F439224

General Info

Members Datasets Scaffolds Average Seq Length
418 207 418 153

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10052512|Ga0070666_100525123
Length 174
Sequence MLLDPASRDVRLHFRDMPKLSHYDRAGRATMVDVSTKSVSKREAEASAFIELTPEVLRALPANPKGDPLEVARLAGIMAAKKTSDLIPMCHPLPLSHVDVSIRLCENGVAISSRVTTTAVTGVEMEALVAVSVAALTVYDMCKALDKGIRIREIKLERKSGGKSGDYVRRRKKI

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
95 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.31
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000348 3300000546 Bacteria 8112
2 Ga0065712_10215342 3300005290 Bacteria 1059
3 Ga0065715_10258067 3300005293 Bacteria 1138
4 Ga0070658_10822693 3300005327 Unclassified 807
5 Ga0070683_100059686 3300005329 Bacteria 3544
6 Ga0070683_100087964 3300005329 Bacteria 2914
7 Ga0070683_100127344 3300005329 Unclassified 2408
8 Ga0070670_100008469 3300005331 Bacteria 8772
9 Ga0070670_100157013 3300005331 Unclassified 1971
10 Ga0068869_100012737 3300005334 Bacteria 5562
11 Ga0070666_10052512 3300005335 Unclassified 2747
12 Ga0070680_100117874 3300005336 Bacteria 2214
13 Ga0070682_100176724 3300005337 Bacteria 1488
14 Ga0068868_100000465 3300005338 Bacteria 26992
15 Ga0068868_100021153 3300005338 Unclassified 4899
16 Ga0068868_100043091 3300005338 Bacteria 3525
17 Ga0068868_100871388 3300005338 Bacteria 817
18 Ga0068868_100968611 3300005338 Unclassified 777
19 Ga0070660_100094089 3300005339 Bacteria 2367
20 Ga0070689_100159591 3300005340 Bacteria 1822
21 Ga0070691_10142028 3300005341 Bacteria 1224
22 Ga0070687_100236072 3300005343 Bacteria 1128
23 Ga0070661_100101340 3300005344 Bacteria 2142
24 Ga0070661_100555002 3300005344 Bacteria 924
25 Ga0070675_100619410 3300005354 Bacteria 982
26 Ga0070671_100188748 3300005355 Bacteria 1747
27 Ga0070674_100263349 3300005356 Bacteria 1359
28 Ga0070673_100070923 3300005364 Bacteria 2798
29 Ga0070673_100261146 3300005364 Bacteria 1513
30 Ga0070659_100033114 3300005366 Bacteria 4012
31 Ga0070659_100413315 3300005366 Bacteria 1140
32 Ga0070667_100183324 3300005367 Unclassified 1852
33 Ga0070709_10007937 3300005434 Bacteria 5830
34 Ga0070709_10091456 3300005434 Bacteria 2008
35 Ga0070709_10243369 3300005434 Bacteria 1293
36 Ga0070709_10635496 3300005434 Bacteria 825
37 Ga0070714_100006205 3300005435 Bacteria 9194
38 Ga0070714_100020493 3300005435 Bacteria 5399
39 Ga0070714_100025754 3300005435 Bacteria 4857
40 Ga0070714_100115241 3300005435 Bacteria 2385
41 Ga0070714_100364892 3300005435 Bacteria 1358
42 Ga0070714_100779911 3300005435 Bacteria 925
43 Ga0070714_101155990 3300005435 Bacteria 755
44 Ga0070714_101963190 3300005435 Bacteria 571
45 Ga0070713_100003749 3300005436 Bacteria 10058
46 Ga0070713_100014838 3300005436 Bacteria 5800
47 Ga0070713_100120188 3300005436 Bacteria 2303
48 Ga0070713_100898977 3300005436 Bacteria 852
49 Ga0070710_10012248 3300005437 Bacteria 4254
50 Ga0070710_10077609 3300005437 Unclassified 1931
51 Ga0070711_100000476 3300005439 Bacteria 20852
52 Ga0070711_100629258 3300005439 Bacteria 898
53 Ga0070708_100010243 3300005445 Bacteria 7590
54 Ga0070708_100153292 3300005445 Bacteria 2144
55 Ga0070708_101209148 3300005445 Bacteria 707
56 Ga0070662_100463396 3300005457 Bacteria 1053
57 Ga0070681_10001481 3300005458 Bacteria 20738
58 Ga0070681_10016075 3300005458 Bacteria 7459
59 Ga0070681_10044122 3300005458 Bacteria 4463
60 Ga0070681_10596760 3300005458 Bacteria 1018
61 Ga0068867_100008997 3300005459 Bacteria 7046
62 Ga0070685_10332705 3300005466 Unclassified 1033
63 Ga0070706_100155333 3300005467 Bacteria 2136
64 Ga0070707_100224641 3300005468 Bacteria 1828
65 Ga0070707_100424782 3300005468 Bacteria 1289
66 Ga0070707_100942009 3300005468 Unclassified 828
67 Ga0070698_100090191 3300005471 Bacteria 3049
68 Ga0070699_100005316 3300005518 Bacteria 11297
69 Ga0070679_100002345 3300005530 Bacteria 17137
70 Ga0070679_100033636 3300005530 Bacteria 5076
71 Ga0070679_100039861 3300005530 Bacteria 4670
72 Ga0070679_100063618 3300005530 Bacteria 3677
73 Ga0070679_100242194 3300005530 Unclassified 1761
74 Ga0070679_100275045 3300005530 Bacteria 1637
75 Ga0070684_100083958 3300005535 Unclassified 2823
76 Ga0070684_100138728 3300005535 Bacteria 2198
77 Ga0070697_100001591 3300005536 Bacteria 17329
78 Ga0070697_100006458 3300005536 Bacteria 9078
79 Ga0070697_100011237 3300005536 Bacteria 6998
80 Ga0070697_100023052 3300005536 Bacteria 4950
81 Ga0070697_100032036 3300005536 Bacteria 4228
82 Ga0068853_100911873 3300005539 Unclassified 844
83 Ga0070686_100730248 3300005544 Bacteria 792
84 Ga0070695_100225086 3300005545 Bacteria 1353
85 Ga0070693_100030183 3300005547 Bacteria 2962
86 Ga0070693_100050772 3300005547 Bacteria 2372
87 Ga0068855_100000477 3300005563 Bacteria 49253
88 Ga0068855_100000664 3300005563 Bacteria 41988
89 Ga0068855_100019350 3300005563 Bacteria 8181
90 Ga0068855_100049672 3300005563 Bacteria 4946
91 Ga0068855_101854371 3300005563 Bacteria 612
92 Ga0070664_100000304 3300005564 Bacteria 35664
93 Ga0070664_100211723 3300005564 Bacteria 1732
94 Ga0070664_100278840 3300005564 Bacteria 1507
95 Ga0068857_100008491 3300005577 Bacteria 8879
96 Ga0068857_100021111 3300005577 Bacteria 5730
97 Ga0068857_100072671 3300005577 Unclassified 3065
98 Ga0068854_100023308 3300005578 Unclassified 4227
99 Ga0068854_100028477 3300005578 Bacteria 3861
100 Ga0068854_100029396 3300005578 Bacteria 3804
101 Ga0068856_100000334 3300005614 Bacteria 51590
102 Ga0068856_100000667 3300005614 Bacteria 37242
103 Ga0068856_100001991 3300005614 Bacteria 21304
104 Ga0068856_100250121 3300005614 Bacteria 1788
105 Ga0068856_100561729 3300005614 Bacteria 1162
106 Ga0068852_100027791 3300005616 Bacteria 4617
107 Ga0068852_100088147 3300005616 Bacteria 2771
108 Ga0068852_100203012 3300005616 Unclassified 1876
109 Ga0068852_100693047 3300005616 Bacteria 1028
110 Ga0068859_100023059 3300005617 Bacteria 6242
111 Ga0068864_100012672 3300005618 Bacteria 6970
