207706_10766034 | 3300025933 | Bacteria | 822 |
| 275 | Ga0207686_10066763 | 3300025934 | Bacteria | 2299 |
| 276 | Ga0207670_10259725 | 3300025936 | Bacteria | 1346 |
| 277 | Ga0207669_10234957 | 3300025937 | Bacteria | 1355 |
| 278 | Ga0207704_10004850 | 3300025938 | Bacteria | 6175 |
| 279 | Ga0207704_10439504 | 3300025938 | Unclassified | 1039 |
| 280 | Ga0207665_10697833 | 3300025939 | Bacteria | 798 |
| 281 | Ga0207711_10016537 | 3300025941 | Bacteria | 6127 |
| 282 | Ga0207711_10170605 | 3300025941 | Unclassified | 1974 |
| 283 | Ga0207711_10812916 | 3300025941 | Bacteria | 870 |
| 284 | Ga0207711_10955352 | 3300025941 | Bacteria | 796 |
| 285 | Ga0207689_10036713 | 3300025942 | Bacteria | 4068 |
| 286 | Ga0207661_10108858 | 3300025944 | Bacteria | 2340 |
| 287 | Ga0207661_10236256 | 3300025944 | Bacteria | 1620 |
| 288 | Ga0207679_10000789 | 3300025945 | Bacteria | 20715 |
| 289 | Ga0207679_10035126 | 3300025945 | Bacteria | 3543 |
| 290 | Ga0207679_10422746 | 3300025945 | Bacteria | 1176 |
| 291 | Ga0207667_10000764 | 3300025949 | Bacteria | 41822 |
| 292 | Ga0207667_10017825 | 3300025949 | Bacteria | 7983 |
| 293 | Ga0207667_10042765 | 3300025949 | Bacteria | 4813 |
| 294 | Ga0207667_10153289 | 3300025949 | Unclassified | 2371 |
| 295 | Ga0207667_10392934 | 3300025949 | Bacteria | 1412 |
| 296 | Ga0207667_11566948 | 3300025949 | Bacteria | 628 |
| 297 | Ga0207651_10241259 | 3300025960 | Bacteria | 1473 |
| 298 | Ga0207651_10289963 | 3300025960 | Bacteria | 1356 |
| 299 | Ga0207640_10003853 | 3300025981 | Bacteria | 8094 |
| 300 | Ga0207640_10029683 | 3300025981 | Bacteria | 3359 |
| 301 | Ga0207640_10044967 | 3300025981 | Unclassified | 2833 |
| 302 | Ga0207640_10187006 | 3300025981 | Bacteria | 1558 |
| 303 | Ga0207658_10151438 | 3300025986 | Unclassified | 1890 |
| 304 | Ga0207677_10003799 | 3300026023 | Bacteria | 8020 |
| 305 | Ga0207677_10005450 | 3300026023 | Bacteria | 6908 |
| 306 | Ga0207677_10043002 | 3300026023 | Unclassified | 3001 |
| 307 | Ga0207677_10342032 | 3300026023 | Bacteria | 1250 |
| 308 | Ga0207703_10013014 | 3300026035 | Bacteria | 6483 |
| 309 | Ga0207703_10018742 | 3300026035 | Bacteria | 5406 |
| 310 | Ga0207703_11105667 | 3300026035 | Unclassified | 761 |
| 311 | Ga0207639_10092987 | 3300026041 | Bacteria | 2417 |
| 312 | Ga0207702_10001773 | 3300026078 | Bacteria | 21236 |
| 313 | Ga0207702_10002987 | 3300026078 | Bacteria | 15742 |
| 314 | Ga0207702_10087803 | 3300026078 | Bacteria | 2716 |
| 315 | Ga0207702_10106864 | 3300026078 | Bacteria | 2481 |
| 316 | Ga0207702_10168453 | 3300026078 | Bacteria | 2006 |
| 317 | Ga0207641_10033924 | 3300026088 | Bacteria | 4243 |
| 318 | Ga0207641_10187291 | 3300026088 | Bacteria | 1900 |
| 319 | Ga0207648_10009875 | 3300026089 | Bacteria | 9097 |
| 320 | Ga0207648_10140263 | 3300026089 | Unclassified | 2130 |
| 321 | Ga0207676_10002632 | 3300026095 | Bacteria | 12794 |
| 322 | Ga0207676_10023956 | 3300026095 | Bacteria | 4512 |
| 323 | Ga0207676_10080678 | 3300026095 | Bacteria | 2641 |
| 324 | Ga0207676_10232203 | 3300026095 | Unclassified | 1650 |
| 325 | Ga0207674_10003318 | 3300026116 | Bacteria | 19788 |
| 326 | Ga0207674_10034148 | 3300026116 | Bacteria | 5320 |
| 327 | Ga0207674_10043435 | 3300026116 | Bacteria | 4634 |
| 328 | Ga0207675_100442123 | 3300026118 | Bacteria | 1287 |
| 329 | Ga0207683_10292247 | 3300026121 | Bacteria | 1490 |
| 330 | Ga0207698_10028935 | 3300026142 | Unclassified | 3960 |
| 331 | Ga0207698_11006438 | 3300026142 | Bacteria | 844 |
| 332 | Ga0209179_1014552 | 3300027512 | Unclassified | 1446 |
| 333 | Ga0265357_1003812 | 3300028023 | Bacteria | 1327 |
| 334 | Ga0268266_10152686 | 3300028379 | Bacteria | 2083 |
| 335 | Ga0268266_10833276 | 3300028379 | Unclassified | 891 |
| 336 | Ga0268264_10053800 | 3300028381 | Bacteria | 3359 |
| 337 | Ga0265770_1004103 | 3300030878 | Bacteria | 1984 |
| 338 | Ga0265760_10001600 | 3300031090 | Bacteria | 6659 |
| 339 | Ga0265760_10016092 | 3300031090 | Bacteria | 2145 |
| 340 | Ga0373930_0140965 | 3300034816 | Unclassified | 599 |
| 341 | Ga0373936_0044227 | 3300035113 | Bacteria | 1791 |
| 342 | Ga0373945_0116710 | 3300035116 | Unclassified | 1058 |
| 343 | Ga0373946_0032360 | 3300035171 | Bacteria | 2100 |
| 344 | Ga0373955_0300578 | 3300035172 | Bacteria | 968 |
| 345 | Ga0373924_0065086 | 3300035410 | Unclassified | 1531 |
| 346 | Ga0373924_0099108 | 3300035410 | Bacteria | 1252 |
| 347 | Ga0373931_0039397 | 3300035691 | Bacteria | 2476 |
| 348 | Ga0373931_0170103 | 3300035691 | Bacteria | 1283 |
| 349 | Ga0373935_0066593 | 3300035692 | Bacteria | 2314 |
| 350 | Ga0373935_0316565 | 3300035692 | Unclassified | 1106 |
| 351 | Ga0373927_0130136 | 3300035695 | Bacteria | 1644 |
| 352 | Ga0373927_0229280 | 3300035695 | Unclassified | 1220 |
| 353 | Ga0373927_0240943 | 3300035695 | Unclassified | 1188 |
| 354 | Ga0373927_1130079 | 3300035695 | Bacteria | 517 |
| 355 | Ga0373933_0334109 | 3300035724 | Unclassified | 983 |
| 356 | Ga0373947_0048813 | 3300035725 | Bacteria | 2540 |
| 357 | Ga0373937_0245265 | 3300036401 | Unclassified | 1688 |
