F439255

General Info

Members Datasets Scaffolds Average Seq Length
418 207 415 122

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100001422|Ga0068856_10000142220
Length 136
Sequence VRLLASTPTSREKSEMIKLTFCLHRLPSLTREQFQKYWYEKHAPLVAKHREVLRIKRYVQMHSLSHPANEGIRGTRMGPEMYDGVAELWWDSIDDVLGNPSPERQAAGLELLEDERKFIDLPRSPLWFGDEKTIFG

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0
Rhizoplane 1.67
Rhizosphere 93.54
Stem 0
Stem Tuber 0
Unclassified 2.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10002047 3300003320 Bacteria 5699
2 rootH2_10084179 3300003320 Bacteria 2094
3 Ga0070658_10272202 3300005327 Bacteria 1440
4 Ga0070658_10471870 3300005327 Bacteria 1082
5 Ga0070666_10000992 3300005335 Bacteria 17349
6 Ga0070666_10196108 3300005335 Bacteria 1420
7 Ga0070680_100029870 3300005336 Bacteria 4376
8 Ga0070680_100035525 3300005336 Bacteria 4024
9 Ga0070680_100096572 3300005336 Bacteria 2450
10 Ga0070660_100013403 3300005339 Bacteria 5881
11 Ga0070660_100030503 3300005339 Bacteria 4045
12 Ga0070660_100075658 3300005339 Bacteria 2636
13 Ga0070691_10000181 3300005341 Bacteria 20796
14 Ga0070691_10019955 3300005341 Bacteria 3094
15 Ga0070661_100042109 3300005344 Bacteria 3333
16 Ga0070661_100319523 3300005344 Bacteria 1212
17 Ga0070675_100081863 3300005354 Unclassified 2693
18 Ga0070675_100395762 3300005354 Bacteria 1232
19 Ga0070674_100694530 3300005356 Unclassified 869
20 Ga0070674_100743606 3300005356 Bacteria 842
21 Ga0070673_100421525 3300005364 Bacteria 1197
22 Ga0070673_100688685 3300005364 Bacteria 938
23 Ga0070659_100006797 3300005366 Bacteria 8280
24 Ga0070659_100012333 3300005366 Bacteria 6333
25 Ga0070659_100047954 3300005366 Bacteria 3353
26 Ga0070667_100250867 3300005367 Bacteria 1582
27 Ga0070709_10010658 3300005434 Bacteria 5097
28 Ga0070709_10411069 3300005434 Unclassified 1012
29 Ga0070714_100093824 3300005435 Bacteria 2633
30 Ga0070714_100273095 3300005435 Unclassified 1568
31 Ga0070714_100358201 3300005435 Bacteria 1371
32 Ga0070714_102366590 3300005435 Unclassified 516
33 Ga0070713_100000044 3300005436 Bacteria 78106
34 Ga0070713_100128993 3300005436 Bacteria 2228
35 Ga0070713_100210514 3300005436 Bacteria 1760
36 Ga0070713_100942600 3300005436 Bacteria 831
37 Ga0070711_100015118 3300005439 Bacteria 4879
38 Ga0070711_100115583 3300005439 Bacteria 1976
39 Ga0070711_101135072 3300005439 Unclassified 674
40 Ga0070705_100555300 3300005440 Bacteria 881
41 Ga0070705_101310065 3300005440 Unclassified 601
42 Ga0070694_100715500 3300005444 Bacteria 815
43 Ga0070708_100301729 3300005445 Bacteria 1508
44 Ga0070708_100514387 3300005445 Bacteria 1129
45 Ga0070708_100962780 3300005445 Bacteria 801
46 Ga0070662_100511248 3300005457 Bacteria 1003
47 Ga0070662_100515211 3300005457 Bacteria 999
48 Ga0070681_10005487 3300005458 Bacteria 12251
49 Ga0070681_10036795 3300005458 Bacteria 4914
50 Ga0070681_10126867 3300005458 Bacteria 2484
51 Ga0070681_10209035 3300005458 Bacteria 1868
52 Ga0070699_100558152 3300005518 Bacteria 1043
53 Ga0070679_100320844 3300005530 Bacteria 1498
54 Ga0070679_100349193 3300005530 Bacteria 1427
55 Ga0070679_100416850 3300005530 Bacteria 1288
56 Ga0070679_100468952 3300005530 Bacteria 1203
57 Ga0068853_100005474 3300005539 Bacteria 9950
58 Ga0068853_100013091 3300005539 Bacteria 6767
59 Ga0068853_100019115 3300005539 Bacteria 5677
60 Ga0068853_100057234 3300005539 Bacteria 3364
61 Ga0070695_100004794 3300005545 Bacteria 7962
62 Ga0070695_101115915 3300005545 Unclassified 646
63 Ga0070696_101470800 3300005546 Unclassified 582
64 Ga0070693_100009348 3300005547 Bacteria 4873
65 Ga0070693_100210524 3300005547 Bacteria 1268
66 Ga0070665_100103952 3300005548 Unclassified 2843
67 Ga0070704_100780943 3300005549 Unclassified 852
68 Ga0068855_100000047 3300005563 Bacteria 145355
69 Ga0068855_100021592 3300005563 Bacteria 7721
70 Ga0068855_100027553 3300005563 Bacteria 6796
71 Ga0068855_100155497 3300005563 Bacteria 2598
72 Ga0068855_100210959 3300005563 Bacteria 2182
73 Ga0070664_100411125 3300005564 Bacteria 1238
74 Ga0070664_100462432 3300005564 Bacteria 1166
75 Ga0068857_100000359 3300005577 Bacteria 31852
76 Ga0068857_100081649 3300005577 Bacteria 2887
77 Ga0068857_101609281 3300005577 Bacteria 634
78 Ga0068854_100335009 3300005578 Bacteria 1234
79 Ga0068854_100424314 3300005578 Bacteria 1105
80 Ga0068856_100001422 3300005614 Bacteria 25117
81 Ga0068856_100002408 3300005614 Bacteria 19253
82 Ga0068856_100206957 3300005614 Bacteria 1976
83 Ga0068856_101217348 3300005614 Bacteria 769
84 Ga0068856_101448022 3300005614 Unclassified 701
85 Ga0068852_100007368 3300005616 Bacteria 8026
86 Ga0068852_100013555 3300005616 Bacteria 6240
87 Ga0068852_100093411 3300005616 Bacteria 2696
88 Ga0068852_100170939 3300005616 Bacteria 2037
89 Ga0068852_100603948 3300005616 Unclassified 1101
90 Ga0068864_101962388 3300005618 Unclassified 591
91 Ga0068861_101419525 3300005719 Bacteria 679
92 Ga0068863_100799665 3300005841 Unclassified 941
93 Ga0068863_100821166 3300005841 Unclassified 928
94 Ga0068863_101986164 3300005841 Unclassified 592
95 Ga0068858_100084850 3300005842 Bacteria 2946
96 Ga0068858_100401291 3300005842 Bacteria 1317
97 Ga0068862_100224294 3300005844 Bacteria 1702
98 Ga0070716_100077790 3300006173 Bacteria 1970
99 Ga0070712_100000037 3300006175 Bacteria 67430
100 Ga0070712_100000359 3300006175 Bacteria 25813
101 Ga0097621_100654676 3300006237 Bacteria 964
102 Ga0075370_10091028 3300006353 Bacteria 1759
103 Ga0068871_100322793 3300006358 Bacteria 1360
104 Ga0068871_100547390 3300006358 Bacteria 1048
105 Ga0075430_100868421 3300006846 Bacteria 743
106 Ga0075434_100019254 3300006871 Bacteria 6603
107 Ga0075434_100066482 3300006871 Bacteria 3591
108 Ga0075434_100090211 3300006871 Bacteria 3067
109 Ga0075434_100115249 3300006871 Bacteria 2700
110 Ga0075436_100000558 3300006914 Bacteria 24300
111 Ga0075436_100053375 3300006914 Bacteria 2790