112 Ga0068864_100264071 3300005618 Bacteria 1602
113 Ga0068866_10001555 3300005718 Bacteria 9752
114 Ga0068866_10199642 3300005718 Unclassified 1194
115 Ga0068861_100269581 3300005719 Bacteria 1461
116 Ga0068870_10015894 3300005840 Bacteria 3583
117 Ga0068863_100044379 3300005841 Bacteria 4220
118 Ga0068863_100287811 3300005841 Bacteria 1593
119 Ga0068863_101277826 3300005841 Bacteria 741
120 Ga0068858_100003363 3300005842 Bacteria 15926
121 Ga0068858_100025554 3300005842 Bacteria 5495
122 Ga0068858_100063571 3300005842 Unclassified 3415
123 Ga0068860_100008186 3300005843 Bacteria 10409
124 Ga0068860_100057629 3300005843 Unclassified 3693
125 Ga0068860_100146847 3300005843 Bacteria 2269
126 Ga0070717_10000800 3300006028 Bacteria 20687
127 Ga0070717_10008127 3300006028 Bacteria 7829
128 Ga0070717_10291519 3300006028 Bacteria 1449
129 Ga0070717_11140892 3300006028 Bacteria 710
130 Ga0070715_10011807 3300006163 Unclassified 3156
131 Ga0070716_100270910 3300006173 Unclassified 1167
132 Ga0070716_100527649 3300006173 Bacteria 876
133 Ga0070712_100003881 3300006175 Bacteria 9207
134 Ga0070712_100319653 3300006175 Bacteria 1262
135 Ga0097621_100000153 3300006237 Bacteria 42702
136 Ga0097621_100000415 3300006237 Bacteria 29789
137 Ga0097621_100000992 3300006237 Bacteria 19954
138 Ga0097621_100021499 3300006237 Bacteria 4993
139 Ga0068871_100000565 3300006358 Bacteria 25303
140 Ga0068871_100000712 3300006358 Bacteria 22517
141 Ga0068871_100000931 3300006358 Bacteria 19542
142 Ga0075428_100762843 3300006844 Bacteria 1029
143 Ga0075434_100002949 3300006871 Bacteria 15125
144 Ga0068865_100009486 3300006881 Bacteria 6037
145 Ga0068865_100291754 3300006881 Unclassified 1302
146 Ga0075436_100160249 3300006914 Bacteria 1586
147 Ga0075436_100587951 3300006914 Bacteria 819
148 Ga0097620_100023059 3300006931 Bacteria 6242
149 Ga0099795_10051319 3300007788 Unclassified 1503
150 Ga0105240_10075270 3300009093 Unclassified 4164
151 Ga0105240_10100353 3300009093 Bacteria 3522
152 Ga0105240_10209712 3300009093 Bacteria 2277
153 Ga0105240_10216677 3300009093 Bacteria 2233
154 Ga0105240_12566410 3300009093 Bacteria 527
155 Ga0105245_10000384 3300009098 Bacteria 41154
156 Ga0105245_10917890 3300009098 Bacteria 918
157 Ga0114129_10064252 3300009147 Bacteria 5122
158 Ga0105241_10057374 3300009174 Bacteria 2987
159 Ga0105241_10086147 3300009174 Unclassified 2470
160 Ga0105241_10087087 3300009174 Unclassified 2457
161 Ga0105241_10330057 3300009174 Unclassified 1318
162 Ga0105241_10751425 3300009174 Bacteria 894
163 Ga0105242_10084569 3300009176 Bacteria 2659
164 Ga0105248_10008650 3300009177 Bacteria 11183
165 Ga0105248_10078001 3300009177 Unclassified 3725
166 Ga0105248_10090708 3300009177 Bacteria 3441
167 Ga0105248_10259934 3300009177 Unclassified 1954
168 Ga0105248_10315374 3300009177 Bacteria 1761
169 Ga0105237_10032816 3300009545 Bacteria 5257
170 Ga0105237_10113017 3300009545 Bacteria 2708
171 Ga0105237_10276364 3300009545 Bacteria 1682
172 Ga0105237_11475351 3300009545 Bacteria 687
173 Ga0105238_10000219 3300009551 Bacteria 63043
174 Ga0105238_10016350 3300009551 Bacteria 7510
175 Ga0105238_10381801 3300009551 Bacteria 1400
176 Ga0099796_10018343 3300010159 Bacteria 2100
177 Ga0105239_10037386 3300010375 Bacteria 5322
178 Ga0105239_10093575 3300010375 Unclassified 3319
179 Ga0105239_10116582 3300010375 Unclassified 2964
180 Ga0105239_11735372 3300010375 Bacteria 723
181 Ga0157373_10070944 3300013100 Bacteria 2462
182 Ga0157373_10092736 3300013100 Bacteria 2127
183 Ga0157373_10120707 3300013100 Unclassified 1842
184 Ga0157369_10000565 3300013105 Bacteria 48680
185 Ga0157369_10035102 3300013105 Bacteria 5500
186 Ga0157369_10039889 3300013105 Bacteria 5130
187 Ga0157369_10078981 3300013105 Unclassified 3525
188 Ga0157369_10561215 3300013105 Bacteria 1180
189 Ga0157374_10000280 3300013296 Bacteria 47309
190 Ga0157374_10000702 3300013296 Bacteria 29423
191 Ga0157374_10002230 3300013296 Bacteria 16325
192 Ga0157374_10025967 3300013296 Bacteria 5266
193 Ga0157374_10223212 3300013296 Bacteria 1849
194 Ga0157378_10000157 3300013297 Bacteria 64384
195 Ga0157378_10000229 3300013297 Bacteria 54489
196 Ga0157378_10000992 3300013297 Bacteria 26009
197 Ga0157378_10015156 3300013297 Bacteria 6749
198 Ga0157378_10041243 3300013297 Bacteria 4094
199 Ga0163162_10055181 3300013306 Bacteria 3999
200 Ga0163162_10302099 3300013306 Bacteria 1733
201 Ga0157372_10001179 3300013307 Bacteria 28254
202 Ga0157372_10002008 3300013307 Bacteria 22106
203 Ga0157372_10003049 3300013307 Bacteria 18055
204 Ga0157372_10034628 3300013307 Bacteria 5554
205 Ga0157372_10040580 3300013307 Bacteria 5141
206 Ga0157372_10269165 3300013307 Bacteria 1979
207 Ga0163163_10198807 3300014325 Bacteria 2053
208 Ga0182008_10041902 3300014497 Bacteria 2282
209 Ga0157377_10196744 3300014745 Bacteria 1277
210 Ga0157379_10142729 3300014968 Bacteria 2159
211 Ga0157376_10170557 3300014969 Unclassified 1981
212 Ga0157376_10195437 3300014969 Bacteria 1858
213 Ga0157376_10778524 3300014969 Bacteria 968
214 Ga0182006_1022385 3300015261 Unclassified 2628
215 Ga0182007_10037286 3300015262 Bacteria 1633
216 Ga0213874_10095823 3300021377 Bacteria 981
217 Ga0224569_100278 3300022732 Bacteria 4306
218 Ga0224571_100383 3300022734 Bacteria 2390
219 Ga0224572_1010833 3300024225 Bacteria 1719
220 Ga0228598_1001050 3300024227 Bacteria 6073
221 Ga0228598_1003343 3300024227 Bacteria 3455
222 Ga0207682_10180495 3300025893 Bacteria 964
223 Ga0207692_10532569 3300025898 Bacteria 749
224 Ga0207642_10097782 3300025899 Bacteria 1466
225 Ga0207680_10080054 3300025903 Unclassified 2051
226 Ga0207647_10050774 3300025904 Bacteria 2566
227 Ga0207699_10067113 3300025906 Bacteria 2180
228 Ga0207699_10474653 3300025906 Bacteria 900
229 Ga0207643_10045293 3300025908 Bacteria 2484
230 Ga0207705_11096505 3300025909 Unclassified 613
231 Ga0207684_10034641 3300025910 Bacteria 4290
232 Ga0207684_10227598 3300025910 Bacteria 1609