| 358 | Ga0373937_0286151 | 3300036401 | Bacteria | 1557 |
| 359 | Ga0373937_0365621 | 3300036401 | Bacteria | 1368 |
| 360 | Ga0373925_0033519 | 3300037068 | Unclassified | 3784 |
| 361 | Ga0395900_0293443 | 3300037418 | Bacteria | 1614 |
| 362 | Ga0395898_0153351 | 3300037466 | Bacteria | 2204 |
| 363 | Ga0395898_1169328 | 3300037466 | Bacteria | 701 |
| 364 | Ga0395905_0039526 | 3300037471 | Bacteria | 4426 |
| 365 | Ga0395905_0063097 | 3300037471 | Bacteria | 3466 |
| 366 | Ga0395905_0177653 | 3300037471 | Bacteria | 1998 |
| 367 | Ga0395901_0626701 | 3300038443 | Bacteria | 1082 |
| 368 | Ga0436363_0828059 | 3300039450 | Bacteria | 1359 |
| 369 | Ga0466963_0025699 | 3300044694 | Bacteria | 3758 |
| 370 | Ga0466967_0140561 | 3300045976 | Bacteria | 2248 |
| 371 | Ga0495629_0167697 | 3300046459 | Bacteria | 1525 |
| 372 | Ga0495580_0001212 | 3300046472 | Bacteria | 22706 |
| 373 | Ga0495580_0001301 | 3300046472 | Bacteria | 22045 |
| 374 | Ga0495580_0012898 | 3300046472 | Bacteria | 6403 |
| 375 | Ga0495580_0014014 | 3300046472 | Bacteria | 6098 |
| 376 | Ga0495580_0041131 | 3300046472 | Bacteria | 3297 |
| 377 | Ga0495580_0216481 | 3300046472 | Bacteria | 1317 |
| 378 | Ga0495580_0299275 | 3300046472 | Bacteria | 1095 |
| 379 | Ga0495630_0020435 | 3300046517 | Bacteria | 4883 |
| 380 | Ga0495665_0068026 | 3300046531 | Unclassified | 1878 |
| 381 | Ga0495586_0245415 | 3300046535 | Bacteria | 1021 |
| 382 | Ga0495656_0243790 | 3300046615 | Bacteria | 906 |
| 383 | Ga0495635_0599763 | 3300046663 | Unclassified | 719 |
| 384 | Ga0495646_0336197 | 3300046680 | Unclassified | 793 |
| 385 | Ga0495669_0016621 | 3300046684 | Bacteria | 3152 |
| 386 | Ga0495669_0344429 | 3300046684 | Bacteria | 720 |
| 387 | Ga0495674_0022663 | 3300047319 | Bacteria | 5790 |
| 388 | Ga0495674_0089456 | 3300047319 | Unclassified | 2632 |
| 389 | Ga0495674_0705423 | 3300047319 | Bacteria | 792 |
| 390 | Ga0496100_0580655 | 3300048903 | Unclassified | 869 |
| 391 | Ga0496102_0169000 | 3300048905 | Bacteria | 2058 |
| 392 | Ga0496102_0227879 | 3300048905 | Bacteria | 1757 |
| 393 | Ga0496103_0318378 | 3300048906 | Bacteria | 1000 |
| 394 | Ga0496104_0060068 | 3300048907 | Unclassified | 3601 |
| 395 | Ga0496104_0262620 | 3300048907 | Bacteria | 1639 |
| 396 | Ga0496105_0138035 | 3300048908 | Bacteria | 2008 |
| 397 | Ga0496105_0288890 | 3300048908 | Unclassified | 1321 |
| 398 | Ga0496106_0030578 | 3300048909 | Bacteria | 4014 |
| 399 | Ga0496108_0099713 | 3300048911 | Bacteria | 2476 |
| 400 | Ga0496109_0098752 | 3300048912 | Bacteria | 2707 |
| 401 | Ga0496109_1472999 | 3300048912 | Unclassified | 616 |
| 402 | Ga0496110_0161949 | 3300048913 | Bacteria | 2028 |
| 403 | Ga0496111_0241170 | 3300048914 | Bacteria | 1342 |
| 404 | Ga0496112_0011207 | 3300048915 | Bacteria | 8177 |
| 405 | Ga0496112_0079235 | 3300048915 | Unclassified | 3249 |
| 406 | Ga0496112_0121059 | 3300048915 | Bacteria | 2586 |
| 407 | Ga0496112_0384837 | 3300048915 | Bacteria | 1343 |
| 408 | Ga0501067_0190336 | 3300049583 | Bacteria | 1143 |
| 409 | Ga0501069_0867318 | 3300049585 | Bacteria | 549 |
| 410 | Ga0501073_0010534 | 3300049589 | Bacteria | 6771 |
| 411 | Ga0501083_0239538 | 3300049744 | Bacteria | 1181 |
| 412 | nmdc:mga05p37_893174_c1 | 3300050507 | Bacteria | 959 |
| 413 | nmdc:mga08x19_1056781_c1 | 3300050514 | Bacteria | 576 |
| 414 | nmdc:mga08x19_417247_c1 | 3300050514 | Bacteria | 942 |
| 415 | Ga0495601_0012392 | 3300053077 | Bacteria | 5115 |
| 416 | Ga0500590_246033 | 3300053148 | Bacteria | 715 |
| 417 | Ga0501084_0159354 | 3300054114 | Bacteria | 1904 |
| 418 | Ga0501082_0129022 | 3300060353 | Bacteria | 2194 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005290 | Ga0065712_10215342 | Ga0065712_102153422 | 141 |
| 2 | 3300005329 | Ga0070683_100059686 | Ga0070683_1000596864 | 141 |
| 3 | 3300005329 | Ga0070683_100087964 | Ga0070683_1000879643 | 141 |
| 4 | 3300005329 | Ga0070683_100127344 | Ga0070683_1001273442 | 141 |
| 5 | 3300005331 | Ga0070670_100157013 | Ga0070670_1001570133 | 141 |
| 6 | 3300005334 | Ga0068869_100012737 | Ga0068869_1000127375 | 141 |
| 7 | 3300005338 | Ga0068868_100000465 | Ga0068868_1000004655 | 141 |
| 8 | 3300005338 | Ga0068868_100043091 | Ga0068868_1000430912 | 141 |
| 9 | 3300005338 | Ga0068868_100871388 | Ga0068868_1008713882 | 141 |
| 10 | 3300005339 | Ga0070660_100094089 | Ga0070660_1000940892 | 141 |
| 11 | 3300005344 | Ga0070661_100101340 | Ga0070661_1001013402 | 141 |
| 12 | 3300005354 | Ga0070675_100619410 | Ga0070675_1006194102 | 141 |
| 13 | 3300005356 | Ga0070674_100263349 | Ga0070674_1002633492 | 141 |
| 14 | 3300005364 | Ga0070673_100261146 | Ga0070673_1002611463 | 141 |
| 15 | 3300005366 | Ga0070659_100033114 | Ga0070659_1000331146 | 141 |
| 16 | 3300005366 | Ga0070659_100413315 | Ga0070659_1004133152 | 141 |
| 17 | 3300005434 | Ga0070709_10091456 | Ga0070709_100914562 | 141 |
| 18 | 3300005434 | Ga0070709_10635496 | Ga0070709_106354961 | 141 |
| 19 | 3300005435 | Ga0070714_100006205 | Ga0070714_1000062054 | 141 |