112 Ga0075435_100339170 3300007076 Bacteria 1288
113 Ga0099794_10133222 3300007265 Bacteria 1256
114 Ga0105240_10000647 3300009093 Bacteria 64299
115 Ga0105240_10043780 3300009093 Bacteria 5692
116 Ga0105240_10079017 3300009093 Bacteria 4050
117 Ga0105240_10228575 3300009093 Bacteria 2163
118 Ga0105240_10491646 3300009093 Unclassified 1366
119 Ga0105240_10816537 3300009093 Bacteria 1009
120 Ga0105240_10902359 3300009093 Bacteria 951
121 Ga0111539_10143649 3300009094 Bacteria 2793
122 Ga0111539_10598324 3300009094 Bacteria 1284
123 Ga0105247_10005425 3300009101 Bacteria 8033
124 Ga0105247_10480914 3300009101 Bacteria 901
125 Ga0114129_10387855 3300009147 Bacteria 1843
126 Ga0105241_10017613 3300009174 Bacteria 5252
127 Ga0105241_10095696 3300009174 Bacteria 2351
128 Ga0105248_10308710 3300009177 Bacteria 1781
129 Ga0105237_10008567 3300009545 Bacteria 11059
130 Ga0105237_10605445 3300009545 Unclassified 1103
131 Ga0105237_11817982 3300009545 Bacteria 617
132 Ga0105237_11873779 3300009545 Bacteria 608
133 Ga0105238_10004810 3300009551 Bacteria 13365
134 Ga0105238_10006039 3300009551 Bacteria 12009
135 Ga0105238_10010519 3300009551 Bacteria 9287
136 Ga0105238_10129191 3300009551 Bacteria 2505
137 Ga0105238_10224074 3300009551 Unclassified 1857
138 Ga0105238_10768741 3300009551 Bacteria 978
139 Ga0105238_11111231 3300009551 Bacteria 813
140 Ga0105238_11577063 3300009551 Unclassified 686
141 Ga0105238_12257438 3300009551 Bacteria 579
142 Ga0105239_10001683 3300010375 Bacteria 29162
143 Ga0105239_10019025 3300010375 Bacteria 7589
144 Ga0105239_10098638 3300010375 Bacteria 3230
145 Ga0157370_10000433 3300013104 Bacteria 52195
146 Ga0157370_10010448 3300013104 Bacteria 9780
147 Ga0157370_10496967 3300013104 Unclassified 1120
148 Ga0157369_10001361 3300013105 Bacteria 30169
149 Ga0157369_10015486 3300013105 Bacteria 8593
150 Ga0157369_10030637 3300013105 Bacteria 5932
151 Ga0157369_11335060 3300013105 Unclassified 731
152 Ga0157374_10249733 3300013296 Bacteria 1746
153 Ga0157378_11851738 3300013297 Unclassified 652
154 Ga0163162_11116314 3300013306 Bacteria 894
155 Ga0163162_11371391 3300013306 Bacteria 804
156 Ga0157372_10013940 3300013307 Bacteria 8589
157 Ga0157372_10024675 3300013307 Bacteria 6534
158 Ga0157372_10146929 3300013307 Bacteria 2719
159 Ga0157375_10457821 3300013308 Bacteria 1441
160 Ga0157375_10542391 3300013308 Bacteria 1325
161 Ga0157375_11837038 3300013308 Bacteria 719
162 Ga0163163_10368038 3300014325 Bacteria 1494
163 Ga0163163_10473416 3300014325 Bacteria 1313
164 Ga0163163_10592049 3300014325 Bacteria 1172
165 Ga0163163_10596029 3300014325 Unclassified 1168
166 Ga0182008_10158295 3300014497 Bacteria 1138
167 Ga0157379_10003600 3300014968 Bacteria 13138
168 Ga0157379_10003906 3300014968 Bacteria 12706
169 Ga0157379_10030899 3300014968 Bacteria 4770
170 Ga0157379_10032205 3300014968 Bacteria 4673
171 Ga0157376_11407409 3300014969 Unclassified 729
172 Ga0207710_10012126 3300025900 Bacteria 3622
173 Ga0207710_10581691 3300025900 Bacteria 584
174 Ga0207680_10023873 3300025903 Bacteria 3347
175 Ga0207699_10005899 3300025906 Bacteria 5893
176 Ga0207699_10549842 3300025906 Bacteria 837
177 Ga0207645_10206242 3300025907 Bacteria 1294
178 Ga0207705_10008283 3300025909 Bacteria 7594
179 Ga0207684_10133107 3300025910 Bacteria 2134
180 Ga0207654_10052360 3300025911 Bacteria 2352
181 Ga0207654_10101443 3300025911 Bacteria 1774
182 Ga0207654_11130067 3300025911 Unclassified 571
183 Ga0207707_10003028 3300025912 Bacteria 14936
184 Ga0207707_10085142 3300025912 Bacteria 2762
185 Ga0207695_10000003 3300025913 Bacteria 1368691
186 Ga0207695_10007822 3300025913 Bacteria 13524
187 Ga0207695_10040920 3300025913 Bacteria 4964
188 Ga0207695_10058785 3300025913 Bacteria 3990
189 Ga0207695_10263456 3300025913 Bacteria 1621
190 Ga0207695_10526847 3300025913 Bacteria 1063
191 Ga0207671_10013552 3300025914 Bacteria 6491
192 Ga0207693_10000135 3300025915 Bacteria 67093
193 Ga0207693_10001064 3300025915 Bacteria 24563
194 Ga0207663_10058955 3300025916 Bacteria 2426
195 Ga0207663_11513475 3300025916 Unclassified 540
196 Ga0207660_10024883 3300025917 Bacteria 4057
197 Ga0207657_10000101 3300025919 Bacteria 82962
198 Ga0207649_10000154 3300025920 Bacteria 56342
199 Ga0207649_10218622 3300025920 Bacteria 1356
200 Ga0207649_11045538 3300025920 Unclassified 643
201 Ga0207652_10006431 3300025921 Bacteria 9473
202 Ga0207652_10657063 3300025921 Bacteria 937
203 Ga0207694_10000011 3300025924 Bacteria 417640
204 Ga0207694_10045214 3300025924 Bacteria 3401
205 Ga0207694_10113373 3300025924 Bacteria 2158
206 Ga0207694_10599130 3300025924 Bacteria 927
207 Ga0207694_10881135 3300025924 Unclassified 757
208 Ga0207650_10626470 3300025925 Bacteria 906
209 Ga0207659_10597747 3300025926 Bacteria 940
210 Ga0207659_10603585 3300025926 Bacteria 936
211 Ga0207700_10000017 3300025928 Bacteria 195983
212 Ga0207700_10060002 3300025928 Bacteria 2879
213 Ga0207700_10405604 3300025928 Bacteria 1195
214 Ga0207700_11000926 3300025928 Bacteria 748
215 Ga0207700_11440996 3300025928 Bacteria 612
216 Ga0207664_10080075 3300025929 Bacteria 2654
217 Ga0207664_10112241 3300025929 Bacteria 2269
218 Ga0207664_10149492 3300025929 Bacteria 1983
219 Ga0207644_10642455 3300025931 Bacteria 883
220 Ga0207690_10000077 3300025932 Bacteria 85018
221 Ga0207690_10056973 3300025932 Bacteria 2639
222 Ga0207669_10307394 3300025937 Bacteria 1208
223 Ga0207669_10490947 3300025937 Unclassified 981
224 Ga0207704_10000927 3300025938 Bacteria 12964
225 Ga0207665_10047748 3300025939 Bacteria 2871
226 Ga0207665_10076292 3300025939 Bacteria 2298
227 Ga0207711_10359381 3300025941 Bacteria 1349
228 Ga0207711_11208228 3300025941 Unclassified 698
229 Ga0207689_11243166 3300025942 Bacteria 626
230 Ga0207661_10716027 3300025944 Unclassified 921
231 Ga0207679_10307405 3300025945 Bacteria 1369
232 Ga0207679_11215204 3300025945 Bacteria 692
233 Ga0207679_11333648 3300025945 Unclassified 658