233 Ga0207684_10528918 3300025910 Bacteria 1009
234 Ga0207654_10084661 3300025911 Unclassified 1917
235 Ga0207654_10339907 3300025911 Bacteria 1031
236 Ga0207654_10427210 3300025911 Unclassified 925
237 Ga0207707_10000681 3300025912 Bacteria 33712
238 Ga0207707_10027950 3300025912 Bacteria 4932
239 Ga0207695_10007887 3300025913 Bacteria 13438
240 Ga0207695_10153236 3300025913 Bacteria 2242
241 Ga0207695_10395467 3300025913 Bacteria 1267
242 Ga0207671_10031184 3300025914 Bacteria 3972
243 Ga0207671_10040340 3300025914 Unclassified 3456
244 Ga0207693_10163232 3300025915 Bacteria 1753
245 Ga0207663_10393927 3300025916 Bacteria 1058
246 Ga0207660_10049324 3300025917 Bacteria 2983
247 Ga0207657_10033756 3300025919 Bacteria 4609
248 Ga0207649_10126719 3300025920 Bacteria 1729
249 Ga0207652_10020957 3300025921 Bacteria 5391
250 Ga0207652_10021846 3300025921 Bacteria 5286
251 Ga0207652_10027833 3300025921 Unclassified 4714
252 Ga0207652_10235299 3300025921 Bacteria 1651
253 Ga0207646_10075610 3300025922 Unclassified 3009
254 Ga0207694_10001905 3300025924 Bacteria 17287
255 Ga0207694_10146764 3300025924 Bacteria 1899
256 Ga0207694_11529033 3300025924 Bacteria 563
257 Ga0207650_10006405 3300025925 Bacteria 8018
258 Ga0207659_10477189 3300025926 Bacteria 1053
259 Ga0207687_10004670 3300025927 Bacteria 9113
260 Ga0207687_11001026 3300025927 Bacteria 717
261 Ga0207700_10020596 3300025928 Bacteria 4483
262 Ga0207700_10091323 3300025928 Bacteria 2405
263 Ga0207700_10213407 3300025928 Bacteria 1633
264 Ga0207700_10258161 3300025928 Bacteria 1491
265 Ga0207700_10530147 3300025928 Bacteria 1044
266 Ga0207664_10010781 3300025929 Bacteria 6466
267 Ga0207664_10217660 3300025929 Bacteria 1655
268 Ga0207664_10241552 3300025929 Bacteria 1573
269 Ga0207664_10695321 3300025929 Bacteria 914
270 Ga0207644_10478172 3300025931 Bacteria 1026
271 Ga0207690_11059622 3300025932 Bacteria 675
272 Ga0207706_10007827 3300025933 Bacteria 9863
273 Ga0207706_10387448 3300025933 Bacteria 1212
274 Ga0207706_10766034 3300025933 Bacteria 822
275 Ga0207686_10066763 3300025934 Bacteria 2299
276 Ga0207670_10259725 3300025936 Bacteria 1346
277 Ga0207669_10234957 3300025937 Bacteria 1355
278 Ga0207704_10004850 3300025938 Bacteria 6175
279 Ga0207704_10439504 3300025938 Unclassified 1039
280 Ga0207665_10697833 3300025939 Bacteria 798
281 Ga0207711_10016537 3300025941 Bacteria 6127
282 Ga0207711_10170605 3300025941 Unclassified 1974
283 Ga0207711_10812916 3300025941 Bacteria 870
284 Ga0207711_10955352 3300025941 Bacteria 796
285 Ga0207689_10036713 3300025942 Bacteria 4068
286 Ga0207661_10108858 3300025944 Bacteria 2340
287 Ga0207661_10236256 3300025944 Bacteria 1620
288 Ga0207679_10000789 3300025945 Bacteria 20715
289 Ga0207679_10035126 3300025945 Bacteria 3543
290 Ga0207679_10422746 3300025945 Bacteria 1176
291 Ga0207667_10000764 3300025949 Bacteria 41822
292 Ga0207667_10017825 3300025949 Bacteria 7983
293 Ga0207667_10042765 3300025949 Bacteria 4813
294 Ga0207667_10153289 3300025949 Unclassified 2371
295 Ga0207667_10392934 3300025949 Bacteria 1412
296 Ga0207667_11566948 3300025949 Bacteria 628
297 Ga0207651_10241259 3300025960 Bacteria 1473
298 Ga0207651_10289963 3300025960 Bacteria 1356
299 Ga0207640_10003853 3300025981 Bacteria 8094
300 Ga0207640_10029683 3300025981 Bacteria 3359
301 Ga0207640_10044967 3300025981 Unclassified 2833
302 Ga0207640_10187006 3300025981 Bacteria 1558
303 Ga0207658_10151438 3300025986 Unclassified 1890
304 Ga0207677_10003799 3300026023 Bacteria 8020
305 Ga0207677_10005450 3300026023 Bacteria 6908
306 Ga0207677_10043002 3300026023 Unclassified 3001
307 Ga0207677_10342032 3300026023 Bacteria 1250
308 Ga0207703_10013014 3300026035 Bacteria 6483
309 Ga0207703_10018742 3300026035 Bacteria 5406
310 Ga0207703_11105667 3300026035 Unclassified 761
311 Ga0207639_10092987 3300026041 Bacteria 2417
312 Ga0207702_10001773 3300026078 Bacteria 21236
313 Ga0207702_10002987 3300026078 Bacteria 15742
314 Ga0207702_10087803 3300026078 Bacteria 2716
315 Ga0207702_10106864 3300026078 Bacteria 2481
316 Ga0207702_10168453 3300026078 Bacteria 2006
317 Ga0207641_10033924 3300026088 Bacteria 4243
318 Ga0207641_10187291 3300026088 Bacteria 1900
319 Ga0207648_10009875 3300026089 Bacteria 9097
320 Ga0207648_10140263 3300026089 Unclassified 2130
321 Ga0207676_10002632 3300026095 Bacteria 12794
322 Ga0207676_10023956 3300026095 Bacteria 4512
323 Ga0207676_10080678 3300026095 Bacteria 2641
324 Ga0207676_10232203 3300026095 Unclassified 1650
325 Ga0207674_10003318 3300026116 Bacteria 19788
326 Ga0207674_10034148 3300026116 Bacteria 5320
327 Ga0207674_10043435 3300026116 Bacteria 4634
328 Ga0207675_100442123 3300026118 Bacteria 1287
329 Ga0207683_10292247 3300026121 Bacteria 1490
330 Ga0207698_10028935 3300026142 Unclassified 3960
331 Ga0207698_11006438 3300026142 Bacteria 844
332 Ga0209179_1014552 3300027512 Unclassified 1446
333 Ga0265357_1003812 3300028023 Bacteria 1327
334 Ga0268266_10152686 3300028379 Bacteria 2083
335 Ga0268266_10833276 3300028379 Unclassified 891
336 Ga0268264_10053800 3300028381 Bacteria 3359
337 Ga0265770_1004103 3300030878 Bacteria 1984
338 Ga0265760_10001600 3300031090 Bacteria 6659
339 Ga0265760_10016092 3300031090 Bacteria 2145
340 Ga0373930_0140965 3300034816 Unclassified 599
341 Ga0373936_0044227 3300035113 Bacteria 1791
342 Ga0373945_0116710 3300035116 Unclassified 1058
343 Ga0373946_0032360 3300035171 Bacteria 2100
344 Ga0373955_0300578 3300035172 Bacteria 968
345 Ga0373924_0065086 3300035410 Unclassified 1531
346 Ga0373924_0099108 3300035410 Bacteria 1252
347 Ga0373931_0039397 3300035691 Bacteria 2476
348 Ga0373931_0170103 3300035691 Bacteria 1283
349 Ga0373935_0066593 3300035692 Bacteria 2314
350 Ga0373935_0316565 3300035692 Unclassified 1106
351 Ga0373927_0130136 3300035695 Bacteria 1644
352 Ga0373927_0229280 3300035695 Unclassified 1220
353 Ga0373927_0240943 3300035695 Unclassified 1188
354 Ga0373927_1130079 3300035695 Bacteria 517