| 20 | 3300005435 | Ga0070714_100025754 | Ga0070714_1000257543 | 141 |
| 21 | 3300005435 | Ga0070714_100115241 | Ga0070714_1001152412 | 141 |
| 22 | 3300005435 | Ga0070714_100779911 | Ga0070714_1007799112 | 141 |
| 23 | 3300005436 | Ga0070713_100014838 | Ga0070713_1000148386 | 141 |
| 24 | 3300005436 | Ga0070713_100120188 | Ga0070713_1001201881 | 141 |
| 25 | 3300005436 | Ga0070713_100898977 | Ga0070713_1008989772 | 141 |
| 26 | 3300005445 | Ga0070708_100153292 | Ga0070708_1001532922 | 141 |
| 27 | 3300005445 | Ga0070708_101209148 | Ga0070708_1012091481 | 141 |
| 28 | 3300005457 | Ga0070662_100463396 | Ga0070662_1004633962 | 141 |
| 29 | 3300005458 | Ga0070681_10001481 | Ga0070681_100014815 | 141 |
| 30 | 3300005458 | Ga0070681_10016075 | Ga0070681_100160756 | 141 |
| 31 | 3300005458 | Ga0070681_10044122 | Ga0070681_100441221 | 141 |
| 32 | 3300005459 | Ga0068867_100008997 | Ga0068867_1000089972 | 141 |
| 33 | 3300005468 | Ga0070707_100424782 | Ga0070707_1004247822 | 141 |
| 34 | 3300005468 | Ga0070707_100942009 | Ga0070707_1009420092 | 141 |
| 35 | 3300005530 | Ga0070679_100002345 | Ga0070679_10000234511 | 141 |
| 36 | 3300005530 | Ga0070679_100039861 | Ga0070679_1000398613 | 141 |
| 37 | 3300005530 | Ga0070679_100063618 | Ga0070679_1000636184 | 141 |
| 38 | 3300005530 | Ga0070679_100242194 | Ga0070679_1002421943 | 141 |
| 39 | 3300005535 | Ga0070684_100138728 | Ga0070684_1001387282 | 141 |
| 40 | 3300005536 | Ga0070697_100023052 | Ga0070697_1000230526 | 141 |
| 41 | 3300005544 | Ga0070686_100730248 | Ga0070686_1007302482 | 141 |
| 42 | 3300005547 | Ga0070693_100030183 | Ga0070693_1000301832 | 141 |
| 43 | 3300005563 | Ga0068855_101854371 | Ga0068855_1018543712 | 141 |
| 44 | 3300005577 | Ga0068857_100072671 | Ga0068857_1000726714 | 141 |
| 45 | 3300005578 | Ga0068854_100029396 | Ga0068854_1000293962 | 141 |
| 46 | 3300005614 | Ga0068856_100250121 | Ga0068856_1002501212 | 141 |
| 47 | 3300005614 | Ga0068856_100561729 | Ga0068856_1005617291 | 141 |
| 48 | 3300005616 | Ga0068852_100203012 | Ga0068852_1002030123 | 141 |
| 49 | 3300005616 | Ga0068852_100693047 | Ga0068852_1006930472 | 141 |
| 50 | 3300005841 | Ga0068863_100287811 | Ga0068863_1002878113 | 141 |
| 51 | 3300005842 | Ga0068858_100025554 | Ga0068858_1000255544 | 141 |
| 52 | 3300006028 | Ga0070717_10291519 | Ga0070717_102915192 | 141 |
| 53 | 3300006173 | Ga0070716_100270910 | Ga0070716_1002709102 | 141 |
| 54 | 3300006173 | Ga0070716_100527649 | Ga0070716_1005276492 | 141 |
| 55 | 3300006844 | Ga0075428_100762843 | Ga0075428_1007628432 | 141 |
| 56 | 3300006881 | Ga0068865_100009486 | Ga0068865_1000094865 | 141 |
| 57 | 3300006914 | Ga0075436_100160249 | Ga0075436_1001602492 | 141 |
| 58 | 3300006914 | Ga0075436_100587951 | Ga0075436_1005879511 | 141 |
| 59 | 3300009093 | Ga0105240_10075270 | Ga0105240_100752706 | 141 |
| 60 | 3300009093 | Ga0105240_10100353 | Ga0105240_101003535 | 141 |
| 61 | 3300009093 | Ga0105240_10216677 | Ga0105240_102166772 | 141 |
| 62 | 3300009093 | Ga0105240_12566410 | Ga0105240_125664101 | 141 |
| 63 | 3300009098 | Ga0105245_10917890 | Ga0105245_109178902 | 141 |
| 64 | 3300009174 | Ga0105241_10086147 | Ga0105241_100861472 | 141 |
| 65 | 3300009177 | Ga0105248_10008650 | Ga0105248_100086505 | 141 |
| 66 | 3300009545 | Ga0105237_10276364 | Ga0105237_102763641 | 141 |
| 67 | 3300009545 | Ga0105237_11475351 | Ga0105237_114753511 | 141 |
| 68 | 3300009551 | Ga0105238_10000219 | Ga0105238_1000021925 | 141 |
| 69 | 3300009551 | Ga0105238_10381801 | Ga0105238_103818012 | 141 |
| 70 | 3300010375 | Ga0105239_10093575 | Ga0105239_100935753 | 141 |
| 71 | 3300013105 | Ga0157369_10000565 | Ga0157369_1000056526 | 141 |
| 72 | 3300013105 | Ga0157369_10035102 | Ga0157369_100351022 | 141 |
| 73 | 3300013296 | Ga0157374_10000280 | Ga0157374_1000028024 | 141 |
| 74 | 3300013296 | Ga0157374_10000702 | Ga0157374_1000070220 | 141 |
| 75 | 3300013297 | Ga0157378_10000157 | Ga0157378_1000015725 | 141 |
| 76 | 3300013297 | Ga0157378_10015156 | Ga0157378_100151566 | 141 |
| 77 | 3300013306 | Ga0163162_10302099 | Ga0163162_103020992 | 141 |
| 78 | 3300013307 | Ga0157372_10001179 | Ga0157372_100011796 | 141 |
| 79 | 3300013307 | Ga0157372_10002008 | Ga0157372_1000200812 | 141 |
| 80 | 3300013307 | Ga0157372_10040580 | Ga0157372_100405802 | 141 |
| 81 | 3300013307 | Ga0157372_10269165 | Ga0157372_102691652 | 141 |
| 82 | 3300014325 | Ga0163163_10198807 | Ga0163163_101988073 | 141 |
| 83 | 3300014969 | Ga0157376_10195437 | Ga0157376_101954372 | 141 |
| 84 | 3300024225 | Ga0224572_1010833 | Ga0224572_10108332 | 141 |
| 85 | 3300024227 | Ga0228598_1001050 | Ga0228598_10010502 | 141 |
| 86 | 3300025893 | Ga0207682_10180495 | Ga0207682_101804951 | 141 |
| 87 | 3300025906 | Ga0207699_10067113 | Ga0207699_100671132 | 141 |
| 88 | 3300025906 | Ga0207699_10474653 | Ga0207699_104746532 | 141 |
| 89 | 3300025911 | Ga0207654_10339907 | Ga0207654_103399072 | 141 |
| 90 | 3300025911 | Ga0207654_10427210 | Ga0207654_104272102 | 141 |
| 91 | 3300025913 | Ga0207695_10007887 | Ga0207695_100078872 | 141 |
| 92 | 3300025913 | Ga0207695_10153236 | Ga0207695_101532362 | 141 |