234 Ga0207667_10000050 3300025949 Bacteria 234390
235 Ga0207667_10006353 3300025949 Bacteria 14327
236 Ga0207667_10145563 3300025949 Bacteria 2439
237 Ga0207667_10631494 3300025949 Unclassified 1078
238 Ga0207667_11630794 3300025949 Unclassified 613
239 Ga0207651_10225548 3300025960 Bacteria 1518
240 Ga0207651_10562246 3300025960 Bacteria 993
241 Ga0207651_10935953 3300025960 Bacteria 773
242 Ga0207668_10404298 3300025972 Bacteria 1155
243 Ga0207640_10305167 3300025981 Bacteria 1261
244 Ga0207658_10153604 3300025986 Unclassified 1878
245 Ga0207703_10078116 3300026035 Bacteria 2749
246 Ga0207703_10181062 3300026035 Bacteria 1860
247 Ga0207639_10043301 3300026041 Bacteria 3379
248 Ga0207639_10213199 3300026041 Bacteria 1663
249 Ga0207678_10046163 3300026067 Bacteria 3767
250 Ga0207678_11927529 3300026067 Unclassified 515
251 Ga0207702_10000035 3300026078 Bacteria 158744
252 Ga0207702_10003677 3300026078 Bacteria 13880
253 Ga0207702_10157870 3300026078 Bacteria 2069
254 Ga0207702_10437015 3300026078 Unclassified 1268
255 Ga0207702_10457052 3300026078 Bacteria 1240
256 Ga0207702_10603811 3300026078 Bacteria 1077
257 Ga0207702_10631769 3300026078 Unclassified 1052
258 Ga0207641_10249650 3300026088 Bacteria 1657
259 Ga0207641_10286965 3300026088 Bacteria 1550
260 Ga0207648_10157065 3300026089 Bacteria 2008
261 Ga0207648_10370426 3300026089 Bacteria 1294
262 Ga0207648_10617958 3300026089 Bacteria 1000
263 Ga0207676_11570127 3300026095 Bacteria 656
264 Ga0207676_11916369 3300026095 Unclassified 591
265 Ga0207674_10000003 3300026116 Bacteria 241674
266 Ga0207698_10009173 3300026142 Bacteria 6291
267 Ga0207698_10084151 3300026142 Bacteria 2578
268 Ga0207698_10192178 3300026142 Bacteria 1819
269 Ga0268266_10397903 3300028379 Unclassified 1302
270 Ga0268265_10138661 3300028380 Bacteria 2033
271 Ga0268265_10271106 3300028380 Bacteria 1514
272 Ga0268264_11066707 3300028381 Bacteria 816
273 Ga0265338_10006246 3300028800 Bacteria 15252
274 Ga0265338_10008944 3300028800 Bacteria 12046
275 Ga0265338_10075338 3300028800 Bacteria 2864
276 Ga0265338_10929688 3300028800 Unclassified 591
277 Ga0265338_11218414 3300028800 Bacteria 504
278 Ga0265332_10451030 3300031238 Bacteria 532
279 Ga0265325_10001455 3300031241 Bacteria 16632
280 Ga0265329_10117509 3300031242 Bacteria 852
281 Ga0265329_10192458 3300031242 Unclassified 669
282 Ga0265340_10050974 3300031247 Bacteria 2006
283 Ga0265340_10052794 3300031247 Bacteria 1964
284 Ga0265340_10365782 3300031247 Unclassified 637
285 Ga0265339_10002890 3300031249 Bacteria 12161
286 Ga0265339_10040781 3300031249 Bacteria 2579
287 Ga0265331_10000113 3300031250 Bacteria 105472
288 Ga0265331_10003392 3300031250 Bacteria 10325
289 Ga0265327_10000124 3300031251 Bacteria 169233
290 Ga0265327_10000602 3300031251 Bacteria 59632
291 Ga0307513_10007113 3300031456 Bacteria 14550
292 Ga0307408_100445390 3300031548 Bacteria 1122
293 Ga0265313_10001046 3300031595 Bacteria 26926
294 Ga0265314_10003125 3300031711 Bacteria 16268
295 Ga0265314_10011644 3300031711 Bacteria 7240
296 Ga0265314_10027220 3300031711 Bacteria 4284
297 Ga0265314_10057677 3300031711 Unclassified 2665
298 Ga0307516_10009375 3300031730 Bacteria 10920
299 Ga0307413_10428801 3300031824 Bacteria 1043
300 Ga0307410_10001019 3300031852 Bacteria 12147
301 Ga0307410_11484441 3300031852 Bacteria 597
302 Ga0307409_100454357 3300031995 Unclassified 1237
303 Ga0307416_100477981 3300032002 Unclassified 1305
304 Ga0307414_10127213 3300032004 Unclassified 1971
305 Ga0307414_10454217 3300032004 Bacteria 1124
306 Ga0307414_10693202 3300032004 Bacteria 921
307 Ga0307414_12238786 3300032004 Bacteria 510
308 Ga0307411_10008168 3300032005 Bacteria 5402
309 Ga0307415_100346599 3300032126 Unclassified 1249
310 Ga0373943_0421228 3300035170 Unclassified 773
311 Ga0373946_0266126 3300035171 Bacteria 840
312 Ga0373955_0229065 3300035172 Bacteria 1111
313 Ga0373955_0288347 3300035172 Unclassified 988
314 Ga0373931_0099646 3300035691 Bacteria 1632
315 Ga0373935_1131707 3300035692 Unclassified 583
316 Ga0373933_0015050 3300035724 Bacteria 4312
317 Ga0373937_0010732 3300036401 Bacteria 8013
318 Ga0373937_0043098 3300036401 Bacteria 4118
319 Ga0373937_0760373 3300036401 Bacteria 916
320 Ga0373925_0075500 3300037068 Bacteria 2554
321 Ga0436365_0710801 3300039437 Bacteria 1021
322 Ga0436365_1196036 3300039437 Bacteria 119165
323 Ga0436360_0105778 3300039438 Bacteria 930
324 Ga0436360_0290156 3300039438 Bacteria 645
325 Ga0436362_1000137 3300039453 Bacteria 1394
326 Ga0453683_0043221 3300044673 Bacteria 2828
327 Ga0466965_0940081 3300044683 Unclassified 506
328 Ga0466961_0294355 3300044693 Bacteria 992
329 Ga0451576_0419037 3300045051 Bacteria 1405
330 Ga0495651_0450430 3300046462 Bacteria 832
331 Ga0495651_1002434 3300046462 Unclassified 507
332 Ga0495580_0176868 3300046472 Bacteria 1474
333 Ga0495664_0232101 3300046477 Unclassified 1117
334 Ga0495583_0106852 3300046506 Bacteria 1189
335 Ga0495628_0635535 3300046516 Unclassified 759
336 Ga0495652_0050671 3300046529 Bacteria 3549
337 Ga0495652_1038637 3300046529 Bacteria 534
338 Ga0495665_0492634 3300046531 Unclassified 618
339 Ga0495645_0082828 3300046543 Bacteria 2300
340 Ga0495668_0181214 3300046616 Bacteria 1154
341 Ga0495668_0545722 3300046616 Bacteria 640
342 Ga0495625_0053003 3300046660 Bacteria 2903
343 Ga0495657_0410734 3300046675 Unclassified 796
344 Ga0495672_0061602 3300047320 Bacteria 2162
345 Ga0496102_0899101 3300048905 Bacteria 807
346 Ga0496104_0595226 3300048907 Bacteria 1016
347 Ga0496110_0565498 3300048913 Bacteria 1033
348 Ga0496110_0599862 3300048913 Bacteria 999
349 Ga0496111_0490443 3300048914 Bacteria 905
350 Ga0496112_0963073 3300048915 Unclassified 774
351 Ga0496115_0008084 3300048918 Bacteria 7770
352 Ga0496126_0001616 3300048929 Bacteria 34122
353 Ga0495682_0001113 3300049460 Bacteria 15638
354 Ga0501031_0046855 3300049568 Unclassified 2819
355 Ga0501031_0277426 3300049568 Bacteria 1088
356 Ga0501033_0083029 3300049570 Bacteria 2349
357 Ga0501033_0190126 3300049570 Bacteria 1469
358 Ga0501033_0635613 3300049570 Unclassified 730
359 Ga0501036_0086025 3300049572 Bacteria 2658
360 Ga0501037_0068856 3300049573 Plasmid 2577
361 Ga0501038_0350187 3300049574 Unclassified 1150
362 Ga0501039_0231151 3300049575 Bacteria 1454
363 Ga0501043_0036941 3300049579 Bacteria 3843
364 Ga0501043_0274612 3300049579 Bacteria 1293
365 Ga0501043_0322418 3300049579 Bacteria 1178
366 Ga0501046_0017119 3300049580 Bacteria 6057
367 Ga0501047_0031499 3300049581 Bacteria 5114
368 Ga0501047_0439501 3300049581 Unclassified 1135
369 Ga0501047_0533138 3300049581 Bacteria 999
370 Ga0501047_1081503 3300049581 Unclassified 615
371 Ga0501048_0086002 3300049582 Bacteria 2218
372 Ga0501067_0017951 3300049583 Bacteria 3918
373 Ga0501070_0001669 3300049586 Bacteria 19669
374 Ga0501070_0013891 3300049586 Bacteria 6781
375 Ga0501070_0656021 3300049586 Bacteria 833
376 Ga0501072_0126608 3300049588 Bacteria 2035
377 Ga0501073_0010175 3300049589 Bacteria 6908
378 Ga0501074_0733759 3300049590 Unclassified 697
379 Ga0501079_0441886 3300049741 Unclassified 1021
380 Ga0501079_1652589 3300049741 Unclassified 504
381 Ga0501080_0002174 3300049742 Bacteria 17024
382 Ga0501080_0043589 3300049742 Bacteria 4178
383 Ga0501080_0564782 3300049742 Bacteria 1012
384 Ga0501080_0843067 3300049742 Bacteria 802
385 Ga0501035_0001772 3300049822 Bacteria 21790
386 Ga0501035_0079537 3300049822 Bacteria 2896
387 Ga0501035_0184563 3300049822 Bacteria 1796
388 Ga0501044_0025156 3300049823 Bacteria 6312
389 Ga0501044_0028306 3300049823 Bacteria 5914
390 Ga0501044_0071547 3300049823 Bacteria 3526
391 Ga0501044_0113246 3300049823 Bacteria 2720
392 Ga0501044_0747071 3300049823 Bacteria 861
393 Ga0501044_1342384 3300049823 Unclassified 581
394 nmdc:mga07m45_169602_c1 3300050496 Bacteria 1268
395 nmdc:mga05p37_834307_c1 3300050507 Bacteria 1003
396 nmdc:mga0n895_150495_c1 3300050512 Unclassified 2357
397 nmdc:mga0n895_37333_c1 3300050512 Bacteria 4699
398 nmdc:mga0n895_3960_c1 3300050512 Bacteria 12038
399 nmdc:mga0n895_47863_c1 3300050512 Bacteria 4182
400 nmdc:mga0n895_547273_c1 3300050512 Bacteria 1163
401 nmdc:mga0n895_80411_c1 3300050512 Bacteria 3247
402 nmdc:mga0rr50_490673_c1 3300050513 Bacteria 1044
403 nmdc:mga08x19_32544_c1 3300050514 Bacteria 3287
404 nmdc:mga08x19_561_c1 3300050514 Bacteria 24307
405 Ga0495612_0268570 3300053078 Unclassified 761
406 Ga0500641_0007331 3300053096 Bacteria 3930
407 Ga0500641_0091144 3300053096 Bacteria 1301
408 Ga0500555_069334 3300053103 Bacteria 933
409 Ga0500562_001120 3300053108 Bacteria 6593
410 Ga0500562_002637 3300053108 Bacteria 4464
411 Ga0500595_008445 3300053119 Bacteria 4205
412 Ga0500655_002595 3300053133 Unclassified 3285
413 Ga0500655_014636 3300053133 Bacteria 1436
414 Ga0501084_0530297 3300054114 Bacteria 995
415 Ga0501082_0247725 3300060353 Bacteria 1551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10598324 Ga0111539_105983242 113
2 3300046660 Ga0495625_0053003 Ga0495625_0053003_1200_1568 114
3 iso_pu_bacteria 2643221614 2644086473 116
4 iso_pu_bacteria 2643221661 2644341427 116
5 iso_pu_bacteria 2643221666 2644367714 116
6 3300009093 Ga0105240_10902359 Ga0105240_109023592 118
7 3300028800 Ga0265338_10006246 Ga0265338_1000624616 118
8 3300028800 Ga0265338_10075338 Ga0265338_100753383 118
9 3300005439 Ga0070711_100115583 Ga0070711_1001155832 120
10 3300005440 Ga0070705_101310065 Ga0070705_1013100651 120
11 3300005444 Ga0070694_100715500 Ga0070694_1007155002 120
12 3300005545 Ga0070695_101115915 Ga0070695_1011159152 120
13 3300005549 Ga0070704_100780943 Ga0070704_1007809432 120
14 3300005614 Ga0068856_101217348 Ga0068856_1012173482 120
15 3300006871 Ga0075434_100066482 Ga0075434_1000664823 120
16 3300006871 Ga0075434_100090211 Ga0075434_1000902113 120
17 3300007076 Ga0075435_100339170 Ga0075435_1003391702 120
18 3300009093 Ga0105240_10816537 Ga0105240_108165372 120
19 3300009147 Ga0114129_10387855 Ga0114129_103878552 120
20 3300013306 Ga0163162_11371391 Ga0163162_113713911 120
21 3300014325 Ga0163163_10592049 Ga0163163_105920491 120
22 3300025913 Ga0207695_10526847 Ga0207695_105268472 120
23 3300025916 Ga0207663_10058955 Ga0207663_100589552 120
24 3300025939 Ga0207665_10047748 Ga0207665_100477482 120
25 3300026078 Ga0207702_10603811 Ga0207702_106038112 120
26 3300031824 Ga0307413_10428801 Ga0307413_104288011 120
27 3300032004 Ga0307414_10454217 Ga0307414_104542172 120
28 3300032004 Ga0307414_10693202 Ga0307414_106932022 120
29 3300032004 Ga0307414_12238786 Ga0307414_122387862 120
30 3300039438 Ga0436360_0290156 Ga0436360_0290156_17_379 120
31 3300050507 nmdc:mga05p37_834307_c1 nmdc:mga05p37_834307_c1_554_922 120
32 3300050512 nmdc:mga0n895_150495_c1 nmdc:mga0n895_150495_c1_1926_2288 120
33 3300050512 nmdc:mga0n895_3960_c1 nmdc:mga0n895_3960_c1_5435_5800 120
34 3300050512 nmdc:mga0n895_47863_c1 nmdc:mga0n895_47863_c1_2954_3322 120
35 3300050513 nmdc:mga0rr50_490673_c1 nmdc:mga0rr50_490673_c1_65_433 120
36 3300003320 rootH2_10002047 rootH2_100020474 121
37 3300003320 rootH2_10084179 rootH2_100841792 121
38 3300005327 Ga0070658_10272202 Ga0070658_102722022 121
39 3300005327 Ga0070658_10471870 Ga0070658_104718702 121
40 3300005335 Ga0070666_10000992 Ga0070666_1000099215 121
41 3300005335 Ga0070666_10196108 Ga0070666_101961082 121
42 3300005336 Ga0070680_100029870 Ga0070680_1000298705 121
43 3300005336 Ga0070680_100035525 Ga0070680_1000355254 121
44 3300005336 Ga0070680_100096572 Ga0070680_1000965723 121
45 3300005339 Ga0070660_100013403 Ga0070660_1000134037 121
46 3300005339 Ga0070660_100030503 Ga0070660_1000305032 121
47 3300005339 Ga0070660_100075658 Ga0070660_1000756582 121
48 3300005341 Ga0070691_10000181 Ga0070691_100001813 121
49 3300005341 Ga0070691_10019955 Ga0070691_100199552 121
50 3300005344 Ga0070661_100042109 Ga0070661_1000421093 121
51 3300005344 Ga0070661_100319523 Ga0070661_1003195232 121
52 3300005354 Ga0070675_100081863 Ga0070675_1000818632 121
53 3300005354 Ga0070675_100395762 Ga0070675_1003957622 121
54 3300005356 Ga0070674_100694530 Ga0070674_1006945302 121
55 3300005356 Ga0070674_100743606 Ga0070674_1007436062 121
56 3300005364 Ga0070673_100421525 Ga0070673_1004215252 121
57 3300005364 Ga0070673_100688685 Ga0070673_1006886852 121
58 3300005366 Ga0070659_100006797 Ga0070659_10000679711 121
59 3300005366 Ga0070659_100012333 Ga0070659_1000123336 121
60 3300005366 Ga0070659_100047954 Ga0070659_1000479543 121
61 3300005367 Ga0070667_100250867 Ga0070667_1002508672 121
62 3300005434 Ga0070709_10010658 Ga0070709_100106583 121
63 3300005434 Ga0070709_10411069 Ga0070709_104110692 121
64 3300005435 Ga0070714_100093824 Ga0070714_1000938242 121
65 3300005435 Ga0070714_100273095 Ga0070714_1002730951 121
66 3300005435 Ga0070714_100358201 Ga0070714_1003582012 121
67 3300005435 Ga0070714_102366590 Ga0070714_1023665901 121
68 3300005436 Ga0070713_100000044 Ga0070713_10000004421 121
69 3300005436 Ga0070713_100128993 Ga0070713_1001289932 121
70 3300005436 Ga0070713_100210514 Ga0070713_1002105142 121
71 3300005436 Ga0070713_100942600 Ga0070713_1009426002 121
72 3300005439 Ga0070711_100015118 Ga0070711_1000151187 121
73 3300005439 Ga0070711_101135072 Ga0070711_1011350721 121
74 3300005440 Ga0070705_100555300 Ga0070705_1005553002 121
75 3300005445 Ga0070708_100301729 Ga0070708_1003017292 121
76 3300005445 Ga0070708_100514387 Ga0070708_1005143872 121
77 3300005445 Ga0070708_100962780 Ga0070708_1009627802 121
78 3300005457 Ga0070662_100511248 Ga0070662_1005112482 121
79 3300005457 Ga0070662_100515211 Ga0070662_1005152112 121
80 3300005458 Ga0070681_10005487 Ga0070681_100054878 121
81 3300005458 Ga0070681_10036795 Ga0070681_100367956 121
82 3300005458 Ga0070681_10126867 Ga0070681_101268673 121
83 3300005458 Ga0070681_10209035 Ga0070681_102090352 121
84 3300005518 Ga0070699_100558152 Ga0070699_1005581522 121
85 3300005530 Ga0070679_100320844 Ga0070679_1003208442 121
86 3300005530 Ga0070679_100349193 Ga0070679_1003491932 121
87 3300005530 Ga0070679_100416850 Ga0070679_1004168502 121
88 3300005530 Ga0070679_100468952 Ga0070679_1004689522 121
89 3300005539 Ga0068853_100005474 Ga0068853_1000054747 121
90 3300005539 Ga0068853_100013091 Ga0068853_1000130911 121
91 3300005539 Ga0068853_100019115 Ga0068853_1000191153 121
92 3300005539 Ga0068853_100057234 Ga0068853_1000572343 121
93 3300005545 Ga0070695_100004794 Ga0070695_1000047943 121
94 3300005546 Ga0070696_101470800 Ga0070696_1014708002 121
95 3300005547 Ga0070693_100009348 Ga0070693_1000093483 121
96 3300005547 Ga0070693_100210524 Ga0070693_1002105241 121
97 3300005548 Ga0070665_100103952 Ga0070665_1001039522 121
98 3300005563 Ga0068855_100000047 Ga0068855_10000004734 121
99 3300005563 Ga0068855_100021592 Ga0068855_1000215923 121
100 3300005563 Ga0068855_100027553 Ga0068855_1000275538 121
101 3300005563 Ga0068855_100155497 Ga0068855_1001554972 121
102 3300005563 Ga0068855_100210959 Ga0068855_1002109594 121
103 3300005564 Ga0070664_100411125 Ga0070664_1004111252 121
104 3300005564 Ga0070664_100462432 Ga0070664_1004624322 121
105 3300005577 Ga0068857_100000359 Ga0068857_10000035922 121
106 3300005577 Ga0068857_100081649 Ga0068857_1000816494 121
107 3300005577 Ga0068857_101609281 Ga0068857_1016092811 121
108 3300005578 Ga0068854_100335009 Ga0068854_1003350092 121
109 3300005578 Ga0068854_100424314 Ga0068854_1004243142 121
110 3300005614 Ga0068856_100001422 Ga0068856_10000142220 121
111 3300005614 Ga0068856_100002408 Ga0068856_1000024083 121
112 3300005614 Ga0068856_100206957 Ga0068856_1002069572 121
113 3300005614 Ga0068856_101448022 Ga0068856_1014480221 121
114 3300005616 Ga0068852_100007368 Ga0068852_1000073682 121
115 3300005616 Ga0068852_100013555 Ga0068852_1000135551 121
116 3300005616 Ga0068852_100093411 Ga0068852_1000934113 121
117 3300005616 Ga0068852_100170939 Ga0068852_1001709393 121
118 3300005616 Ga0068852_100603948 Ga0068852_1006039482 121
119 3300005618 Ga0068864_101962388 Ga0068864_1019623882 121
120 3300005719 Ga0068861_101419525 Ga0068861_1014195251 121
121 3300005841 Ga0068863_100799665 Ga0068863_1007996652 121
122 3300005841 Ga0068863_100821166 Ga0068863_1008211662 121
123 3300005841 Ga0068863_101986164 Ga0068863_1019861641 121
124 3300005842 Ga0068858_100084850 Ga0068858_1000848502 121
125 3300005842 Ga0068858_100401291 Ga0068858_1004012911 121
126 3300005844 Ga0068862_100224294 Ga0068862_1002242942 121
127 3300006173 Ga0070716_100077790 Ga0070716_1000777902 121
128 3300006175 Ga0070712_100000037 Ga0070712_10000003731 121
129 3300006175 Ga0070712_100000359 Ga0070712_1000003599 121
130 3300006237 Ga0097621_100654676 Ga0097621_1006546762 121
131 3300006353 Ga0075370_10091028 Ga0075370_100910282 121
132 3300006358 Ga0068871_100322793 Ga0068871_1003227932 121
133 3300006358 Ga0068871_100547390 Ga0068871_1005473902 121
134 3300006846 Ga0075430_100868421 Ga0075430_1008684212 121
135 3300006871 Ga0075434_100019254 Ga0075434_1000192544 121
136 3300006871 Ga0075434_100115249 Ga0075434_1001152493 121
137 3300006914 Ga0075436_100000558 Ga0075436_1000005587 121
138 3300006914 Ga0075436_100053375 Ga0075436_1000533753 121
139 3300007265 Ga0099794_10133222 Ga0099794_101332221 121
140 3300009093 Ga0105240_10000647 Ga0105240_1000064716 121
141 3300009093 Ga0105240_10043780 Ga0105240_100437801 121
142 3300009093 Ga0105240_10079017 Ga0105240_100790174 121
143 3300009093 Ga0105240_10228575 Ga0105240_102285752 121
144 3300009093 Ga0105240_10491646 Ga0105240_104916462 121
145 3300009094 Ga0111539_10143649 Ga0111539_101436492 121
146 3300009101 Ga0105247_10005425 Ga0105247_100054253 121
147 3300009101 Ga0105247_10480914 Ga0105247_104809142 121
148 3300009174 Ga0105241_10017613 Ga0105241_100176133 121
149 3300009174 Ga0105241_10095696 Ga0105241_100956962 121
150 3300009177 Ga0105248_10308710 Ga0105248_103087103 121
151 3300009545 Ga0105237_10008567 Ga0105237_100085675 121
152 3300009545 Ga0105237_10605445 Ga0105237_106054452 121
153 3300009545 Ga0105237_11817982 Ga0105237_118179821 121
154 3300009545 Ga0105237_11873779 Ga0105237_118737792 121
155 3300009551 Ga0105238_10004810 Ga0105238_100048102 121
156 3300009551 Ga0105238_10006039 Ga0105238_1000603911 121
157 3300009551 Ga0105238_10010519 Ga0105238_100105198 121
158 3300009551 Ga0105238_10129191 Ga0105238_101291912 121
159 3300009551 Ga0105238_10224074 Ga0105238_102240744 121
160 3300009551 Ga0105238_10768741 Ga0105238_107687412 121
161 3300009551 Ga0105238_11111231 Ga0105238_111112313 121
162 3300009551 Ga0105238_11577063 Ga0105238_115770631 121
163 3300009551 Ga0105238_12257438 Ga0105238_122574381 121
164 3300010375 Ga0105239_10001683 Ga0105239_1000168315 121
165 3300010375 Ga0105239_10019025 Ga0105239_100190252 121
166 3300010375 Ga0105239_10098638 Ga0105239_100986384 121
167 3300013104 Ga0157370_10000433 Ga0157370_1000043317 121
168 3300013104 Ga0157370_10010448 Ga0157370_100104483 121
169 3300013104 Ga0157370_10496967 Ga0157370_104969672 121
170 3300013105 Ga0157369_10001361 Ga0157369_1000136115 121
171 3300013105 Ga0157369_10015486 Ga0157369_100154867 121
172 3300013105 Ga0157369_10030637 Ga0157369_100306377 121
173 3300013105 Ga0157369_11335060 Ga0157369_113350601 121
174 3300013296 Ga0157374_10249733 Ga0157374_102497333 121
175 3300013297 Ga0157378_11851738 Ga0157378_118517382 121
176 3300013306 Ga0163162_11116314 Ga0163162_111163142 121
177 3300013307 Ga0157372_10013940 Ga0157372_100139405 121
178 3300013307 Ga0157372_10024675 Ga0157372_100246754 121
179 3300013307 Ga0157372_10146929 Ga0157372_101469292 121
180 3300013308 Ga0157375_10457821 Ga0157375_104578212 121
181 3300013308 Ga0157375_10542391 Ga0157375_105423911 121
182 3300013308 Ga0157375_11837038 Ga0157375_118370382 121
183 3300014325 Ga0163163_10368038 Ga0163163_103680382 121
184 3300014325 Ga0163163_10473416 Ga0163163_104734162 121
185 3300014325 Ga0163163_10596029 Ga0163163_105960292 121
186 3300014497 Ga0182008_10158295 Ga0182008_101582952 121
187 3300014968 Ga0157379_10003600 Ga0157379_100036007 121
188 3300014968 Ga0157379_10003906 Ga0157379_1000390612 121
189 3300014968 Ga0157379_10030899 Ga0157379_100308993 121
190 3300014968 Ga0157379_10032205 Ga0157379_100322053 121
191 3300014969 Ga0157376_11407409 Ga0157376_114074091 121
192 3300025900 Ga0207710_10012126 Ga0207710_100121264 121
193 3300025900 Ga0207710_10581691 Ga0207710_105816912 121
194 3300025903 Ga0207680_10023873 Ga0207680_100238733 121
195 3300025906 Ga0207699_10005899 Ga0207699_100058992 121
196 3300025906 Ga0207699_10549842 Ga0207699_105498421 121
197 3300025907 Ga0207645_10206242 Ga0207645_102062422 121
198 3300025909 Ga0207705_10008283 Ga0207705_100082836 121
199 3300025910 Ga0207684_10133107 Ga0207684_101331072 121
200 3300025911 Ga0207654_10052360 Ga0207654_100523602 121
201 3300025911 Ga0207654_10101443 Ga0207654_101014432 121
202 3300025911 Ga0207654_11130067 Ga0207654_111300671 121
203 3300025912 Ga0207707_10003028 Ga0207707_100030283 121
204 3300025912 Ga0207707_10085142 Ga0207707_100851423 121
205 3300025913 Ga0207695_10000003 Ga0207695_10000003728 121
206 3300025913 Ga0207695_10007822 Ga0207695_1000782213 121
207 3300025913 Ga0207695_10040920 Ga0207695_100409204 121
208 3300025913 Ga0207695_10058785 Ga0207695_100587853 121
209 3300025913 Ga0207695_10263456 Ga0207695_102634562 121
210 3300025914 Ga0207671_10013552 Ga0207671_100135525 121
211 3300025915 Ga0207693_10000135 Ga0207693_1000013531 121
212 3300025915 Ga0207693_10001064 Ga0207693_1000106410 121
213 3300025916 Ga0207663_11513475 Ga0207663_115134751 121
214 3300025917 Ga0207660_10024883 Ga0207660_100248834 121
215 3300025919 Ga0207657_10000101 Ga0207657_100001014 121
216 3300025920 Ga0207649_10000154 Ga0207649_1000015448 121
217 3300025920 Ga0207649_10218622 Ga0207649_102186222 121
218 3300025920 Ga0207649_11045538 Ga0207649_110455382 121
219 3300025921 Ga0207652_10006431 Ga0207652_100064313 121
220 3300025921 Ga0207652_10657063 Ga0207652_106570631 121
221 3300025924 Ga0207694_10000011 Ga0207694_1000001195 121
222 3300025924 Ga0207694_10045214 Ga0207694_100452142 121
223 3300025924 Ga0207694_10113373 Ga0207694_101133733 121
224 3300025924 Ga0207694_10599130 Ga0207694_105991302 121
225 3300025924 Ga0207694_10881135 Ga0207694_108811352 121
226 3300025925 Ga0207650_10626470 Ga0207650_106264701 121
227 3300025926 Ga0207659_10597747 Ga0207659_105977471 121
228 3300025926 Ga0207659_10603585 Ga0207659_106035852 121
229 3300025928 Ga0207700_10000017 Ga0207700_10000017125 121
230 3300025928 Ga0207700_10060002 Ga0207700_100600022 121
231 3300025928 Ga0207700_10405604 Ga0207700_104056042 121
232 3300025928 Ga0207700_11000926 Ga0207700_110009261 121
233 3300025928 Ga0207700_11440996 Ga0207700_114409961 121
234 3300025929 Ga0207664_10080075 Ga0207664_100800753 121
235 3300025929 Ga0207664_10112241 Ga0207664_101122414 121
236 3300025929 Ga0207664_10149492 Ga0207664_101494923 121
237 3300025931 Ga0207644_10642455 Ga0207644_106424552 121
238 3300025932 Ga0207690_10000077 Ga0207690_1000007748 121
239 3300025932 Ga0207690_10056973 Ga0207690_100569733 121
240 3300025937 Ga0207669_10307394 Ga0207669_103073942 121
241 3300025937 Ga0207669_10490947 Ga0207669_104909472 121
242 3300025938 Ga0207704_10000927 Ga0207704_1000092711 121
243 3300025939 Ga0207665_10076292 Ga0207665_100762922 121
244 3300025941 Ga0207711_10359381 Ga0207711_103593813 121
245 3300025941 Ga0207711_11208228 Ga0207711_112082281 121
246 3300025942 Ga0207689_11243166 Ga0207689_112431661 121
247 3300025944 Ga0207661_10716027 Ga0207661_107160271 121
248 3300025945 Ga0207679_10307405 Ga0207679_103074052 121
249 3300025945 Ga0207679_11215204 Ga0207679_112152042 121
250 3300025945 Ga0207679_11333648 Ga0207679_113336482 121
251 3300025949 Ga0207667_10000050 Ga0207667_10000050112 121
252 3300025949 Ga0207667_10006353 Ga0207667_100063532 121
253 3300025949 Ga0207667_10145563 Ga0207667_101455633 121
254 3300025949 Ga0207667_10631494 Ga0207667_106314942 121
255 3300025949 Ga0207667_11630794 Ga0207667_116307941 121
256 3300025960 Ga0207651_10225548 Ga0207651_102255482 121
257 3300025960 Ga0207651_10562246 Ga0207651_105622462 121
258 3300025960 Ga0207651_10935953 Ga0207651_109359532 121
259 3300025972 Ga0207668_10404298 Ga0207668_104042982 121
260 3300025981 Ga0207640_10305167 Ga0207640_103051672 121
261 3300025986 Ga0207658_10153604 Ga0207658_101536042 121
262 3300026035 Ga0207703_10078116 Ga0207703_100781162 121
263 3300026035 Ga0207703_10181062 Ga0207703_101810623 121
264 3300026041 Ga0207639_10043301 Ga0207639_100433013 121
265 3300026041 Ga0207639_10213199 Ga0207639_102131991 121
266 3300026067 Ga0207678_10046163 Ga0207678_100461634 121
267 3300026067 Ga0207678_11927529 Ga0207678_119275291 121
268 3300026078 Ga0207702_10000035 Ga0207702_10000035130 121
269 3300026078 Ga0207702_10003677 Ga0207702_1000367716 121
270 3300026078 Ga0207702_10157870 Ga0207702_101578702 121
271 3300026078 Ga0207702_10437015 Ga0207702_104370152 121
272 3300026078 Ga0207702_10457052 Ga0207702_104570522 121
273 3300026078 Ga0207702_10631769 Ga0207702_106317692 121
274 3300026088 Ga0207641_10249650 Ga0207641_102496503 121
275 3300026088 Ga0207641_10286965 Ga0207641_102869652 121
276 3300026089 Ga0207648_10157065 Ga0207648_101570652 121
277 3300026089 Ga0207648_10370426 Ga0207648_103704262 121
278 3300026089 Ga0207648_10617958 Ga0207648_106179583 121
279 3300026095 Ga0207676_11570127 Ga0207676_115701272 121
280 3300026095 Ga0207676_11916369 Ga0207676_119163691 121
281 3300026116 Ga0207674_10000003 Ga0207674_10000003200 121
282 3300026142 Ga0207698_10009173 Ga0207698_100091731 121
283 3300026142 Ga0207698_10084151 Ga0207698_100841512 121
284 3300026142 Ga0207698_10192178 Ga0207698_101921782 121
285 3300028379 Ga0268266_10397903 Ga0268266_103979031 121
286 3300028380 Ga0268265_10138661 Ga0268265_101386612 121
287 3300028380 Ga0268265_10271106 Ga0268265_102711062 121
288 3300028381 Ga0268264_11066707 Ga0268264_110667071 121
289 3300028800 Ga0265338_10008944 Ga0265338_1000894413 121
290 3300028800 Ga0265338_10929688 Ga0265338_109296881 121
291 3300028800 Ga0265338_11218414 Ga0265338_112184142 121
292 3300031238 Ga0265332_10451030 Ga0265332_104510301 121
293 3300031241 Ga0265325_10001455 Ga0265325_100014554 121
294 3300031242 Ga0265329_10117509 Ga0265329_101175092 121
295 3300031242 Ga0265329_10192458 Ga0265329_101924582 121
296 3300031247 Ga0265340_10050974 Ga0265340_100509742 121
297 3300031247 Ga0265340_10052794 Ga0265340_100527941 121
298 3300031247 Ga0265340_10365782 Ga0265340_103657821 121
299 3300031249 Ga0265339_10002890 Ga0265339_1000289013 121
300 3300031249 Ga0265339_10040781 Ga0265339_100407813 121
301 3300031250 Ga0265331_10000113 Ga0265331_10000113105 121
302 3300031250 Ga0265331_10003392 Ga0265331_1000339213 121
303 3300031251 Ga0265327_10000124 Ga0265327_10000124131 121
304 3300031251 Ga0265327_10000602 Ga0265327_1000060236 121
305 3300031456 Ga0307513_10007113 Ga0307513_1000711311 121
306 3300031548 Ga0307408_100445390 Ga0307408_1004453902 121
307 3300031595 Ga0265313_10001046 Ga0265313_1000104614 121
308 3300031711 Ga0265314_10003125 Ga0265314_100031257 121
309 3300031711 Ga0265314_10011644 Ga0265314_100116447 121
310 3300031711 Ga0265314_10027220 Ga0265314_100272202 121
311 3300031711 Ga0265314_10057677 Ga0265314_100576773 121
312 3300031730 Ga0307516_10009375 Ga0307516_100093753 121
313 3300031852 Ga0307410_10001019 Ga0307410_1000101910 121
314 3300031852 Ga0307410_11484441 Ga0307410_114844412 121
315 3300031995 Ga0307409_100454357 Ga0307409_1004543573 121
316 3300032002 Ga0307416_100477981 Ga0307416_1004779812 121
317 3300032004 Ga0307414_10127213 Ga0307414_101272132 121
318 3300032005 Ga0307411_10008168 Ga0307411_100081688 121
319 3300032126 Ga0307415_100346599 Ga0307415_1003465992 121
320 3300035170 Ga0373943_0421228 Ga0373943_0421228_379_744 121
321 3300035171 Ga0373946_0266126 Ga0373946_0266126_424_789 121
322 3300035172 Ga0373955_0229065 Ga0373955_0229065_452_817 121
323 3300035172 Ga0373955_0288347 Ga0373955_0288347_479_844 121
324 3300035691 Ga0373931_0099646 Ga0373931_0099646_826_1191 121
325 3300035692 Ga0373935_1131707 Ga0373935_1131707_134_499 121
326 3300035724 Ga0373933_0015050 Ga0373933_0015050_3666_4031 121
327 3300036401 Ga0373937_0010732 Ga0373937_0010732_3825_4190 121
328 3300036401 Ga0373937_0043098 Ga0373937_0043098_1176_1541 121
329 3300036401 Ga0373937_0760373 Ga0373937_0760373_317_682 121
330 3300037068 Ga0373925_0075500 Ga0373925_0075500_764_1135 121
331 3300039437 Ga0436365_0710801 Ga0436365_0710801_283_648 121
332 3300039437 Ga0436365_1196036 Ga0436365_1196036_19736_20104 121
333 3300039438 Ga0436360_0105778 Ga0436360_0105778_147_521 121
334 3300039453 Ga0436362_1000137 Ga0436362_1000137_686_1051 121
335 3300044673 Ga0453683_0043221 Ga0453683_0043221_1720_2091 121
336 3300044683 Ga0466965_0940081 Ga0466965_0940081_16_384 121
337 3300044693 Ga0466961_0294355 Ga0466961_0294355_68_436 121
338 3300045051 Ga0451576_0419037 Ga0451576_0419037_307_675 121
339 3300046462 Ga0495651_0450430 Ga0495651_0450430_24_404 121
340 3300046462 Ga0495651_1002434 Ga0495651_1002434_93_461 121
341 3300046472 Ga0495580_0176868 Ga0495580_0176868_1065_1430 121
342 3300046477 Ga0495664_0232101 Ga0495664_0232101_534_902 121
343 3300046506 Ga0495583_0106852 Ga0495583_0106852_459_827 121
344 3300046516 Ga0495628_0635535 Ga0495628_0635535_32_400 121
345 3300046529 Ga0495652_0050671 Ga0495652_0050671_317_697 121
346 3300046529 Ga0495652_1038637 Ga0495652_1038637_30_398 121
347 3300046531 Ga0495665_0492634 Ga0495665_0492634_194_559 121
348 3300046543 Ga0495645_0082828 Ga0495645_0082828_1171_1551 121
349 3300046616 Ga0495668_0181214 Ga0495668_0181214_68_436 121
350 3300046616 Ga0495668_0545722 Ga0495668_0545722_15_383 121
351 3300046675 Ga0495657_0410734 Ga0495657_0410734_147_515 121
352 3300047320 Ga0495672_0061602 Ga0495672_0061602_421_789 121
353 3300048905 Ga0496102_0899101 Ga0496102_0899101_342_707 121
354 3300048907 Ga0496104_0595226 Ga0496104_0595226_451_816 121
355 3300048913 Ga0496110_0565498 Ga0496110_0565498_424_789 121
356 3300048913 Ga0496110_0599862 Ga0496110_0599862_204_572 121
357 3300048914 Ga0496111_0490443 Ga0496111_0490443_133_498 121
358 3300048915 Ga0496112_0963073 Ga0496112_0963073_113_478 121
359 3300048918 Ga0496115_0008084 Ga0496115_0008084_5772_6137 121
360 3300048929 Ga0496126_0001616 Ga0496126_0001616_4660_5058 121
361 3300049460 Ga0495682_0001113 Ga0495682_0001113_5444_5812 121
362 3300049568 Ga0501031_0046855 Ga0501031_0046855_608_973 121
363 3300049568 Ga0501031_0277426 Ga0501031_0277426_182_571 121
364 3300049570 Ga0501033_0083029 Ga0501033_0083029_666_1031 121
365 3300049570 Ga0501033_0190126 Ga0501033_0190126_104_469 121
366 3300049570 Ga0501033_0635613 Ga0501033_0635613_166_555 121
367 3300049572 Ga0501036_0086025 Ga0501036_0086025_72_437 121
368 3300049573 Ga0501037_0068856 Ga0501037_0068856_1993_2358 121
369 3300049574 Ga0501038_0350187 Ga0501038_0350187_25_390 121
370 3300049575 Ga0501039_0231151 Ga0501039_0231151_659_1024 121
371 3300049579 Ga0501043_0036941 Ga0501043_0036941_391_756 121
372 3300049579 Ga0501043_0274612 Ga0501043_0274612_771_1136 121
373 3300049579 Ga0501043_0322418 Ga0501043_0322418_619_984 121
374 3300049580 Ga0501046_0017119 Ga0501046_0017119_1473_1838 121
375 3300049581 Ga0501047_0031499 Ga0501047_0031499_1961_2329 121
376 3300049581 Ga0501047_0439501 Ga0501047_0439501_576_941 121
377 3300049581 Ga0501047_0533138 Ga0501047_0533138_232_621 121
378 3300049581 Ga0501047_1081503 Ga0501047_1081503_12_380 121
379 3300049582 Ga0501048_0086002 Ga0501048_0086002_235_606 121
380 3300049583 Ga0501067_0017951 Ga0501067_0017951_1738_2106 121
381 3300049586 Ga0501070_0001669 Ga0501070_0001669_14190_14555 121
382 3300049586 Ga0501070_0013891 Ga0501070_0013891_1441_1806 121
383 3300049586 Ga0501070_0656021 Ga0501070_0656021_40_408 121
384 3300049588 Ga0501072_0126608 Ga0501072_0126608_1395_1763 121
385 3300049589 Ga0501073_0010175 Ga0501073_0010175_1330_1698 121
386 3300049590 Ga0501074_0733759 Ga0501074_0733759_212_577 121
387 3300049741 Ga0501079_0441886 Ga0501079_0441886_169_534 121
388 3300049741 Ga0501079_1652589 Ga0501079_1652589_47_415 121
389 3300049742 Ga0501080_0002174 Ga0501080_0002174_7432_7797 121
390 3300049742 Ga0501080_0043589 Ga0501080_0043589_2285_2650 121
391 3300049742 Ga0501080_0564782 Ga0501080_0564782_487_855 121
392 3300049742 Ga0501080_0843067 Ga0501080_0843067_120_491 121
393 3300049822 Ga0501035_0001772 Ga0501035_0001772_19532_19897 121
394 3300049822 Ga0501035_0079537 Ga0501035_0079537_1197_1562 121
395 3300049822 Ga0501035_0184563 Ga0501035_0184563_1237_1602 121
396 3300049823 Ga0501044_0025156 Ga0501044_0025156_4700_5065 121
397 3300049823 Ga0501044_0028306 Ga0501044_0028306_313_678 121
398 3300049823 Ga0501044_0071547 Ga0501044_0071547_2241_2606 121
399 3300049823 Ga0501044_0113246 Ga0501044_0113246_1760_2125 121
400 3300049823 Ga0501044_0747071 Ga0501044_0747071_167_532 121
401 3300049823 Ga0501044_1342384 Ga0501044_1342384_54_419 121
402 3300050496 nmdc:mga07m45_169602_c1 nmdc:mga07m45_169602_c1_890_1258 121
403 3300050512 nmdc:mga0n895_37333_c1 nmdc:mga0n895_37333_c1_2087_2452 121
404 3300050512 nmdc:mga0n895_547273_c1 nmdc:mga0n895_547273_c1_596_964 121
405 3300050512 nmdc:mga0n895_80411_c1 nmdc:mga0n895_80411_c1_566_931 121
406 3300050514 nmdc:mga08x19_32544_c1 nmdc:mga08x19_32544_c1_962_1327 121
407 3300050514 nmdc:mga08x19_561_c1 nmdc:mga08x19_561_c1_7651_8016 121
408 3300053078 Ga0495612_0268570 Ga0495612_0268570_240_605 121
409 3300053096 Ga0500641_0007331 Ga0500641_0007331_3377_3784 121
410 3300053096 Ga0500641_0091144 Ga0500641_0091144_394_762 121
411 3300053103 Ga0500555_069334 Ga0500555_069334_229_597 121
412 3300053108 Ga0500562_001120 Ga0500562_001120_73_441 121
413 3300053108 Ga0500562_002637 Ga0500562_002637_3526_3924 121
414 3300053119 Ga0500595_008445 Ga0500595_008445_346_711 121
415 3300053133 Ga0500655_002595 Ga0500655_002595_1318_1686 121
416 3300053133 Ga0500655_014636 Ga0500655_014636_921_1289 121
417 3300054114 Ga0501084_0530297 Ga0501084_0530297_122_490 121
418 3300060353 Ga0501082_0247725 Ga0501082_0247725_75_443 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07110

EthD

EthD domain

26

122

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jdj-assembly1.cif.gz_A crystal structure of hapk from hahella chejuensis 0.7431 1 117
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7413 1 117
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.74 1 118
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.7333 1 118
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7302 1 117
ID Description Score Start End Superfamily
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7294 1 118 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7262 2 114 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7229 1 118 3.30.70.100
3bn7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.713 1 116 3.30.70.100
3bn7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7071 1 116 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2V6WIL8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9922 1 121 GO:0016491
AF-A0A2V6WIL8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9841 1 121 GO:0016491
AF-A0A317DZP8-F1-model_v4 EthD family reductase 0.9735 2 121 GO:0016491
AF-A0A3L8AYX5-F1-model_v4 EthD family reductase 0.9723 1 120 GO:0016491
AF-A0A0M3AJU8-F1-model_v4 EthD domain-containing protein 0.9719 2 120 GO:0016491

Feature Viewer

pLDDT pTM Quality
96.76 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map