355 Ga0373933_0334109 3300035724 Unclassified 983
356 Ga0373947_0048813 3300035725 Bacteria 2540
357 Ga0373937_0245265 3300036401 Unclassified 1688
358 Ga0373937_0286151 3300036401 Bacteria 1557
359 Ga0373937_0365621 3300036401 Bacteria 1368
360 Ga0373925_0033519 3300037068 Unclassified 3784
361 Ga0395900_0293443 3300037418 Bacteria 1614
362 Ga0395898_0153351 3300037466 Bacteria 2204
363 Ga0395898_1169328 3300037466 Bacteria 701
364 Ga0395905_0039526 3300037471 Bacteria 4426
365 Ga0395905_0063097 3300037471 Bacteria 3466
366 Ga0395905_0177653 3300037471 Bacteria 1998
367 Ga0395901_0626701 3300038443 Bacteria 1082
368 Ga0436363_0828059 3300039450 Bacteria 1359
369 Ga0466963_0025699 3300044694 Bacteria 3758
370 Ga0466967_0140561 3300045976 Bacteria 2248
371 Ga0495629_0167697 3300046459 Bacteria 1525
372 Ga0495580_0001212 3300046472 Bacteria 22706
373 Ga0495580_0001301 3300046472 Bacteria 22045
374 Ga0495580_0012898 3300046472 Bacteria 6403
375 Ga0495580_0014014 3300046472 Bacteria 6098
376 Ga0495580_0041131 3300046472 Bacteria 3297
377 Ga0495580_0216481 3300046472 Bacteria 1317
378 Ga0495580_0299275 3300046472 Bacteria 1095
379 Ga0495630_0020435 3300046517 Bacteria 4883
380 Ga0495665_0068026 3300046531 Unclassified 1878
381 Ga0495586_0245415 3300046535 Bacteria 1021
382 Ga0495656_0243790 3300046615 Bacteria 906
383 Ga0495635_0599763 3300046663 Unclassified 719
384 Ga0495646_0336197 3300046680 Unclassified 793
385 Ga0495669_0016621 3300046684 Bacteria 3152
386 Ga0495669_0344429 3300046684 Bacteria 720
387 Ga0495674_0022663 3300047319 Bacteria 5790
388 Ga0495674_0089456 3300047319 Unclassified 2632
389 Ga0495674_0705423 3300047319 Bacteria 792
390 Ga0496100_0580655 3300048903 Unclassified 869
391 Ga0496102_0169000 3300048905 Bacteria 2058
392 Ga0496102_0227879 3300048905 Bacteria 1757
393 Ga0496103_0318378 3300048906 Bacteria 1000
394 Ga0496104_0060068 3300048907 Unclassified 3601
395 Ga0496104_0262620 3300048907 Bacteria 1639
396 Ga0496105_0138035 3300048908 Bacteria 2008
397 Ga0496105_0288890 3300048908 Unclassified 1321
398 Ga0496106_0030578 3300048909 Bacteria 4014
399 Ga0496108_0099713 3300048911 Bacteria 2476
400 Ga0496109_0098752 3300048912 Bacteria 2707
401 Ga0496109_1472999 3300048912 Unclassified 616
402 Ga0496110_0161949 3300048913 Bacteria 2028
403 Ga0496111_0241170 3300048914 Bacteria 1342
404 Ga0496112_0011207 3300048915 Bacteria 8177
405 Ga0496112_0079235 3300048915 Unclassified 3249
406 Ga0496112_0121059 3300048915 Bacteria 2586
407 Ga0496112_0384837 3300048915 Bacteria 1343
408 Ga0501067_0190336 3300049583 Bacteria 1143
409 Ga0501069_0867318 3300049585 Bacteria 549
410 Ga0501073_0010534 3300049589 Bacteria 6771
411 Ga0501083_0239538 3300049744 Bacteria 1181
412 nmdc:mga05p37_893174_c1 3300050507 Bacteria 959
413 nmdc:mga08x19_1056781_c1 3300050514 Bacteria 576
414 nmdc:mga08x19_417247_c1 3300050514 Bacteria 942
415 Ga0495601_0012392 3300053077 Bacteria 5115
416 Ga0500590_246033 3300053148 Bacteria 715
417 Ga0501084_0159354 3300054114 Bacteria 1904
418 Ga0501082_0129022 3300060353 Bacteria 2194

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10215342 Ga0065712_102153422 141
2 3300005329 Ga0070683_100059686 Ga0070683_1000596864 141
3 3300005329 Ga0070683_100087964 Ga0070683_1000879643 141
4 3300005329 Ga0070683_100127344 Ga0070683_1001273442 141
5 3300005331 Ga0070670_100157013 Ga0070670_1001570133 141
6 3300005334 Ga0068869_100012737 Ga0068869_1000127375 141
7 3300005338 Ga0068868_100000465 Ga0068868_1000004655 141
8 3300005338 Ga0068868_100043091 Ga0068868_1000430912 141
9 3300005338 Ga0068868_100871388 Ga0068868_1008713882 141
10 3300005339 Ga0070660_100094089 Ga0070660_1000940892 141
11 3300005344 Ga0070661_100101340 Ga0070661_1001013402 141
12 3300005354 Ga0070675_100619410 Ga0070675_1006194102 141
13 3300005356 Ga0070674_100263349 Ga0070674_1002633492 141
14 3300005364 Ga0070673_100261146 Ga0070673_1002611463 141
15 3300005366 Ga0070659_100033114 Ga0070659_1000331146 141
16 3300005366 Ga0070659_100413315 Ga0070659_1004133152 141
17 3300005434 Ga0070709_10091456 Ga0070709_100914562 141
18 3300005434 Ga0070709_10635496 Ga0070709_106354961 141
19 3300005435 Ga0070714_100006205 Ga0070714_1000062054 141
20 3300005435 Ga0070714_100025754 Ga0070714_1000257543 141
21 3300005435 Ga0070714_100115241 Ga0070714_1001152412 141
22 3300005435 Ga0070714_100779911 Ga0070714_1007799112 141
23 3300005436 Ga0070713_100014838 Ga0070713_1000148386 141
24 3300005436 Ga0070713_100120188 Ga0070713_1001201881 141
25 3300005436 Ga0070713_100898977 Ga0070713_1008989772 141
26 3300005445 Ga0070708_100153292 Ga0070708_1001532922 141
27 3300005445 Ga0070708_101209148 Ga0070708_1012091481 141
28 3300005457 Ga0070662_100463396 Ga0070662_1004633962 141
29 3300005458 Ga0070681_10001481 Ga0070681_100014815 141
30 3300005458 Ga0070681_10016075 Ga0070681_100160756 141
31 3300005458 Ga0070681_10044122 Ga0070681_100441221 141
32 3300005459 Ga0068867_100008997 Ga0068867_1000089972 141
33 3300005468 Ga0070707_100424782 Ga0070707_1004247822 141
34 3300005468 Ga0070707_100942009 Ga0070707_1009420092 141
35 3300005530 Ga0070679_100002345 Ga0070679_10000234511 141
36 3300005530 Ga0070679_100039861 Ga0070679_1000398613 141
37 3300005530 Ga0070679_100063618 Ga0070679_1000636184 141
38 3300005530 Ga0070679_100242194 Ga0070679_1002421943 141
39 3300005535 Ga0070684_100138728 Ga0070684_1001387282 141
40 3300005536 Ga0070697_100023052 Ga0070697_1000230526 141
41 3300005544 Ga0070686_100730248 Ga0070686_1007302482 141
42 3300005547 Ga0070693_100030183 Ga0070693_1000301832 141
43 3300005563 Ga0068855_101854371 Ga0068855_1018543712 141
44 3300005577 Ga0068857_100072671 Ga0068857_1000726714 141
45 3300005578 Ga0068854_100029396 Ga0068854_1000293962 141
46 3300005614 Ga0068856_100250121 Ga0068856_1002501212 141
47 3300005614 Ga0068856_100561729 Ga0068856_1005617291 141
48 3300005616 Ga0068852_100203012 Ga0068852_1002030123 141