| 93 | 3300025913 | Ga0207695_10395467 | Ga0207695_103954671 | 141 |
| 94 | 3300025916 | Ga0207663_10393927 | Ga0207663_103939272 | 141 |
| 95 | 3300025919 | Ga0207657_10033756 | Ga0207657_100337567 | 141 |
| 96 | 3300025921 | Ga0207652_10021846 | Ga0207652_100218462 | 141 |
| 97 | 3300025928 | Ga0207700_10020596 | Ga0207700_100205964 | 141 |
| 98 | 3300025929 | Ga0207664_10010781 | Ga0207664_100107814 | 141 |
| 99 | 3300025929 | Ga0207664_10217660 | Ga0207664_102176602 | 141 |
| 100 | 3300025929 | Ga0207664_10241552 | Ga0207664_102415522 | 141 |
| 101 | 3300025931 | Ga0207644_10478172 | Ga0207644_104781722 | 141 |
| 102 | 3300025933 | Ga0207706_10007827 | Ga0207706_100078277 | 141 |
| 103 | 3300025934 | Ga0207686_10066763 | Ga0207686_100667632 | 141 |
| 104 | 3300025937 | Ga0207669_10234957 | Ga0207669_102349572 | 141 |
| 105 | 3300025938 | Ga0207704_10004850 | Ga0207704_100048504 | 141 |
| 106 | 3300025939 | Ga0207665_10697833 | Ga0207665_106978332 | 141 |
| 107 | 3300025941 | Ga0207711_10016537 | Ga0207711_100165372 | 141 |
| 108 | 3300025941 | Ga0207711_10812916 | Ga0207711_108129162 | 141 |
| 109 | 3300025941 | Ga0207711_10955352 | Ga0207711_109553521 | 141 |
| 110 | 3300025944 | Ga0207661_10236256 | Ga0207661_102362562 | 141 |
| 111 | 3300025945 | Ga0207679_10035126 | Ga0207679_100351264 | 141 |
| 112 | 3300025949 | Ga0207667_11566948 | Ga0207667_115669481 | 141 |
| 113 | 3300025960 | Ga0207651_10289963 | Ga0207651_102899631 | 141 |
| 114 | 3300025981 | Ga0207640_10187006 | Ga0207640_101870062 | 141 |
| 115 | 3300026023 | Ga0207677_10005450 | Ga0207677_100054507 | 141 |
| 116 | 3300026023 | Ga0207677_10342032 | Ga0207677_103420322 | 141 |
| 117 | 3300026035 | Ga0207703_10018742 | Ga0207703_100187423 | 141 |
| 118 | 3300026035 | Ga0207703_11105667 | Ga0207703_111056671 | 141 |
| 119 | 3300026041 | Ga0207639_10092987 | Ga0207639_100929872 | 141 |
| 120 | 3300026078 | Ga0207702_10087803 | Ga0207702_100878033 | 141 |
| 121 | 3300026078 | Ga0207702_10168453 | Ga0207702_101684532 | 141 |
| 122 | 3300026088 | Ga0207641_10187291 | Ga0207641_101872911 | 141 |
| 123 | 3300026095 | Ga0207676_10023956 | Ga0207676_100239567 | 141 |
| 124 | 3300026116 | Ga0207674_10043435 | Ga0207674_100434354 | 141 |
| 125 | 3300026118 | Ga0207675_100442123 | Ga0207675_1004421232 | 141 |
| 126 | 3300026121 | Ga0207683_10292247 | Ga0207683_102922472 | 141 |
| 127 | 3300026142 | Ga0207698_11006438 | Ga0207698_110064382 | 141 |
| 128 | 3300028023 | Ga0265357_1003812 | Ga0265357_10038121 | 141 |
| 129 | 3300030878 | Ga0265770_1004103 | Ga0265770_10041031 | 141 |
| 130 | 3300031090 | Ga0265760_10001600 | Ga0265760_100016002 | 141 |
| 131 | 3300031090 | Ga0265760_10016092 | Ga0265760_100160922 | 141 |
| 132 | 3300035691 | Ga0373931_0039397 | Ga0373931_0039397_1753_2181 | 141 |
| 133 | 3300035695 | Ga0373927_1130079 | Ga0373927_1130079_68_502 | 141 |
| 134 | 3300044694 | Ga0466963_0025699 | Ga0466963_0025699_214_639 | 141 |
| 135 | 3300045976 | Ga0466967_0140561 | Ga0466967_0140561_1340_1765 | 141 |
| 136 | 3300046472 | Ga0495580_0014014 | Ga0495580_0014014_1206_1631 | 141 |
| 137 | 3300046472 | Ga0495580_0216481 | Ga0495580_0216481_814_1290 | 141 |
| 138 | 3300046472 | Ga0495580_0299275 | Ga0495580_0299275_649_1083 | 141 |
| 139 | 3300047319 | Ga0495674_0705423 | Ga0495674_0705423_12_437 | 141 |
| 140 | 3300048903 | Ga0496100_0580655 | Ga0496100_0580655_155_583 | 141 |
| 141 | 3300048905 | Ga0496102_0227879 | Ga0496102_0227879_301_729 | 141 |
| 142 | 3300048907 | Ga0496104_0060068 | Ga0496104_0060068_59_487 | 141 |
| 143 | 3300048908 | Ga0496105_0288890 | Ga0496105_0288890_512_940 | 141 |
| 144 | 3300048912 | Ga0496109_1472999 | Ga0496109_1472999_141_569 | 141 |
| 145 | 3300048915 | Ga0496112_0079235 | Ga0496112_0079235_1329_1757 | 141 |
| 146 | 3300048915 | Ga0496112_0121059 | Ga0496112_0121059_1382_1810 | 141 |
| 147 | 3300049583 | Ga0501067_0190336 | Ga0501067_0190336_175_600 | 141 |
| 148 | 3300005471 | Ga0070698_100090191 | Ga0070698_1000901914 | 143 |
| 149 | 3300025910 | Ga0207684_10034641 | Ga0207684_100346411 | 143 |
| 150 | 3300048911 | Ga0496108_0099713 | Ga0496108_0099713_759_1196 | 144 |
| 151 | 3300005327 | Ga0070658_10822693 | Ga0070658_108226931 | 155 |
| 152 | 3300005335 | Ga0070666_10052512 | Ga0070666_100525123 | 155 |
| 153 | 3300005336 | Ga0070680_100117874 | Ga0070680_1001178743 | 155 |
| 154 | 3300005338 | Ga0068868_100021153 | Ga0068868_1000211532 | 155 |
| 155 | 3300005367 | Ga0070667_100183324 | Ga0070667_1001833242 | 155 |
| 156 | 3300005458 | Ga0070681_10596760 | Ga0070681_105967602 | 155 |
| 157 | 3300005466 | Ga0070685_10332705 | Ga0070685_103327052 | 155 |
| 158 | 3300005530 | Ga0070679_100033636 | Ga0070679_1000336367 | 155 |
| 159 | 3300005530 | Ga0070679_100275045 | Ga0070679_1002750452 | 155 |
| 160 | 3300005535 | Ga0070684_100083958 | Ga0070684_1000839582 | 155 |
| 161 | 3300005539 | Ga0068853_100911873 | Ga0068853_1009118731 | 155 |
| 162 | 3300005718 | Ga0068866_10199642 | Ga0068866_101996422 | 155 |
| 163 | 3300005843 | Ga0068860_100057629 | Ga0068860_1000576295 | 155 |
| 164 | 3300006237 | Ga0097621_100000415 | Ga0097621_10000041524 | 155 |
| 165 | 3300006358 | Ga0068871_100000565 | Ga0068871_10000056522 | 155 |
| 166 | 3300006871 | Ga0075434_100002949 | Ga0075434_1000029498 | 155 |
| 167 | 3300006881 | Ga0068865_100291754 | Ga0068865_1002917542 | 155 |
| 168 | 3300009098 | Ga0105245_10000384 | Ga0105245_1000038411 | 155 |
| 169 | 3300009174 | Ga0105241_10087087 | Ga0105241_100870872 | 155 |
| 170 | 3300009177 | Ga0105248_10259934 | Ga0105248_102599343 | 155 |
| 171 | 3300010375 | Ga0105239_10037386 | Ga0105239_100373862 | 155 |
| 172 | 3300013297 | Ga0157378_10000992 | Ga0157378_100009922 | 155 |
| 173 | 3300014969 | Ga0157376_10170557 | Ga0157376_101705571 | 155 |
| 174 | 3300025903 | Ga0207680_10080054 | Ga0207680_100800542 | 155 |
| 175 | 3300025909 | Ga0207705_11096505 | Ga0207705_110965051 | 155 |
| 176 | 3300025917 | Ga0207660_10049324 | Ga0207660_100493242 | 155 |
| 177 | 3300025921 | Ga0207652_10027833 | Ga0207652_100278334 | 155 |
| 178 | 3300025921 | Ga0207652_10235299 | Ga0207652_102352992 | 155 |
| 179 | 3300025927 | Ga0207687_10004670 | Ga0207687_100046707 | 155 |
| 180 | 3300025928 | Ga0207700_10258161 | Ga0207700_102581612 | 155 |
| 181 | 3300025933 | Ga0207706_10766034 | Ga0207706_107660342 | 155 |
| 182 | 3300025938 | Ga0207704_10439504 | Ga0207704_104395042 | 155 |
| 183 | 3300025941 | Ga0207711_10170605 | Ga0207711_101706052 | 155 |
| 184 | 3300025986 | Ga0207658_10151438 | Ga0207658_101514382 | 155 |
| 185 | 3300026023 | Ga0207677_10043002 | Ga0207677_100430023 | 155 |
| 186 | 3300026089 | Ga0207648_10140263 | Ga0207648_101402632 | 155 |
| 187 | 3300028379 | Ga0268266_10833276 | Ga0268266_108332762 | 155 |
| 188 | 3300034816 | Ga0373930_0140965 | Ga0373930_0140965_31_498 | 155 |
| 189 | 3300037418 | Ga0395900_0293443 | Ga0395900_0293443_942_1409 | 155 |
| 190 | 3300037466 | Ga0395898_0153351 | Ga0395898_0153351_1606_2073 | 155 |
| 191 | 3300037466 | Ga0395898_1169328 | Ga0395898_1169328_186_653 | 155 |
| 192 | 3300037471 | Ga0395905_0039526 | Ga0395905_0039526_3892_4359 | 155 |
| 193 | 3300037471 | Ga0395905_0063097 | Ga0395905_0063097_2765_3232 | 155 |
| 194 | 3300037471 | Ga0395905_0177653 | Ga0395905_0177653_1431_1898 | 155 |
| 195 | 3300038443 | Ga0395901_0626701 | Ga0395901_0626701_90_557 | 155 |
| 196 | 3300053148 | Ga0500590_246033 | Ga0500590_246033_206_682 | 155 |
| 197 | 3300000546 | LJNas_1000348 | LJNas_10003487 | 156 |
| 198 | 3300005293 | Ga0065715_10258067 | Ga0065715_102580671 | 156 |
| 199 | 3300005331 | Ga0070670_100008469 | Ga0070670_1000084692 | 156 |
| 200 | 3300005337 | Ga0070682_100176724 | Ga0070682_1001767242 | 156 |
| 201 | 3300005338 | Ga0068868_100968611 | Ga0068868_1009686111 | 156 |
| 202 | 3300005340 | Ga0070689_100159591 | Ga0070689_1001595911 | 156 |
| 203 | 3300005341 | Ga0070691_10142028 | Ga0070691_101420281 | 156 |
| 204 | 3300005343 | Ga0070687_100236072 | Ga0070687_1002360721 | 156 |
| 205 | 3300005344 | Ga0070661_100555002 | Ga0070661_1005550022 | 156 |
| 206 | 3300005355 | Ga0070671_100188748 | Ga0070671_1001887482 | 156 |
| 207 | 3300005364 | Ga0070673_100070923 | Ga0070673_1000709232 | 156 |
| 208 | 3300005434 | Ga0070709_10007937 | Ga0070709_100079376 | 156 |
| 209 | 3300005434 | Ga0070709_10243369 | Ga0070709_102433692 | 156 |
| 210 | 3300005435 | Ga0070714_100020493 | Ga0070714_1000204932 | 156 |
| 211 | 3300005435 | Ga0070714_100364892 | Ga0070714_1003648921 | 156 |
| 212 | 3300005435 | Ga0070714_101155990 | Ga0070714_1011559902 | 156 |
| 213 | 3300005435 | Ga0070714_101963190 | Ga0070714_1019631901 | 156 |
| 214 | 3300005436 | Ga0070713_100003749 | Ga0070713_1000037496 | 156 |
| 215 | 3300005437 | Ga0070710_10012248 | Ga0070710_100122485 | 156 |
| 216 | 3300005437 | Ga0070710_10077609 | Ga0070710_100776092 | 156 |
| 217 | 3300005439 | Ga0070711_100000476 | Ga0070711_1000004762 | 156 |
| 218 | 3300005439 | Ga0070711_100629258 | Ga0070711_1006292581 | 156 |
| 219 | 3300005445 | Ga0070708_100010243 | Ga0070708_1000102434 | 156 |
| 220 | 3300005467 | Ga0070706_100155333 | Ga0070706_1001553333 | 156 |
| 221 | 3300005468 | Ga0070707_100224641 | Ga0070707_1002246412 | 156 |
| 222 | 3300005518 | Ga0070699_100005316 | Ga0070699_10000531612 | 156 |
| 223 | 3300005536 | Ga0070697_100001591 | Ga0070697_10000159115 | 156 |
| 224 | 3300005536 | Ga0070697_100006458 | Ga0070697_1000064581 | 156 |
| 225 | 3300005536 | Ga0070697_100011237 | Ga0070697_1000112377 | 156 |
| 226 | 3300005536 | Ga0070697_100032036 | Ga0070697_1000320363 | 156 |
| 227 | 3300005545 | Ga0070695_100225086 | Ga0070695_1002250862 | 156 |
| 228 | 3300005547 | Ga0070693_100050772 | Ga0070693_1000507722 | 156 |
| 229 | 3300005563 | Ga0068855_100000477 | Ga0068855_10000047717 | 156 |
| 230 | 3300005563 | Ga0068855_100000664 | Ga0068855_10000066430 | 156 |
| 231 | 3300005563 | Ga0068855_100019350 | Ga0068855_1000193509 | 156 |
| 232 | 3300005563 | Ga0068855_100049672 | Ga0068855_1000496724 | 156 |
| 233 | 3300005564 | Ga0070664_100000304 | Ga0070664_10000030420 | 156 |