49 3300005616 Ga0068852_100693047 Ga0068852_1006930472 141
50 3300005841 Ga0068863_100287811 Ga0068863_1002878113 141
51 3300005842 Ga0068858_100025554 Ga0068858_1000255544 141
52 3300006028 Ga0070717_10291519 Ga0070717_102915192 141
53 3300006173 Ga0070716_100270910 Ga0070716_1002709102 141
54 3300006173 Ga0070716_100527649 Ga0070716_1005276492 141
55 3300006844 Ga0075428_100762843 Ga0075428_1007628432 141
56 3300006881 Ga0068865_100009486 Ga0068865_1000094865 141
57 3300006914 Ga0075436_100160249 Ga0075436_1001602492 141
58 3300006914 Ga0075436_100587951 Ga0075436_1005879511 141
59 3300009093 Ga0105240_10075270 Ga0105240_100752706 141
60 3300009093 Ga0105240_10100353 Ga0105240_101003535 141
61 3300009093 Ga0105240_10216677 Ga0105240_102166772 141
62 3300009093 Ga0105240_12566410 Ga0105240_125664101 141
63 3300009098 Ga0105245_10917890 Ga0105245_109178902 141
64 3300009174 Ga0105241_10086147 Ga0105241_100861472 141
65 3300009177 Ga0105248_10008650 Ga0105248_100086505 141
66 3300009545 Ga0105237_10276364 Ga0105237_102763641 141
67 3300009545 Ga0105237_11475351 Ga0105237_114753511 141
68 3300009551 Ga0105238_10000219 Ga0105238_1000021925 141
69 3300009551 Ga0105238_10381801 Ga0105238_103818012 141
70 3300010375 Ga0105239_10093575 Ga0105239_100935753 141
71 3300013105 Ga0157369_10000565 Ga0157369_1000056526 141
72 3300013105 Ga0157369_10035102 Ga0157369_100351022 141
73 3300013296 Ga0157374_10000280 Ga0157374_1000028024 141
74 3300013296 Ga0157374_10000702 Ga0157374_1000070220 141
75 3300013297 Ga0157378_10000157 Ga0157378_1000015725 141
76 3300013297 Ga0157378_10015156 Ga0157378_100151566 141
77 3300013306 Ga0163162_10302099 Ga0163162_103020992 141
78 3300013307 Ga0157372_10001179 Ga0157372_100011796 141
79 3300013307 Ga0157372_10002008 Ga0157372_1000200812 141
80 3300013307 Ga0157372_10040580 Ga0157372_100405802 141
81 3300013307 Ga0157372_10269165 Ga0157372_102691652 141
82 3300014325 Ga0163163_10198807 Ga0163163_101988073 141
83 3300014969 Ga0157376_10195437 Ga0157376_101954372 141
84 3300024225 Ga0224572_1010833 Ga0224572_10108332 141
85 3300024227 Ga0228598_1001050 Ga0228598_10010502 141
86 3300025893 Ga0207682_10180495 Ga0207682_101804951 141
87 3300025906 Ga0207699_10067113 Ga0207699_100671132 141
88 3300025906 Ga0207699_10474653 Ga0207699_104746532 141
89 3300025911 Ga0207654_10339907 Ga0207654_103399072 141
90 3300025911 Ga0207654_10427210 Ga0207654_104272102 141
91 3300025913 Ga0207695_10007887 Ga0207695_100078872 141
92 3300025913 Ga0207695_10153236 Ga0207695_101532362 141
93 3300025913 Ga0207695_10395467 Ga0207695_103954671 141
94 3300025916 Ga0207663_10393927 Ga0207663_103939272 141
95 3300025919 Ga0207657_10033756 Ga0207657_100337567 141
96 3300025921 Ga0207652_10021846 Ga0207652_100218462 141
97 3300025928 Ga0207700_10020596 Ga0207700_100205964 141
98 3300025929 Ga0207664_10010781 Ga0207664_100107814 141
99 3300025929 Ga0207664_10217660 Ga0207664_102176602 141
100 3300025929 Ga0207664_10241552 Ga0207664_102415522 141
101 3300025931 Ga0207644_10478172 Ga0207644_104781722 141
102 3300025933 Ga0207706_10007827 Ga0207706_100078277 141
103 3300025934 Ga0207686_10066763 Ga0207686_100667632 141
104 3300025937 Ga0207669_10234957 Ga0207669_102349572 141
105 3300025938 Ga0207704_10004850 Ga0207704_100048504 141
106 3300025939 Ga0207665_10697833 Ga0207665_106978332 141
107 3300025941 Ga0207711_10016537 Ga0207711_100165372 141
108 3300025941 Ga0207711_10812916 Ga0207711_108129162 141
109 3300025941 Ga0207711_10955352 Ga0207711_109553521 141
110 3300025944 Ga0207661_10236256 Ga0207661_102362562 141
111 3300025945 Ga0207679_10035126 Ga0207679_100351264 141
112 3300025949 Ga0207667_11566948 Ga0207667_115669481 141
113 3300025960 Ga0207651_10289963 Ga0207651_102899631 141
114 3300025981 Ga0207640_10187006 Ga0207640_101870062 141
115 3300026023 Ga0207677_10005450 Ga0207677_100054507 141
116 3300026023 Ga0207677_10342032 Ga0207677_103420322 141
117 3300026035 Ga0207703_10018742 Ga0207703_100187423 141
118 3300026035 Ga0207703_11105667 Ga0207703_111056671 141
119 3300026041 Ga0207639_10092987 Ga0207639_100929872 141
120 3300026078 Ga0207702_10087803 Ga0207702_100878033 141
121 3300026078 Ga0207702_10168453 Ga0207702_101684532 141
122 3300026088 Ga0207641_10187291 Ga0207641_101872911 141
123 3300026095 Ga0207676_10023956 Ga0207676_100239567 141
124 3300026116 Ga0207674_10043435 Ga0207674_100434354 141
125 3300026118 Ga0207675_100442123 Ga0207675_1004421232 141
126 3300026121 Ga0207683_10292247 Ga0207683_102922472 141
127 3300026142 Ga0207698_11006438 Ga0207698_110064382 141
128 3300028023 Ga0265357_1003812 Ga0265357_10038121 141
129 3300030878 Ga0265770_1004103 Ga0265770_10041031 141
130 3300031090 Ga0265760_10001600 Ga0265760_100016002 141
131 3300031090 Ga0265760_10016092 Ga0265760_100160922 141
132 3300035691 Ga0373931_0039397 Ga0373931_0039397_1753_2181 141
133 3300035695 Ga0373927_1130079 Ga0373927_1130079_68_502 141
134 3300044694 Ga0466963_0025699 Ga0466963_0025699_214_639 141
135 3300045976 Ga0466967_0140561 Ga0466967_0140561_1340_1765 141
136 3300046472 Ga0495580_0014014 Ga0495580_0014014_1206_1631 141
137 3300046472 Ga0495580_0216481 Ga0495580_0216481_814_1290 141
138 3300046472 Ga0495580_0299275 Ga0495580_0299275_649_1083 141
139 3300047319 Ga0495674_0705423 Ga0495674_0705423_12_437 141
140 3300048903 Ga0496100_0580655 Ga0496100_0580655_155_583 141
141 3300048905 Ga0496102_0227879 Ga0496102_0227879_301_729 141
142 3300048907 Ga0496104_0060068 Ga0496104_0060068_59_487 141
143 3300048908 Ga0496105_0288890 Ga0496105_0288890_512_940 141
144 3300048912 Ga0496109_1472999 Ga0496109_1472999_141_569 141
145 3300048915 Ga0496112_0079235 Ga0496112_0079235_1329_1757 141
146 3300048915 Ga0496112_0121059 Ga0496112_0121059_1382_1810 141
147 3300049583 Ga0501067_0190336 Ga0501067_0190336_175_600 141
148 3300005471 Ga0070698_100090191 Ga0070698_1000901914 143
149 3300025910 Ga0207684_10034641 Ga0207684_100346411 143
150 3300048911 Ga0496108_0099713 Ga0496108_0099713_759_1196 144
151 3300005327 Ga0070658_10822693 Ga0070658_108226931 155
152 3300005335 Ga0070666_10052512 Ga0070666_100525123 155
153 3300005336 Ga0070680_100117874 Ga0070680_1001178743 155
154 3300005338 Ga0068868_100021153 Ga0068868_1000211532 155
155 3300005367 Ga0070667_100183324 Ga0070667_1001833242 155
156 3300005458 Ga0070681_10596760 Ga0070681_105967602 155
157 3300005466 Ga0070685_10332705 Ga0070685_103327052 155
158 3300005530 Ga0070679_100033636 Ga0070679_1000336367 155
159 3300005530 Ga0070679_100275045 Ga0070679_1002750452 155
160 3300005535 Ga0070684_100083958 Ga0070684_1000839582 155
161 3300005539 Ga0068853_100911873 Ga0068853_1009118731 155
162 3300005718 Ga0068866_10199642 Ga0068866_101996422 155
163 3300005843 Ga0068860_100057629 Ga0068860_1000576295 155
164 3300006237 Ga0097621_100000415 Ga0097621_10000041524 155
165 3300006358 Ga0068871_100000565 Ga0068871_10000056522 155
166 3300006871 Ga0075434_100002949 Ga0075434_1000029498 155
167 3300006881 Ga0068865_100291754 Ga0068865_1002917542 155
168 3300009098 Ga0105245_10000384 Ga0105245_1000038411 155
169 3300009174 Ga0105241_10087087 Ga0105241_100870872 155
170 3300009177 Ga0105248_10259934 Ga0105248_102599343 155
171 3300010375 Ga0105239_10037386 Ga0105239_100373862 155
172 3300013297 Ga0157378_10000992 Ga0157378_100009922 155
173 3300014969 Ga0157376_10170557 Ga0157376_101705571 155
174 3300025903 Ga0207680_10080054 Ga0207680_100800542 155
175 3300025909 Ga0207705_11096505 Ga0207705_110965051 155
176 3300025917 Ga0207660_10049324 Ga0207660_100493242 155
177 3300025921 Ga0207652_10027833 Ga0207652_100278334 155
178 3300025921 Ga0207652_10235299 Ga0207652_102352992 155
179 3300025927 Ga0207687_10004670 Ga0207687_100046707 155
180 3300025928 Ga0207700_10258161 Ga0207700_102581612 155
181 3300025933 Ga0207706_10766034 Ga0207706_107660342 155
182 3300025938 Ga0207704_10439504 Ga0207704_104395042 155
183 3300025941 Ga0207711_10170605 Ga0207711_101706052 155
184 3300025986 Ga0207658_10151438 Ga0207658_101514382 155
185 3300026023 Ga0207677_10043002 Ga0207677_100430023 155
186 3300026089 Ga0207648_10140263 Ga0207648_101402632 155
187 3300028379 Ga0268266_10833276 Ga0268266_108332762 155
188 3300034816 Ga0373930_0140965 Ga0373930_0140965_31_498 155
189 3300037418 Ga0395900_0293443 Ga0395900_0293443_942_1409 155
190 3300037466 Ga0395898_0153351 Ga0395898_0153351_1606_2073 155
191 3300037466 Ga0395898_1169328 Ga0395898_1169328_186_653 155
192 3300037471 Ga0395905_0039526 Ga0395905_0039526_3892_4359 155
193 3300037471 Ga0395905_0063097 Ga0395905_0063097_2765_3232 155
194 3300037471 Ga0395905_0177653 Ga0395905_0177653_1431_1898 155
195 3300038443 Ga0395901_0626701 Ga0395901_0626701_90_557 155
196 3300053148 Ga0500590_246033 Ga0500590_246033_206_682 155
197 3300000546 LJNas_1000348 LJNas_10003487 156
198 3300005293 Ga0065715_10258067 Ga0065715_102580671 156
199 3300005331 Ga0070670_100008469 Ga0070670_1000084692 156
200 3300005337 Ga0070682_100176724 Ga0070682_1001767242 156
201 3300005338 Ga0068868_100968611 Ga0068868_1009686111 156
202 3300005340 Ga0070689_100159591 Ga0070689_1001595911 156
203 3300005341 Ga0070691_10142028 Ga0070691_101420281 156
204 3300005343 Ga0070687_100236072 Ga0070687_1002360721 156
205 3300005344 Ga0070661_100555002 Ga0070661_1005550022 156
206 3300005355 Ga0070671_100188748 Ga0070671_1001887482 156
207 3300005364 Ga0070673_100070923 Ga0070673_1000709232 156
208 3300005434 Ga0070709_10007937 Ga0070709_100079376 156
209 3300005434 Ga0070709_10243369 Ga0070709_102433692 156
210 3300005435 Ga0070714_100020493 Ga0070714_1000204932 156
211 3300005435 Ga0070714_100364892 Ga0070714_1003648921 156
212 3300005435 Ga0070714_101155990 Ga0070714_1011559902 156
213 3300005435 Ga0070714_101963190 Ga0070714_1019631901 156
214 3300005436 Ga0070713_100003749 Ga0070713_1000037496 156
215 3300005437 Ga0070710_10012248 Ga0070710_100122485 156
216 3300005437 Ga0070710_10077609 Ga0070710_100776092 156
217 3300005439 Ga0070711_100000476 Ga0070711_1000004762 156
218 3300005439 Ga0070711_100629258 Ga0070711_1006292581 156
219 3300005445 Ga0070708_100010243 Ga0070708_1000102434 156
220 3300005467 Ga0070706_100155333 Ga0070706_1001553333 156
221 3300005468 Ga0070707_100224641 Ga0070707_1002246412 156
222 3300005518 Ga0070699_100005316 Ga0070699_10000531612 156
223 3300005536 Ga0070697_100001591 Ga0070697_10000159115 156
224 3300005536 Ga0070697_100006458 Ga0070697_1000064581 156
225 3300005536 Ga0070697_100011237 Ga0070697_1000112377 156
226 3300005536 Ga0070697_100032036 Ga0070697_1000320363 156
227 3300005545 Ga0070695_100225086 Ga0070695_1002250862 156
228 3300005547 Ga0070693_100050772 Ga0070693_1000507722 156
229 3300005563 Ga0068855_100000477 Ga0068855_10000047717 156
230 3300005563 Ga0068855_100000664 Ga0068855_10000066430 156
231 3300005563 Ga0068855_100019350 Ga0068855_1000193509 156
232 3300005563 Ga0068855_100049672 Ga0068855_1000496724 156
233 3300005564 Ga0070664_100000304 Ga0070664_10000030420 156
234 3300005564 Ga0070664_100211723 Ga0070664_1002117232 156
235 3300005564 Ga0070664_100278840 Ga0070664_1002788402 156
236 3300005577 Ga0068857_100008491 Ga0068857_1000084918 156
237 3300005577 Ga0068857_100021111 Ga0068857_1000211117 156
238 3300005578 Ga0068854_100023308 Ga0068854_1000233085 156
239 3300005578 Ga0068854_100028477 Ga0068854_1000284774 156
240 3300005614 Ga0068856_100000334 Ga0068856_10000033413 156
241 3300005614 Ga0068856_100000667 Ga0068856_10000066714 156
242 3300005614 Ga0068856_100001991 Ga0068856_1000019915 156
243 3300005616 Ga0068852_100027791 Ga0068852_1000277912 156
244 3300005616 Ga0068852_100088147 Ga0068852_1000881472 156
245 3300005617 Ga0068859_100023059 Ga0068859_1000230592 156
246 3300005618 Ga0068864_100012672 Ga0068864_1000126725 156
247 3300005618 Ga0068864_100264071 Ga0068864_1002640712 156
248 3300005718 Ga0068866_10001555 Ga0068866_100015552 156
249 3300005719 Ga0068861_100269581 Ga0068861_1002695812 156
250 3300005840 Ga0068870_10015894 Ga0068870_100158945 156
251 3300005841 Ga0068863_100044379 Ga0068863_1000443795 156
252 3300005841 Ga0068863_101277826 Ga0068863_1012778261 156
253 3300005842 Ga0068858_100003363 Ga0068858_1000033637 156
254 3300005842 Ga0068858_100063571 Ga0068858_1000635712 156
255 3300005843 Ga0068860_100008186 Ga0068860_1000081866 156
256 3300005843 Ga0068860_100146847 Ga0068860_1001468472 156
257 3300006028 Ga0070717_10000800 Ga0070717_1000080016 156
258 3300006028 Ga0070717_10008127 Ga0070717_100081272 156
259 3300006028 Ga0070717_11140892 Ga0070717_111408922 156
260 3300006163 Ga0070715_10011807 Ga0070715_100118074 156
261 3300006175 Ga0070712_100003881 Ga0070712_1000038819 156
262 3300006175 Ga0070712_100319653 Ga0070712_1003196532 156
263 3300006237 Ga0097621_100000153 Ga0097621_10000015340 156
264 3300006237 Ga0097621_100000992 Ga0097621_1000009927 156
265 3300006237 Ga0097621_100021499 Ga0097621_1000214992 156
266 3300006358 Ga0068871_100000712 Ga0068871_10000071210 156
267 3300006358 Ga0068871_100000931 Ga0068871_10000093122 156
268 3300006931 Ga0097620_100023059 Ga0097620_1000230597 156
269 3300007788 Ga0099795_10051319 Ga0099795_100513192 156
270 3300009093 Ga0105240_10209712 Ga0105240_102097122 156
271 3300009147 Ga0114129_10064252 Ga0114129_100642522 156
272 3300009174 Ga0105241_10057374 Ga0105241_100573742 156
273 3300009174 Ga0105241_10330057 Ga0105241_103300571 156
274 3300009174 Ga0105241_10751425 Ga0105241_107514252 156
275 3300009176 Ga0105242_10084569 Ga0105242_100845693 156
276 3300009177 Ga0105248_10078001 Ga0105248_100780016 156
277 3300009177 Ga0105248_10090708 Ga0105248_100907083 156
278 3300009177 Ga0105248_10315374 Ga0105248_103153741 156
279 3300009545 Ga0105237_10032816 Ga0105237_100328163 156
280 3300009545 Ga0105237_10113017 Ga0105237_101130174 156
281 3300009551 Ga0105238_10016350 Ga0105238_100163503 156
282 3300010159 Ga0099796_10018343 Ga0099796_100183433 156
283 3300010375 Ga0105239_10116582 Ga0105239_101165822 156
284 3300010375 Ga0105239_11735372 Ga0105239_117353721 156
285 3300013100 Ga0157373_10070944 Ga0157373_100709444 156
286 3300013100 Ga0157373_10092736 Ga0157373_100927361 156
287 3300013100 Ga0157373_10120707 Ga0157373_101207073 156
288 3300013105 Ga0157369_10039889 Ga0157369_100398895 156
289 3300013105 Ga0157369_10078981 Ga0157369_100789811 156
290 3300013105 Ga0157369_10561215 Ga0157369_105612152 156
291 3300013296 Ga0157374_10002230 Ga0157374_100022307 156
292 3300013296 Ga0157374_10025967 Ga0157374_100259676 156
293 3300013296 Ga0157374_10223212 Ga0157374_102232122 156
294 3300013297 Ga0157378_10000229 Ga0157378_1000022914 156
295 3300013297 Ga0157378_10041243 Ga0157378_100412435 156
296 3300013306 Ga0163162_10055181 Ga0163162_100551813 156
297 3300013307 Ga0157372_10003049 Ga0157372_1000304917 156
298 3300013307 Ga0157372_10034628 Ga0157372_100346282 156
299 3300014497 Ga0182008_10041902 Ga0182008_100419023 156
300 3300014745 Ga0157377_10196744 Ga0157377_101967441 156
301 3300014968 Ga0157379_10142729 Ga0157379_101427291 156
302 3300014969 Ga0157376_10778524 Ga0157376_107785242 156
303 3300015261 Ga0182006_1022385 Ga0182006_10223854 156
304 3300015262 Ga0182007_10037286 Ga0182007_100372862 156
305 3300021377 Ga0213874_10095823 Ga0213874_100958232 156
306 3300022732 Ga0224569_100278 Ga0224569_1002781 156
307 3300022734 Ga0224571_100383 Ga0224571_1003833 156
308 3300024227 Ga0228598_1003343 Ga0228598_10033432 156
309 3300025898 Ga0207692_10532569 Ga0207692_105325692 156
310 3300025899 Ga0207642_10097782 Ga0207642_100977822 156
311 3300025904 Ga0207647_10050774 Ga0207647_100507742 156
312 3300025908 Ga0207643_10045293 Ga0207643_100452932 156
313 3300025910 Ga0207684_10227598 Ga0207684_102275982 156
314 3300025910 Ga0207684_10528918 Ga0207684_105289182 156
315 3300025911 Ga0207654_10084661 Ga0207654_100846612 156
316 3300025912 Ga0207707_10000681 Ga0207707_100006816 156
317 3300025912 Ga0207707_10027950 Ga0207707_100279502 156
318 3300025914 Ga0207671_10031184 Ga0207671_100311842 156
319 3300025914 Ga0207671_10040340 Ga0207671_100403401 156
320 3300025915 Ga0207693_10163232 Ga0207693_101632322 156
321 3300025920 Ga0207649_10126719 Ga0207649_101267192 156
322 3300025921 Ga0207652_10020957 Ga0207652_100209574 156
323 3300025922 Ga0207646_10075610 Ga0207646_100756102 156
324 3300025924 Ga0207694_10001905 Ga0207694_1000190513 156
325 3300025924 Ga0207694_10146764 Ga0207694_101467642 156
326 3300025924 Ga0207694_11529033 Ga0207694_115290331 156
327 3300025925 Ga0207650_10006405 Ga0207650_100064055 156
328 3300025926 Ga0207659_10477189 Ga0207659_104771892 156
329 3300025927 Ga0207687_11001026 Ga0207687_110010261 156
330 3300025928 Ga0207700_10091323 Ga0207700_100913233 156
331 3300025928 Ga0207700_10213407 Ga0207700_102134072 156
332 3300025928 Ga0207700_10530147 Ga0207700_105301472 156
333 3300025929 Ga0207664_10695321 Ga0207664_106953212 156
334 3300025932 Ga0207690_11059622 Ga0207690_110596222 156
335 3300025933 Ga0207706_10387448 Ga0207706_103874482 156
336 3300025936 Ga0207670_10259725 Ga0207670_102597252 156
337 3300025942 Ga0207689_10036713 Ga0207689_100367132 156
338 3300025944 Ga0207661_10108858 Ga0207661_101088582 156
339 3300025945 Ga0207679_10000789 Ga0207679_100007896 156
340 3300025945 Ga0207679_10422746 Ga0207679_104227462 156
341 3300025949 Ga0207667_10000764 Ga0207667_1000076417 156
342 3300025949 Ga0207667_10017825 Ga0207667_100178252 156
343 3300025949 Ga0207667_10042765 Ga0207667_100427652 156
344 3300025949 Ga0207667_10153289 Ga0207667_101532893 156
345 3300025949 Ga0207667_10392934 Ga0207667_103929342 156
346 3300025960 Ga0207651_10241259 Ga0207651_102412592 156
347 3300025981 Ga0207640_10003853 Ga0207640_100038536 156
348 3300025981 Ga0207640_10029683 Ga0207640_100296833 156
349 3300025981 Ga0207640_10044967 Ga0207640_100449673 156
350 3300026023 Ga0207677_10003799 Ga0207677_100037995 156
351 3300026035 Ga0207703_10013014 Ga0207703_100130142 156
352 3300026078 Ga0207702_10001773 Ga0207702_100017738 156
353 3300026078 Ga0207702_10002987 Ga0207702_1000298714 156
354 3300026078 Ga0207702_10106864 Ga0207702_101068642 156
355 3300026088 Ga0207641_10033924 Ga0207641_100339243 156
356 3300026089 Ga0207648_10009875 Ga0207648_100098756 156
357 3300026095 Ga0207676_10002632 Ga0207676_100026329 156
358 3300026095 Ga0207676_10080678 Ga0207676_100806783 156
359 3300026095 Ga0207676_10232203 Ga0207676_102322032 156
360 3300026116 Ga0207674_10003318 Ga0207674_1000331813 156
361 3300026116 Ga0207674_10034148 Ga0207674_100341487 156
362 3300026142 Ga0207698_10028935 Ga0207698_100289352 156
363 3300027512 Ga0209179_1014552 Ga0209179_10145522 156
364 3300028379 Ga0268266_10152686 Ga0268266_101526863 156
365 3300028381 Ga0268264_10053800 Ga0268264_100538005 156
366 3300035113 Ga0373936_0044227 Ga0373936_0044227_1149_1619 156
367 3300035116 Ga0373945_0116710 Ga0373945_0116710_388_858 156
368 3300035171 Ga0373946_0032360 Ga0373946_0032360_1508_1978 156
369 3300035172 Ga0373955_0300578 Ga0373955_0300578_330_800 156
370 3300035410 Ga0373924_0065086 Ga0373924_0065086_382_852 156
371 3300035410 Ga0373924_0099108 Ga0373924_0099108_60_530 156
372 3300035691 Ga0373931_0170103 Ga0373931_0170103_711_1184 156
373 3300035692 Ga0373935_0066593 Ga0373935_0066593_58_528 156
374 3300035692 Ga0373935_0316565 Ga0373935_0316565_585_1055 156
375 3300035695 Ga0373927_0130136 Ga0373927_0130136_1141_1620 156
376 3300035695 Ga0373927_0229280 Ga0373927_0229280_313_783 156
377 3300035695 Ga0373927_0240943 Ga0373927_0240943_691_1161 156
378 3300035724 Ga0373933_0334109 Ga0373933_0334109_433_903 156
379 3300035725 Ga0373947_0048813 Ga0373947_0048813_19_489 156
380 3300036401 Ga0373937_0245265 Ga0373937_0245265_849_1319 156
381 3300036401 Ga0373937_0286151 Ga0373937_0286151_949_1491 156
382 3300036401 Ga0373937_0365621 Ga0373937_0365621_244_744 156
383 3300037068 Ga0373925_0033519 Ga0373925_0033519_1229_1699 156
384 3300039450 Ga0436363_0828059 Ga0436363_0828059_197_667 156
385 3300046459 Ga0495629_0167697 Ga0495629_0167697_50_547 156
386 3300046472 Ga0495580_0001212 Ga0495580_0001212_8335_8805 156
387 3300046472 Ga0495580_0001301 Ga0495580_0001301_11959_12438 156
388 3300046472 Ga0495580_0012898 Ga0495580_0012898_4645_5124 156
389 3300046472 Ga0495580_0041131 Ga0495580_0041131_865_1344 156
390 3300046517 Ga0495630_0020435 Ga0495630_0020435_3335_3805 156
391 3300046531 Ga0495665_0068026 Ga0495665_0068026_353_823 156
392 3300046535 Ga0495586_0245415 Ga0495586_0245415_104_574 156
393 3300046615 Ga0495656_0243790 Ga0495656_0243790_209_691 156
394 3300046663 Ga0495635_0599763 Ga0495635_0599763_171_641 156
395 3300046680 Ga0495646_0336197 Ga0495646_0336197_199_669 156
396 3300046684 Ga0495669_0016621 Ga0495669_0016621_901_1404 156
397 3300046684 Ga0495669_0344429 Ga0495669_0344429_199_681 156
398 3300047319 Ga0495674_0022663 Ga0495674_0022663_1400_1870 156
399 3300047319 Ga0495674_0089456 Ga0495674_0089456_1384_1854 156
400 3300048905 Ga0496102_0169000 Ga0496102_0169000_1364_1837 156
401 3300048906 Ga0496103_0318378 Ga0496103_0318378_400_873 156
402 3300048907 Ga0496104_0262620 Ga0496104_0262620_408_881 156
403 3300048908 Ga0496105_0138035 Ga0496105_0138035_463_936 156
404 3300048909 Ga0496106_0030578 Ga0496106_0030578_1293_1766 156
405 3300048912 Ga0496109_0098752 Ga0496109_0098752_1786_2259 156
406 3300048913 Ga0496110_0161949 Ga0496110_0161949_1234_1707 156
407 3300048914 Ga0496111_0241170 Ga0496111_0241170_370_843 156
408 3300048915 Ga0496112_0011207 Ga0496112_0011207_3052_3525 156
409 3300048915 Ga0496112_0384837 Ga0496112_0384837_600_1073 156
410 3300049585 Ga0501069_0867318 Ga0501069_0867318_53_523 156
411 3300049589 Ga0501073_0010534 Ga0501073_0010534_4514_4993 156
412 3300049744 Ga0501083_0239538 Ga0501083_0239538_435_941 156
413 3300050507 nmdc:mga05p37_893174_c1 nmdc:mga05p37_893174_c1_303_791 156
414 3300050514 nmdc:mga08x19_1056781_c1 nmdc:mga08x19_1056781_c1_90_560 156
415 3300050514 nmdc:mga08x19_417247_c1 nmdc:mga08x19_417247_c1_263_769 156
416 3300053077 Ga0495601_0012392 Ga0495601_0012392_1426_1896 156
417 3300054114 Ga0501084_0159354 Ga0501084_0159354_13_492 156
418 3300060353 Ga0501082_0129022 Ga0501082_0129022_423_902 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

31

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ohd-assembly1.cif.gz_D crystal structure of hypothetical molybdenum cofactor biosynthesis protein c from sulfolobus tokodaii 0.9748 16 141
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.9676 12 145
4pyd-assembly1.cif.gz_D moac in complex with cpmp crystallized in space group p212121 0.9604 6 148
3jqj-assembly1.cif.gz_B crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 0.9589 12 156
3jqk-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) 0.9581 13 154
ID Description Score Start End Superfamily
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9676 12 145 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9622 4 155 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9573 16 141 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9537 5 155 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9536 4 155 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A382EVM7-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.989 16 155 GO:0006777
GO:0016829
AF-A0A2V9JT16-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC 0.9887 37 155 GO:0006777
GO:0061799
AF-A0A7V9C274-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9882 16 145 GO:0006777
GO:0061799
AF-A0A1H9H7X9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9869 16 155 GO:0006777
GO:0061799
AF-A0A3B1BGT7-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9864 16 156 GO:0006777
GO:0061798
GO:0061799

Feature Viewer

pLDDT pTM Quality
90.57 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map