| 234 | 3300005564 | Ga0070664_100211723 | Ga0070664_1002117232 | 156 |
| 235 | 3300005564 | Ga0070664_100278840 | Ga0070664_1002788402 | 156 |
| 236 | 3300005577 | Ga0068857_100008491 | Ga0068857_1000084918 | 156 |
| 237 | 3300005577 | Ga0068857_100021111 | Ga0068857_1000211117 | 156 |
| 238 | 3300005578 | Ga0068854_100023308 | Ga0068854_1000233085 | 156 |
| 239 | 3300005578 | Ga0068854_100028477 | Ga0068854_1000284774 | 156 |
| 240 | 3300005614 | Ga0068856_100000334 | Ga0068856_10000033413 | 156 |
| 241 | 3300005614 | Ga0068856_100000667 | Ga0068856_10000066714 | 156 |
| 242 | 3300005614 | Ga0068856_100001991 | Ga0068856_1000019915 | 156 |
| 243 | 3300005616 | Ga0068852_100027791 | Ga0068852_1000277912 | 156 |
| 244 | 3300005616 | Ga0068852_100088147 | Ga0068852_1000881472 | 156 |
| 245 | 3300005617 | Ga0068859_100023059 | Ga0068859_1000230592 | 156 |
| 246 | 3300005618 | Ga0068864_100012672 | Ga0068864_1000126725 | 156 |
| 247 | 3300005618 | Ga0068864_100264071 | Ga0068864_1002640712 | 156 |
| 248 | 3300005718 | Ga0068866_10001555 | Ga0068866_100015552 | 156 |
| 249 | 3300005719 | Ga0068861_100269581 | Ga0068861_1002695812 | 156 |
| 250 | 3300005840 | Ga0068870_10015894 | Ga0068870_100158945 | 156 |
| 251 | 3300005841 | Ga0068863_100044379 | Ga0068863_1000443795 | 156 |
| 252 | 3300005841 | Ga0068863_101277826 | Ga0068863_1012778261 | 156 |
| 253 | 3300005842 | Ga0068858_100003363 | Ga0068858_1000033637 | 156 |
| 254 | 3300005842 | Ga0068858_100063571 | Ga0068858_1000635712 | 156 |
| 255 | 3300005843 | Ga0068860_100008186 | Ga0068860_1000081866 | 156 |
| 256 | 3300005843 | Ga0068860_100146847 | Ga0068860_1001468472 | 156 |
| 257 | 3300006028 | Ga0070717_10000800 | Ga0070717_1000080016 | 156 |
| 258 | 3300006028 | Ga0070717_10008127 | Ga0070717_100081272 | 156 |
| 259 | 3300006028 | Ga0070717_11140892 | Ga0070717_111408922 | 156 |
| 260 | 3300006163 | Ga0070715_10011807 | Ga0070715_100118074 | 156 |
| 261 | 3300006175 | Ga0070712_100003881 | Ga0070712_1000038819 | 156 |
| 262 | 3300006175 | Ga0070712_100319653 | Ga0070712_1003196532 | 156 |
| 263 | 3300006237 | Ga0097621_100000153 | Ga0097621_10000015340 | 156 |
| 264 | 3300006237 | Ga0097621_100000992 | Ga0097621_1000009927 | 156 |
| 265 | 3300006237 | Ga0097621_100021499 | Ga0097621_1000214992 | 156 |
| 266 | 3300006358 | Ga0068871_100000712 | Ga0068871_10000071210 | 156 |
| 267 | 3300006358 | Ga0068871_100000931 | Ga0068871_10000093122 | 156 |
| 268 | 3300006931 | Ga0097620_100023059 | Ga0097620_1000230597 | 156 |
| 269 | 3300007788 | Ga0099795_10051319 | Ga0099795_100513192 | 156 |
| 270 | 3300009093 | Ga0105240_10209712 | Ga0105240_102097122 | 156 |
| 271 | 3300009147 | Ga0114129_10064252 | Ga0114129_100642522 | 156 |
| 272 | 3300009174 | Ga0105241_10057374 | Ga0105241_100573742 | 156 |
| 273 | 3300009174 | Ga0105241_10330057 | Ga0105241_103300571 | 156 |
| 274 | 3300009174 | Ga0105241_10751425 | Ga0105241_107514252 | 156 |
| 275 | 3300009176 | Ga0105242_10084569 | Ga0105242_100845693 | 156 |
| 276 | 3300009177 | Ga0105248_10078001 | Ga0105248_100780016 | 156 |
| 277 | 3300009177 | Ga0105248_10090708 | Ga0105248_100907083 | 156 |
| 278 | 3300009177 | Ga0105248_10315374 | Ga0105248_103153741 | 156 |
| 279 | 3300009545 | Ga0105237_10032816 | Ga0105237_100328163 | 156 |
| 280 | 3300009545 | Ga0105237_10113017 | Ga0105237_101130174 | 156 |
| 281 | 3300009551 | Ga0105238_10016350 | Ga0105238_100163503 | 156 |
| 282 | 3300010159 | Ga0099796_10018343 | Ga0099796_100183433 | 156 |
| 283 | 3300010375 | Ga0105239_10116582 | Ga0105239_101165822 | 156 |
| 284 | 3300010375 | Ga0105239_11735372 | Ga0105239_117353721 | 156 |
| 285 | 3300013100 | Ga0157373_10070944 | Ga0157373_100709444 | 156 |
| 286 | 3300013100 | Ga0157373_10092736 | Ga0157373_100927361 | 156 |
| 287 | 3300013100 | Ga0157373_10120707 | Ga0157373_101207073 | 156 |
| 288 | 3300013105 | Ga0157369_10039889 | Ga0157369_100398895 | 156 |
| 289 | 3300013105 | Ga0157369_10078981 | Ga0157369_100789811 | 156 |
| 290 | 3300013105 | Ga0157369_10561215 | Ga0157369_105612152 | 156 |
| 291 | 3300013296 | Ga0157374_10002230 | Ga0157374_100022307 | 156 |
| 292 | 3300013296 | Ga0157374_10025967 | Ga0157374_100259676 | 156 |
| 293 | 3300013296 | Ga0157374_10223212 | Ga0157374_102232122 | 156 |
| 294 | 3300013297 | Ga0157378_10000229 | Ga0157378_1000022914 | 156 |
| 295 | 3300013297 | Ga0157378_10041243 | Ga0157378_100412435 | 156 |
| 296 | 3300013306 | Ga0163162_10055181 | Ga0163162_100551813 | 156 |
| 297 | 3300013307 | Ga0157372_10003049 | Ga0157372_1000304917 | 156 |
| 298 | 3300013307 | Ga0157372_10034628 | Ga0157372_100346282 | 156 |
| 299 | 3300014497 | Ga0182008_10041902 | Ga0182008_100419023 | 156 |
| 300 | 3300014745 | Ga0157377_10196744 | Ga0157377_101967441 | 156 |
| 301 | 3300014968 | Ga0157379_10142729 | Ga0157379_101427291 | 156 |
| 302 | 3300014969 | Ga0157376_10778524 | Ga0157376_107785242 | 156 |
| 303 | 3300015261 | Ga0182006_1022385 | Ga0182006_10223854 | 156 |
| 304 | 3300015262 | Ga0182007_10037286 | Ga0182007_100372862 | 156 |
| 305 | 3300021377 | Ga0213874_10095823 | Ga0213874_100958232 | 156 |
| 306 | 3300022732 | Ga0224569_100278 | Ga0224569_1002781 | 156 |
| 307 | 3300022734 | Ga0224571_100383 | Ga0224571_1003833 | 156 |
| 308 | 3300024227 | Ga0228598_1003343 | Ga0228598_10033432 | 156 |
| 309 | 3300025898 | Ga0207692_10532569 | Ga0207692_105325692 | 156 |
| 310 | 3300025899 | Ga0207642_10097782 | Ga0207642_100977822 | 156 |
| 311 | 3300025904 | Ga0207647_10050774 | Ga0207647_100507742 | 156 |
| 312 | 3300025908 | Ga0207643_10045293 | Ga0207643_100452932 | 156 |
| 313 | 3300025910 | Ga0207684_10227598 | Ga0207684_102275982 | 156 |
| 314 | 3300025910 | Ga0207684_10528918 | Ga0207684_105289182 | 156 |
| 315 | 3300025911 | Ga0207654_10084661 | Ga0207654_100846612 | 156 |
| 316 | 3300025912 | Ga0207707_10000681 | Ga0207707_100006816 | 156 |
| 317 | 3300025912 | Ga0207707_10027950 | Ga0207707_100279502 | 156 |
| 318 | 3300025914 | Ga0207671_10031184 | Ga0207671_100311842 | 156 |
| 319 | 3300025914 | Ga0207671_10040340 | Ga0207671_100403401 | 156 |
| 320 | 3300025915 | Ga0207693_10163232 | Ga0207693_101632322 | 156 |
| 321 | 3300025920 | Ga0207649_10126719 | Ga0207649_101267192 | 156 |
| 322 | 3300025921 | Ga0207652_10020957 | Ga0207652_100209574 | 156 |
| 323 | 3300025922 | Ga0207646_10075610 | Ga0207646_100756102 | 156 |
| 324 | 3300025924 | Ga0207694_10001905 | Ga0207694_1000190513 | 156 |
| 325 | 3300025924 | Ga0207694_10146764 | Ga0207694_101467642 | 156 |
| 326 | 3300025924 | Ga0207694_11529033 | Ga0207694_115290331 | 156 |
| 327 | 3300025925 | Ga0207650_10006405 | Ga0207650_100064055 | 156 |
| 328 | 3300025926 | Ga0207659_10477189 | Ga0207659_104771892 | 156 |
| 329 | 3300025927 | Ga0207687_11001026 | Ga0207687_110010261 | 156 |
| 330 | 3300025928 | Ga0207700_10091323 | Ga0207700_100913233 | 156 |
| 331 | 3300025928 | Ga0207700_10213407 | Ga0207700_102134072 | 156 |
| 332 | 3300025928 | Ga0207700_10530147 | Ga0207700_105301472 | 156 |
| 333 | 3300025929 | Ga0207664_10695321 | Ga0207664_106953212 | 156 |
| 334 | 3300025932 | Ga0207690_11059622 | Ga0207690_110596222 | 156 |
| 335 | 3300025933 | Ga0207706_10387448 | Ga0207706_103874482 | 156 |
| 336 | 3300025936 | Ga0207670_10259725 | Ga0207670_102597252 | 156 |
| 337 | 3300025942 | Ga0207689_10036713 | Ga0207689_100367132 | 156 |
| 338 | 3300025944 | Ga0207661_10108858 | Ga0207661_101088582 | 156 |
| 339 | 3300025945 | Ga0207679_10000789 | Ga0207679_100007896 | 156 |
| 340 | 3300025945 | Ga0207679_10422746 | Ga0207679_104227462 | 156 |
| 341 | 3300025949 | Ga0207667_10000764 | Ga0207667_1000076417 | 156 |
| 342 | 3300025949 | Ga0207667_10017825 | Ga0207667_100178252 | 156 |
| 343 | 3300025949 | Ga0207667_10042765 | Ga0207667_100427652 | 156 |
| 344 | 3300025949 | Ga0207667_10153289 | Ga0207667_101532893 | 156 |
| 345 | 3300025949 | Ga0207667_10392934 | Ga0207667_103929342 | 156 |
| 346 | 3300025960 | Ga0207651_10241259 | Ga0207651_102412592 | 156 |
| 347 | 3300025981 | Ga0207640_10003853 | Ga0207640_100038536 | 156 |
| 348 | 3300025981 | Ga0207640_10029683 | Ga0207640_100296833 | 156 |
| 349 | 3300025981 | Ga0207640_10044967 | Ga0207640_100449673 | 156 |
| 350 | 3300026023 | Ga0207677_10003799 | Ga0207677_100037995 | 156 |
| 351 | 3300026035 | Ga0207703_10013014 | Ga0207703_100130142 | 156 |
| 352 | 3300026078 | Ga0207702_10001773 | Ga0207702_100017738 | 156 |
| 353 | 3300026078 | Ga0207702_10002987 | Ga0207702_1000298714 | 156 |
| 354 | 3300026078 | Ga0207702_10106864 | Ga0207702_101068642 | 156 |
| 355 | 3300026088 | Ga0207641_10033924 | Ga0207641_100339243 | 156 |
| 356 | 3300026089 | Ga0207648_10009875 | Ga0207648_100098756 | 156 |
| 357 | 3300026095 | Ga0207676_10002632 | Ga0207676_100026329 | 156 |
| 358 | 3300026095 | Ga0207676_10080678 | Ga0207676_100806783 | 156 |
| 359 | 3300026095 | Ga0207676_10232203 | Ga0207676_102322032 | 156 |
| 360 | 3300026116 | Ga0207674_10003318 | Ga0207674_1000331813 | 156 |
| 361 | 3300026116 | Ga0207674_10034148 | Ga0207674_100341487 | 156 |
| 362 | 3300026142 | Ga0207698_10028935 | Ga0207698_100289352 | 156 |
| 363 | 3300027512 | Ga0209179_1014552 | Ga0209179_10145522 | 156 |
| 364 | 3300028379 | Ga0268266_10152686 | Ga0268266_101526863 | 156 |
| 365 | 3300028381 | Ga0268264_10053800 | Ga0268264_100538005 | 156 |
| 366 | 3300035113 | Ga0373936_0044227 | Ga0373936_0044227_1149_1619 | 156 |
| 367 | 3300035116 | Ga0373945_0116710 | Ga0373945_0116710_388_858 | 156 |
| 368 | 3300035171 | Ga0373946_0032360 | Ga0373946_0032360_1508_1978 | 156 |
| 369 | 3300035172 | Ga0373955_0300578 | Ga0373955_0300578_330_800 | 156 |
| 370 | 3300035410 | Ga0373924_0065086 | Ga0373924_0065086_382_852 | 156 |
| 371 | 3300035410 | Ga0373924_0099108 | Ga0373924_0099108_60_530 | 156 |
| 372 | 3300035691 | Ga0373931_0170103 | Ga0373931_0170103_711_1184 | 156 |
| 373 | 3300035692 | Ga0373935_0066593 | Ga0373935_0066593_58_528 | 156 |
| 374 | 3300035692 | Ga0373935_0316565 | Ga0373935_0316565_585_1055 | 156 |
| 375 | 3300035695 | Ga0373927_0130136 | Ga0373927_0130136_1141_1620 | 156 |
| 376 | 3300035695 | Ga0373927_0229280 | Ga0373927_0229280_313_783 | 156 |
| 377 | 3300035695 | Ga0373927_0240943 | Ga0373927_0240943_691_1161 | 156 |
| 378 | 3300035724 | Ga0373933_0334109 | Ga0373933_0334109_433_903 | 156 |
| 379 | 3300035725 | Ga0373947_0048813 | Ga0373947_0048813_19_489 | 156 |
| 380 | 3300036401 | Ga0373937_0245265 | Ga0373937_0245265_849_1319 | 156 |
| 381 | 3300036401 | Ga0373937_0286151 | Ga0373937_0286151_949_1491 | 156 |
| 382 | 3300036401 | Ga0373937_0365621 | Ga0373937_0365621_244_744 | 156 |
| 383 | 3300037068 | Ga0373925_0033519 | Ga0373925_0033519_1229_1699 | 156 |
| 384 | 3300039450 | Ga0436363_0828059 | Ga0436363_0828059_197_667 | 156 |
| 385 | 3300046459 | Ga0495629_0167697 | Ga0495629_0167697_50_547 | 156 |
| 386 | 3300046472 | Ga0495580_0001212 | Ga0495580_0001212_8335_8805 | 156 |
| 387 | 3300046472 | Ga0495580_0001301 | Ga0495580_0001301_11959_12438 | 156 |
| 388 | 3300046472 | Ga0495580_0012898 | Ga0495580_0012898_4645_5124 | 156 |
| 389 | 3300046472 | Ga0495580_0041131 | Ga0495580_0041131_865_1344 | 156 |
| 390 | 3300046517 | Ga0495630_0020435 | Ga0495630_0020435_3335_3805 | 156 |
| 391 | 3300046531 | Ga0495665_0068026 | Ga0495665_0068026_353_823 | 156 |
| 392 | 3300046535 | Ga0495586_0245415 | Ga0495586_0245415_104_574 | 156 |
| 393 | 3300046615 | Ga0495656_0243790 | Ga0495656_0243790_209_691 | 156 |
| 394 | 3300046663 | Ga0495635_0599763 | Ga0495635_0599763_171_641 | 156 |
| 395 | 3300046680 | Ga0495646_0336197 | Ga0495646_0336197_199_669 | 156 |
| 396 | 3300046684 | Ga0495669_0016621 | Ga0495669_0016621_901_1404 | 156 |
| 397 | 3300046684 | Ga0495669_0344429 | Ga0495669_0344429_199_681 | 156 |
| 398 | 3300047319 | Ga0495674_0022663 | Ga0495674_0022663_1400_1870 | 156 |
| 399 | 3300047319 | Ga0495674_0089456 | Ga0495674_0089456_1384_1854 | 156 |
| 400 | 3300048905 | Ga0496102_0169000 | Ga0496102_0169000_1364_1837 | 156 |
| 401 | 3300048906 | Ga0496103_0318378 | Ga0496103_0318378_400_873 | 156 |
| 402 | 3300048907 | Ga0496104_0262620 | Ga0496104_0262620_408_881 | 156 |
| 403 | 3300048908 | Ga0496105_0138035 | Ga0496105_0138035_463_936 | 156 |
| 404 | 3300048909 | Ga0496106_0030578 | Ga0496106_0030578_1293_1766 | 156 |
| 405 | 3300048912 | Ga0496109_0098752 | Ga0496109_0098752_1786_2259 | 156 |
| 406 | 3300048913 | Ga0496110_0161949 | Ga0496110_0161949_1234_1707 | 156 |
| 407 | 3300048914 | Ga0496111_0241170 | Ga0496111_0241170_370_843 | 156 |
| 408 | 3300048915 | Ga0496112_0011207 | Ga0496112_0011207_3052_3525 | 156 |
| 409 | 3300048915 | Ga0496112_0384837 | Ga0496112_0384837_600_1073 | 156 |
| 410 | 3300049585 | Ga0501069_0867318 | Ga0501069_0867318_53_523 | 156 |
| 411 | 3300049589 | Ga0501073_0010534 | Ga0501073_0010534_4514_4993 | 156 |
| 412 | 3300049744 | Ga0501083_0239538 | Ga0501083_0239538_435_941 | 156 |
| 413 | 3300050507 | nmdc:mga05p37_893174_c1 | nmdc:mga05p37_893174_c1_303_791 | 156 |
| 414 | 3300050514 | nmdc:mga08x19_1056781_c1 | nmdc:mga08x19_1056781_c1_90_560 | 156 |
| 415 | 3300050514 | nmdc:mga08x19_417247_c1 | nmdc:mga08x19_417247_c1_263_769 | 156 |
| 416 | 3300053077 | Ga0495601_0012392 | Ga0495601_0012392_1426_1896 | 156 |
| 417 | 3300054114 | Ga0501084_0159354 | Ga0501084_0159354_13_492 | 156 |
| 418 | 3300060353 | Ga0501082_0129022 | Ga0501082_0129022_423_902 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ohd-assembly1.cif.gz_D | crystal structure of hypothetical molybdenum cofactor biosynthesis protein c from sulfolobus tokodaii | 0.9748 | 16 | 141 |
| 1ekr-assembly1.cif.gz_A | moac protein from e. coli | 0.9676 | 12 | 145 |
| 4pyd-assembly1.cif.gz_D | moac in complex with cpmp crystallized in space group p212121 | 0.9604 | 6 | 148 |
| 3jqj-assembly1.cif.gz_B | crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 | 0.9589 | 12 | 156 |
| 3jqk-assembly1.cif.gz_A | crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) | 0.9581 | 13 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ekrA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9676 | 12 | 145 | 3.30.70.640 |
| af_B4FJH5_64_220_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9622 | 4 | 155 | 3.30.70.640 |
| 2ohdB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9573 | 16 | 141 | 3.30.70.640 |
| af_Q20624_440_595_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9537 | 5 | 155 | 3.30.70.640 |
| af_P9WJR7_13_167_3.30.70.640 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain | 0.9536 | 4 | 155 | 3.30.70.640 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382EVM7-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.989 | 16 | 155 |
GO:0006777
GO:0016829 |
| AF-A0A2V9JT16-F1-model_v4 | Cyclic pyranopterin monophosphate synthase MoaC | 0.9887 | 37 | 155 |
GO:0006777
GO:0061799 |
| AF-A0A7V9C274-F1-model_v4 | Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) | 0.9882 | 16 | 145 |
GO:0006777
GO:0061799 |
| AF-A0A1H9H7X9-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.9869 | 16 | 155 |
GO:0006777
GO:0061799 |
| AF-A0A3B1BGT7-F1-model_v4 | cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) | 0.9864 | 16 | 156 |
GO:0006777
GO:0061798 GO:0061799 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar