F439256

General Info

Members Datasets Scaffolds Average Seq Length
418 222 836 229

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100280147|Ga0068852_1002801472
Length 246
Sequence MTGAAASPPISLREDFREILRLVRPGARVLDVGCGEGELLELLTREKRIDGQGLEISQAGVAACLAKGLAVVQGDGDRDLDHFPTQSFDYAVLSKTLQQMREPAHVLSELLRIADQAVVSLPNFGHWRMRWALLTTGRMPETRALPDPWWSTPNIHLCTLRDFTELCRELDLRIDACAALSGGKAARPIDPEQPLENWRSETALFLLSRRDAGPRAAAPVDLFGQAAAEPPQAAMSKRRTRTKAKA

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
183 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
186 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
194 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
201 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
202 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
205 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
206 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
207 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
208 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
209 2643221584 Caulobacter sp. Root656 Isolate Unclassified
210 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
211 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
212 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
213 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
214 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
215 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
216 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
217 2849560528 Caulobacter zeae 410 Isolate Unclassified
218 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
219 2851153111 Caulobacter radicis 736 Isolate Unclassified
220 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
221 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
222 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.18
Nodule 0
Rhizoplane 3.35
Rhizosphere 70.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100280147 3300005616 Bacteria 1607
2 JGI25153J46596_10024156 3300003215 Bacteria 2196
3 JGI25153J46596_10031996 3300003215 Bacteria 1761
4 Ga0055537_1002154 3300003773 Bacteria 6877
5 Ga0055524_1004327 3300003775 Bacteria 6582
6 Ga0055536_1000576 3300003781 Bacteria 25026
7 Ga0055536_1000606 3300003781 Bacteria 24402
8 Ga0055528_1029017 3300003790 Bacteria 1510
9 Ga0055530_10001308 3300003791 Bacteria 18734
10 Ga0055530_10016353 3300003791 Bacteria 2375
11 Ga0055531_10000294 3300003794 Bacteria 49839
12 Ga0065165_1001939 3300005262 Bacteria 19705
13 Ga0070658_10029604 3300005327 Bacteria 4399
14 Ga0070658_10068855 3300005327 Bacteria 2894
15 Ga0070658_10130515 3300005327 Bacteria 2094
16 Ga0070670_100000013 3300005331 Bacteria 250768
17 Ga0070670_100052230 3300005331 Bacteria 3510
18 Ga0070670_100266985 3300005331 Bacteria 1492
19 Ga0070670_100791635 3300005331 Bacteria 856
20 Ga0070666_10056235 3300005335 Bacteria 2657
21 Ga0070680_100003427 3300005336 Bacteria 11841
22 Ga0070680_100042468 3300005336 Bacteria 3690
23 Ga0070680_100442742 3300005336 Bacteria 1109
24 Ga0068868_100737221 3300005338 Bacteria 884
25 Ga0070660_100023294 3300005339 Bacteria 4587
26 Ga0070660_100090360 3300005339 Bacteria 2414
27 Ga0070691_10004606 3300005341 Bacteria 6265
28 Ga0070661_100212010 3300005344 Bacteria 1483
29 Ga0070668_100000042 3300005347 Bacteria 78694
30 Ga0070668_100000445 3300005347 Bacteria 27359
31 Ga0070668_100001526 3300005347 Bacteria 16698
32 Ga0070668_100001741 3300005347 Bacteria 15835
33 Ga0070668_100020137 3300005347 Bacteria 5030
34 Ga0070668_100034371 3300005347 Bacteria 3862
35 Ga0070669_100018780 3300005353 Bacteria 4942
36 Ga0070669_100048139 3300005353 Bacteria 3111
37 Ga0070671_100003043 3300005355 Bacteria 13045
38 Ga0070671_100348572 3300005355 Bacteria 1264
39 Ga0070659_100001728 3300005366 Bacteria 15682
40 Ga0070659_100003148 3300005366 Bacteria 11755
41 Ga0070659_100006630 3300005366 Bacteria 8365
42 Ga0070667_100000168 3300005367 Bacteria 81935
43 Ga0070667_100060263 3300005367 Bacteria 3211
44 Ga0070667_100191814 3300005367 Bacteria 1810
45 Ga0070667_100260000 3300005367 Bacteria 1554
46 Ga0070663_100115969 3300005455 Bacteria 2018
47 Ga0070681_10005916 3300005458 Bacteria 11836
48 Ga0070681_10094612 3300005458 Bacteria 2936
49 Ga0070679_100007487 3300005530 Bacteria 10209
50 Ga0070679_100015567 3300005530 Bacteria 7308
51 Ga0070679_100380197 3300005530 Bacteria 1359
52 Ga0068853_100034565 3300005539 Bacteria 4291
53 Ga0068853_100094154 3300005539 Bacteria 2639
54 Ga0068853_100204706 3300005539 Bacteria 1797
55 Ga0070665_100000058 3300005548 Bacteria 225040
56 Ga0070665_100000363 3300005548 Bacteria 67699
57 Ga0070665_100000638 3300005548 Bacteria 47589
58 Ga0070665_100042907 3300005548 Bacteria 4547
59 Ga0070665_100144147 3300005548 Bacteria 2385
60 Ga0068855_100015559 3300005563 Bacteria 9158
61 Ga0068855_100029515 3300005563 Bacteria 6554
62 Ga0070664_100114142 3300005564 Bacteria 2360
63 Ga0068857_100522397 3300005577 Bacteria 1116
64 Ga0068854_100215713 3300005578 Bacteria 1516
65 Ga0068856_100262497 3300005614 Bacteria 1742
66 Ga0068856_101011068 3300005614 Bacteria 850
67 Ga0068859_100001153 3300005617 Bacteria 26984
68 Ga0068859_100014592 3300005617 Bacteria 7891
69 Ga0068859_100171493 3300005617 Bacteria 2251
70 Ga0068864_100000067 3300005618 Bacteria 115834
71 Ga0068864_100000135 3300005618 Bacteria 71759
72 Ga0068864_100060726 3300005618 Bacteria 3273
73 Ga0068864_100066853 3300005618 Bacteria 3121
74 Ga0068864_100303018 3300005618 Bacteria 1496
75 Ga0068861_100076127 3300005719 Bacteria 2614
76 Ga0068861_100209311 3300005719 Bacteria 1642
77 Ga0068863_100000735 3300005841 Bacteria 32827
78 Ga0068863_100838664 3300005841 Bacteria 918
79 Ga0068858_100000020 3300005842 Bacteria 175896
80 Ga0068858_100001260 3300005842 Bacteria 26205
81 Ga0068858_100003007 3300005842 Bacteria 16907
82 Ga0068858_100046403 3300005842 Bacteria 4027
83 Ga0068860_100000133 3300005843 Bacteria 120382
84 Ga0068860_100000382 3300005843 Bacteria 58081
85 Ga0068860_100067464 3300005843 Bacteria 3399
86 Ga0068860_100211903 3300005843 Bacteria 1879
87 Ga0068862_100000167 3300005844 Bacteria 72865
88 Ga0068862_100000463 3300005844 Bacteria 43942
89 Ga0068862_100114267 3300005844 Bacteria 2373
90 Ga0068862_100252862 3300005844 Bacteria 1607
91 Ga0068862_100593477 3300005844 Bacteria 1062
92 Ga0075368_10004105 3300006042 Bacteria 4901
93 Ga0075363_100072499 3300006048 Bacteria 1873
94 Ga0075364_10010559 3300006051 Bacteria 5583
95 Ga0075367_10102445 3300006178 Bacteria 1751
96 Ga0075369_10194897 3300006186 Bacteria 934
97 Ga0097620_100001153 3300006931 Bacteria 26984
98 Ga0097620_100014592 3300006931 Bacteria 7891
99 Ga0097620_100171496 3300006931 Bacteria 2251
100 Ga0105240_10023517 3300009093 Bacteria 8145
101 Ga0105240_10033200 3300009093 Bacteria 6671
102 Ga0105240_10099619 3300009093 Bacteria 3537
103 Ga0105240_10151338 3300009093 Bacteria 2763
104 Ga0105240_10308066 3300009093 Bacteria 1809
105 Ga0105242_10855499 3300009176 Bacteria 905
106 Ga0105248_10003656 3300009177 Bacteria 17065
107 Ga0105248_10059679 3300009177 Bacteria 4285
108 Ga0105248_10086324 3300009177 Bacteria 3531
109 Ga0105248_10217226 3300009177 Bacteria 2153
110 Ga0105248_11022878 3300009177 Bacteria 933
111 Ga0105249_10000610 3300009553 Bacteria 32602
112 Ga0105249_10256678 3300009553 Bacteria 1735
113 Ga0105249_10321817 3300009553 Bacteria 1558
114 Ga0105249_11183326 3300009553 Bacteria 835
115 Ga0105239_10269501 3300010375 Bacteria 1915
116 Ga0105239_10450440 3300010375 Bacteria 1460
117 Ga0157370_10169041 3300013104 Bacteria 2033
118 Ga0163162_10033632 3300013306 Bacteria 5096
119 Ga0163162_10045463 3300013306 Bacteria 4398
120 Ga0157375_10073232 3300013308 Bacteria 3444
121 Ga0163163_10005735 3300014325 Bacteria 10771
122 Ga0157379_10006372 3300014968 Bacteria 10164
123 Ga0157379_10009076 3300014968 Bacteria 8665
124 Ga0163161_10122449 3300017792 Bacteria 1956
125 Ga0213872_10103097 3300021361 Bacteria 1270
126 Ga0213876_10040874 3300021384 Bacteria 2450
127 Ga0213875_10153602 3300021388 Bacteria 1079
128 Ga0209565_1000324 3300025263 Bacteria 42921
129 Ga0209673_1003485 3300025273 Bacteria 9234
130 Ga0209676_1000295 3300025292 Bacteria 100711
131 Ga0209676_1000392 3300025292 Bacteria 79950
132 Ga0209564_1022970 3300025295 Bacteria 2183
133 Ga0209564_1044168 3300025295 Bacteria 1160
134 Ga0209758_1000779 3300025297 Bacteria 45780
135 Ga0209758_1003218 3300025297 Bacteria 15211
136 Ga0209050_1000362 3300025298 Bacteria 87030
137 Ga0209050_1000411 3300025298 Bacteria 79805
138 Ga0209050_1003869 3300025298 Bacteria 10634
139 Ga0209256_1001012 3300025299 Bacteria 33185
140 Ga0209256_1005802 3300025299 Bacteria 6883
141 Ga0209256_1009806 3300025299 Bacteria 4123
142 Ga0209051_1004334 3300025303 Bacteria 8801
143 Ga0209257_1000513 3300025304 Bacteria 67348
144 Ga0209257_1002416 3300025304 Bacteria 18671
145 Ga0209257_1006529 3300025304 Bacteria 7456
146 Ga0207705_10002914 3300025909 Bacteria 13075
147 Ga0207705_10134399 3300025909 Bacteria 1843
148 Ga0207707_10010982 3300025912 Bacteria 7879
149 Ga0207707_10048404 3300025912 Bacteria 3703
150 Ga0207707_10118004 3300025912 Bacteria 2319
151 Ga0207695_10001207 3300025913 Bacteria 44318
152 Ga0207695_10001235 3300025913 Bacteria 43771
153 Ga0207695_10016152 3300025913 Bacteria 8755
154 Ga0207695_10071118 3300025913 Bacteria 3553
155 Ga0207660_10001064 3300025917 Bacteria 18216
156 Ga0207660_10045389 3300025917 Bacteria 3096
157 Ga0207657_10005103 3300025919 Bacteria 13756
158 Ga0207657_10030675 3300025919 Bacteria 4878
159 Ga0207649_10133394 3300025920 Bacteria 1690
160 Ga0207652_10004084 3300025921 Bacteria 11911
161 Ga0207652_10084545 3300025921 Bacteria 2780
162 Ga0207681_10077138 3300025923 Bacteria 2342
163 Ga0207681_10104480 3300025923 Bacteria 2049
164 Ga0207650_10000016 3300025925 Bacteria 361958
165 Ga0207650_10084191 3300025925 Bacteria 2417
166 Ga0207644_10002697 3300025931 Bacteria 11439
167 Ga0207644_10207355 3300025931 Bacteria 1548
168 Ga0207690_10000077 3300025932 Bacteria 85018
169 Ga0207690_10002585 3300025932 Bacteria 10931
170 Ga0207690_10041687 3300025932 Bacteria 3010
171 Ga0207711_10025718 3300025941 Bacteria 4936
172 Ga0207711_10030112 3300025941 Bacteria 4578
173 Ga0207711_10250226 3300025941 Bacteria 1627
174 Ga0207711_10457235 3300025941 Bacteria 1189
175 Ga0207711_10598658 3300025941 Bacteria 1029
176 Ga0207679_10212588 3300025945 Bacteria 1623
177 Ga0207667_10006652 3300025949 Bacteria 13971
178 Ga0207667_10053584 3300025949 Bacteria 4244
179 Ga0207667_10292672 3300025949 Bacteria 1664
180 Ga0207712_10000641 3300025961 Bacteria 27375
181 Ga0207712_10126699 3300025961 Bacteria 1939
182 Ga0207712_10228016 3300025961 Bacteria 1493
183 Ga0207712_10268656 3300025961 Bacteria 1386
184 Ga0207668_10000002 3300025972 Bacteria 209163
185 Ga0207668_10000401 3300025972 Bacteria 27305
186 Ga0207668_10000936 3300025972 Bacteria 17552
187 Ga0207668_10002504 3300025972 Bacteria 10728
188 Ga0207668_10011205 3300025972 Bacteria 5442
189 Ga0207640_10157770 3300025981 Bacteria 1675
190 Ga0207658_10000399 3300025986 Bacteria 41904
191 Ga0207658_10006383 3300025986 Bacteria 8051
192 Ga0207658_10016082 3300025986 Bacteria 5139
193 Ga0207658_10298830 3300025986 Bacteria 1386
194 Ga0207658_10492221 3300025986 Bacteria 1091
195 Ga0207703_10000082 3300026035 Bacteria 110579
196 Ga0207703_10004006 3300026035 Bacteria 12195
197 Ga0207703_10010904 3300026035 Bacteria 7084
198 Ga0207703_10038738 3300026035 Bacteria 3807
199 Ga0207703_10357971 3300026035 Bacteria 1345
200 Ga0207678_10123128 3300026067 Bacteria 2213
201 Ga0207702_10234986 3300026078 Bacteria 1715
202 Ga0207702_10597421 3300026078 Bacteria 1083
203 Ga0207702_10993508 3300026078 Bacteria 832
204 Ga0207641_10000007 3300026088 Bacteria 441443
205 Ga0207641_10001614 3300026088 Bacteria 21995
206 Ga0207641_10004115 3300026088 Bacteria 12681
207 Ga0207641_10042480 3300026088 Bacteria 3814
208 Ga0207641_10119842 3300026088 Bacteria 2346
209 Ga0207676_10000191 3300026095 Bacteria 53466
210 Ga0207676_10019470 3300026095 Bacteria 4952
211 Ga0207676_10040773 3300026095 Bacteria 3560
212 Ga0207676_10051019 3300026095 Bacteria 3228
213 Ga0207674_10652085 3300026116 Bacteria 1017
214 Ga0207675_100012562 3300026118 Bacteria 7911
215 Ga0207675_100793121 3300026118 Bacteria 960
216 Ga0207675_100829736 3300026118 Bacteria 939
217 Ga0207683_10074908 3300026121 Bacteria 2995
218 Ga0207698_10169587 3300026142 Bacteria 1920
219 Ga0207698_10381132 3300026142 Bacteria 1342
220 Ga0268266_10000005 3300028379 Bacteria 1448194
221 Ga0268266_10004298 3300028379 Bacteria 13714
222 Ga0268266_10009515 3300028379 Bacteria 8552
223 Ga0268266_10678865 3300028379 Bacteria 992
224 Ga0268265_10000178 3300028380 Bacteria 76275
225 Ga0268265_10035886 3300028380 Bacteria 3627
226 Ga0268265_10071511 3300028380 Bacteria 2702
227 Ga0268265_10228808 3300028380 Bacteria 1632
228 Ga0268265_10705021 3300028380 Bacteria 975
229 Ga0268264_10000008 3300028381 Bacteria 773387
230 Ga0268264_10001205 3300028381 Bacteria 24897
231 Ga0268264_10018464 3300028381 Bacteria 5703
232 Ga0268264_10034431 3300028381 Bacteria 4166
233 Ga0268264_10717429 3300028381 Bacteria 994
234 Ga0307517_10045118 3300028786 Bacteria 4641
235 Ga0307515_10139640 3300028794 Bacteria 2608
236 Ga0265327_10001677 3300031251 Bacteria 26559
237 Ga0307513_10000077 3300031456 Bacteria 134167
238 Ga0307513_10002125 3300031456 Bacteria 27813
239 Ga0307513_10005206 3300031456 Bacteria 17241
240 Ga0307508_10207656 3300031616 Bacteria 1559
241 Ga0307516_10000001 3300031730 Bacteria 510338
242 Ga0307411_10177564 3300032005 Bacteria 1613
243 Ga0307510_10106131 3300033180 Bacteria 2574
244 Ga0307510_10196046 3300033180 Bacteria 1561
245 Ga0373936_0003022 3300035113 Bacteria 6287
246 Ga0395899_0104979 3300037312 Bacteria 2036
247 Ga0395900_0464224 3300037418 Bacteria 1220
248 Ga0395898_0570010 3300037466 Bacteria 1074
249 Ga0395905_0252116 3300037471 Bacteria 1649
250 Ga0395905_0323369 3300037471 Bacteria 1432
251 Ga0395905_0366661 3300037471 Bacteria 1333
252 Ga0395905_0406639 3300037471 Bacteria 1256
253 Ga0395901_0012954 3300038443 Bacteria 8460
254 Ga0395901_0228345 3300038443 Bacteria 1944
255 Ga0436365_0248244 3300039437 Bacteria 2461
256 Ga0436361_0799712 3300039447 Bacteria 22208
257 Ga0439465_0013590 3300041413 Bacteria 2536
258 Ga0451853_2849604 3300041512 Bacteria 1290
259 Ga0466961_0219300 3300044693 Bacteria 1173
260 Ga0495629_0009552 3300046459 Bacteria 7088
261 Ga0495638_0000884 3300046460 Bacteria 30806
262 Ga0495638_0001082 3300046460 Bacteria 26547
263 Ga0495638_0011795 3300046460 Bacteria 6016
264 Ga0495638_0076433 3300046460 Bacteria 2040
265 Ga0495650_0000046 3300046471 Bacteria 342987
266 Ga0495585_0089436 3300046492 Bacteria 1660
267 Ga0495583_0000003 3300046506 Bacteria 709273
268 Ga0495610_0000779 3300046512 Bacteria 29994
269 Ga0495610_0003404 3300046512 Bacteria 12414
270 Ga0495616_0000473 3300046513 Bacteria 30543
271 Ga0495616_0017364 3300046513 Bacteria 3970
272 Ga0495620_0013580 3300046515 Bacteria 4166
273 Ga0495620_0031039 3300046515 Bacteria 2452
274 Ga0495632_0003085 3300046519 Bacteria 12087
275 Ga0495632_0093430 3300046519 Bacteria 1423
276 Ga0495637_0001422 3300046520 Bacteria 14112
277 Ga0495643_0029286 3300046522 Bacteria 3082
278 Ga0495643_0101183 3300046522 Bacteria 1477
279 Ga0495643_0133777 3300046522 Bacteria 1243
280 Ga0495644_0134832 3300046523 Bacteria 942
281 Ga0495648_0000066 3300046524 Bacteria 140767
282 Ga0495648_0040202 3300046524 Bacteria 2968
283 Ga0495648_0063498 3300046524 Bacteria 2180
284 Ga0495642_0011894 3300046528 Bacteria 3352
285 Ga0495642_0024411 3300046528 Bacteria 2391
286 Ga0495654_0000023 3300046530 Bacteria 243798
287 Ga0495654_0049666 3300046530 Bacteria 2054
288 Ga0495609_0038043 3300046538 Bacteria 2170
289 Ga0495597_0060985 3300046542 Bacteria 1644
290 Ga0495597_0263557 3300046542 Bacteria 674
291 Ga0495668_0005347 3300046616 Bacteria 8756
292 Ga0495668_0008691 3300046616 Bacteria 6312
293 Ga0495668_0014733 3300046616 Bacteria 4578
294 Ga0495668_0091782 3300046616 Bacteria 1664
295 Ga0495668_0277269 3300046616 Bacteria 918
296 Ga0495611_0008182 3300046648 Bacteria 4436
297 Ga0495625_0001472 3300046660 Bacteria 28466
298 Ga0495625_0011015 3300046660 Bacteria 7418
299 Ga0495625_0107598 3300046660 Bacteria 1908
300 Ga0495625_0354530 3300046660 Bacteria 926
301 Ga0495659_0058848 3300046664 Bacteria 1415
302 Ga0495669_0000002 3300046684 Bacteria 282777
303 Ga0495669_0009146 3300046684 Bacteria 4174
304 Ga0495669_0046846 3300046684 Bacteria 1930
305 Ga0495669_0073573 3300046684 Bacteria 1561
306 Ga0495670_0087361 3300046691 Bacteria 1593
307 Ga0495671_0028071 3300046692 Bacteria 2902
308 Ga0495671_0317118 3300046692 Bacteria 749
309 Ga0495660_0012126 3300046810 Bacteria 5001
310 Ga0495581_0109239 3300047315 Bacteria 1608
311 Ga0495672_0000311 3300047320 Bacteria 65012
312 Ga0495683_0086311 3300047323 Bacteria 1525
313 Ga0495677_0013716 3300047445 Bacteria 2949
314 Ga0495679_013323 3300047446 Bacteria 3094
315 Ga0495673_0000710 3300047469 Bacteria 32297
316 Ga0495673_0001008 3300047469 Bacteria 24918
317 Ga0495681_0043583 3300047470 Bacteria 2162
318 Ga0495681_0057281 3300047470 Bacteria 1810
319 Ga0495686_0011532 3300047472 Bacteria 6225
320 Ga0495686_0028160 3300047472 Bacteria 3660
321 Ga0495686_0067895 3300047472 Bacteria 2200
322 Ga0495686_0078038 3300047472 Bacteria 2027
323 Ga0495686_0251514 3300047472 Bacteria 993
324 Ga0496100_0342364 3300048903 Bacteria 1128
325 Ga0496102_0019937 3300048905 Bacteria 5915
326 Ga0496103_0210981 3300048906 Bacteria 1249
327 Ga0496104_0141812 3300048907 Bacteria 2309
328 Ga0496106_0015925 3300048909 Bacteria 5561
329 Ga0496107_0000112 3300048910 Bacteria 39450
330 Ga0496108_0686688 3300048911 Bacteria 888
331 Ga0496109_0039706 3300048912 Bacteria 4261
332 Ga0496112_0097281 3300048915 Bacteria 2914
333 Ga0496112_0181416 3300048915 Bacteria 2069
334 Ga0496113_0533679 3300048916 Bacteria 942
335 Ga0496115_0004474 3300048918 Bacteria 10116
336 Ga0496115_0009878 3300048918 Bacteria 7105
337 Ga0496115_0036586 3300048918 Bacteria 3888
338 Ga0496117_0011384 3300048920 Bacteria 7970
339 Ga0496118_0004288 3300048921 Bacteria 17062
340 Ga0496121_0000035 3300048924 Bacteria 374316
341 Ga0496121_0001796 3300048924 Bacteria 34668
342 Ga0496121_0292447 3300048924 Bacteria 1109
343 Ga0496124_0014384 3300048927 Bacteria 7651
344 Ga0496126_0004925 3300048929 Bacteria 15584
345 Ga0496126_0375305 3300048929 Bacteria 1159
346 Ga0501033_0002814 3300049570 Bacteria 14559
347 Ga0501033_0009084 3300049570 Bacteria 7669
348 Ga0501034_0007932 3300049571 Bacteria 11278
349 Ga0501037_0287530 3300049573 Bacteria 1144
350 Ga0501043_0041181 3300049579 Bacteria 3630
351 Ga0501047_0002235 3300049581 Bacteria 18535
352 Ga0501047_0111569 3300049581 Bacteria 2617
353 Ga0501047_0246918 3300049581 Bacteria 1634
354 Ga0501047_0669518 3300049581 Bacteria 856
355 Ga0501044_0008351 3300049823 Bacteria 11351
356 Ga0501044_0011677 3300049823 Bacteria 9519
357 Ga0501044_0239206 3300049823 Bacteria 1760
358 Ga0501044_0467870 3300049823 Bacteria 1165
359 Ga0501044_0811370 3300049823 Bacteria 814
360 nmdc:mga00v17_1616_c1 3300050491 Bacteria 11777
361 nmdc:mga06z11_141924_c1 3300050494 Bacteria 1359
362 nmdc:mga07m45_6207_c1 3300050496 Bacteria 6031
363 nmdc:mga0sz30_107581_c1 3300050516 Bacteria 1220
364 Ga0500635_0000133 3300053080 Bacteria 42884
365 Ga0500644_0000084 3300053088 Bacteria 57829
366 Ga0500583_0151188 3300053092 Bacteria 1155
367 Ga0500651_0237573 3300053093 Bacteria 1064
368 Ga0500566_0116957 3300053094 Bacteria 1442
369 Ga0500554_001287 3300053102 Bacteria 4864
370 Ga0500555_001169 3300053103 Bacteria 8613
371 Ga0500556_0000314 3300053104 Bacteria 36676
372 Ga0500562_000327 3300053108 Bacteria 11496
373 Ga0500562_043711 3300053108 Bacteria 1193
374 Ga0500569_009406 3300053109 Bacteria 2270
375 Ga0500595_005961 3300053119 Bacteria 5246
376 Ga0500608_000831 3300053122 Bacteria 11161
377 Ga0500618_000092 3300053125 Bacteria 73216
378 Ga0500642_0025648 3300053130 Bacteria 2396
379 Ga0500658_0002597 3300053134 Bacteria 6976
380 Ga0500559_0000046 3300053136 Bacteria 98853
381 Ga0500559_0001854 3300053136 Bacteria 11523
382 Ga0500559_0002680 3300053136 Bacteria 9060
383 Ga0500559_0011386 3300053136 Bacteria 3800
384 Ga0500564_000080 3300053138 Bacteria 24788
385 Ga0500590_010870 3300053148 Bacteria 4603
386 Ga0500616_0068741 3300053153 Bacteria 1813
387 Ga0500616_0120808 3300053153 Bacteria 1252
388 Ga0500619_044307 3300053154 Bacteria 1418
389 Ga0500622_0005190 3300053156 Bacteria 7889
390 Ga0500622_0010791 3300053156 Bacteria 4997
391 Ga0500622_0018551 3300053156 Bacteria 3699
392 Ga0500624_004743 3300053157 Bacteria 1796
393 Ga0500627_0051129 3300053158 Bacteria 1801
394 Ga0500638_063286 3300053162 Bacteria 1775
395 Ga0500637_0001963 3300053178 Bacteria 8938
396 Ga0500637_0043423 3300053178 Bacteria 2544
397 Ga0500611_001212 3300053727 Bacteria 2765
398 Ga0500645_001187 3300053730 Bacteria 13857
399 Ga0500645_004400 3300053730 Bacteria 5415
400 Ga0500609_009655 3300053731 Bacteria 1300
401 Ga0500661_041813 3300055283 Bacteria 812
402 2511122619 2510917020 Bacteria 5657507
403 2585148012 2582581279 Bacteria 4980720
404 2643749142 2643221545 Bacteria 5083237
405 2643930918 2643221584 Bacteria 5511711
406 2644000550 2643221598 Bacteria 4578346
407 2644088684 2643221614 Bacteria 4260023
408 2644343919 2643221661 Bacteria 4267604
409 2644368602 2643221666 Bacteria 4265935
410 2644509083 2643221691 Bacteria 5093099
411 2792460446 2791355048 Bacteria 5832535
412 2843745134 2843744320 Bacteria 5659202
413 2849564075 2849560528 Bacteria 5393480
414 2849577376 2849573788 Bacteria 5421256
415 2851155208 2851153111 Bacteria 5542585
416 2857508649 2857504554 Bacteria 5369913
417 2884961446 2884960567 Bacteria 5437054
418 2898331183 2898329390 Bacteria 5168154
419 Ga0068852_100280147
420 JGI25153J46596_10024156
421 JGI25153J46596_10031996
422 Ga0055537_1002154
423 Ga0055524_1004327
424 Ga0055536_1000576
425 Ga0055536_1000606
426 Ga0055528_1029017
427 Ga0055530_10001308
428 Ga0055530_10016353
429 Ga0055531_10000294
430 Ga0065165_1001939
431 Ga0070658_10029604
432 Ga0070658_10068855
433 Ga0070658_10130515
434 Ga0070670_100000013
435 Ga0070670_100052230
436 Ga0070670_100266985
437 Ga0070670_100791635
438 Ga0070666_10056235
439 Ga0070680_100003427
440 Ga0070680_100042468
441 Ga0070680_100442742
442 Ga0068868_100737221
443 Ga0070660_100023294
444 Ga0070660_100090360
445 Ga0070691_10004606
446 Ga0070661_100212010
447 Ga0070668_100000042
448 Ga0070668_100000445
449 Ga0070668_100001526
450 Ga0070668_100001741
451 Ga0070668_100020137
452 Ga0070668_100034371
453 Ga0070669_100018780
454 Ga0070669_100048139
455 Ga0070671_100003043
456 Ga0070671_100348572
457 Ga0070659_100001728
458 Ga0070659_100003148
459 Ga0070659_100006630
460 Ga0070667_100000168
461 Ga0070667_100060263
462 Ga0070667_100191814
463 Ga0070667_100260000
464 Ga0070663_100115969
465 Ga0070681_10005916
466 Ga0070681_10094612
467 Ga0070679_100007487
468 Ga0070679_100015567
469 Ga0070679_100380197
470 Ga0068853_100034565
471 Ga0068853_100094154
472 Ga0068853_100204706
473 Ga0070665_100000058
474 Ga0070665_100000363
475 Ga0070665_100000638
476 Ga0070665_100042907
477 Ga0070665_100144147
478 Ga0068855_100015559
479 Ga0068855_100029515
480 Ga0070664_100114142
481 Ga0068857_100522397
482 Ga0068854_100215713
483 Ga0068856_100262497
484 Ga0068856_101011068
485 Ga0068859_100001153
486 Ga0068859_100014592
487 Ga0068859_100171493
488 Ga0068864_100000067
489 Ga0068864_100000135
490 Ga0068864_100060726
491 Ga0068864_100066853
492 Ga0068864_100303018
493 Ga0068861_100076127
494 Ga0068861_100209311
495 Ga0068863_100000735
496 Ga0068863_100838664
497 Ga0068858_100000020
498 Ga0068858_100001260
499 Ga0068858_100003007
500 Ga0068858_100046403
501 Ga0068860_100000133
502 Ga0068860_100000382
503 Ga0068860_100067464
504 Ga0068860_100211903
505 Ga0068862_100000167
506 Ga0068862_100000463
507 Ga0068862_100114267
508 Ga0068862_100252862
509 Ga0068862_100593477
510 Ga0075368_10004105
511 Ga0075363_100072499
512 Ga0075364_10010559
513 Ga0075367_10102445
514 Ga0075369_10194897
515 Ga0097620_100001153
516 Ga0097620_100014592
517 Ga0097620_100171496
518 Ga0105240_10023517
519 Ga0105240_10033200
520 Ga0105240_10099619
521 Ga0105240_10151338
522 Ga0105240_10308066
523 Ga0105242_10855499
524 Ga0105248_10003656
525 Ga0105248_10059679
526 Ga0105248_10086324
527 Ga0105248_10217226
528 Ga0105248_11022878
529 Ga0105249_10000610
530 Ga0105249_10256678
531 Ga0105249_10321817
532 Ga0105249_11183326
533 Ga0105239_10269501
534 Ga0105239_10450440
535 Ga0157370_10169041
536 Ga0163162_10033632
537 Ga0163162_10045463
538 Ga0157375_10073232
539 Ga0163163_10005735
540 Ga0157379_10006372
541 Ga0157379_10009076
542 Ga0163161_10122449
543 Ga0213872_10103097
544 Ga0213876_10040874
545 Ga0213875_10153602
546 Ga0209565_1000324
547 Ga0209673_1003485
548 Ga0209676_1000295
549 Ga0209676_1000392
550 Ga0209564_1022970
551 Ga0209564_1044168
552 Ga0209758_1000779
553 Ga0209758_1003218
554 Ga0209050_1000362
555 Ga0209050_1000411
556 Ga0209050_1003869
557 Ga0209256_1001012
558 Ga0209256_1005802
559 Ga0209256_1009806
560 Ga0209051_1004334
561 Ga0209257_1000513
562 Ga0209257_1002416
563 Ga0209257_1006529
564 Ga0207705_10002914
565 Ga0207705_10134399
566 Ga0207707_10010982
567 Ga0207707_10048404
568 Ga0207707_10118004
569 Ga0207695_10001207
570 Ga0207695_10001235
571 Ga0207695_10016152
572 Ga0207695_10071118
573 Ga0207660_10001064
574 Ga0207660_10045389
575 Ga0207657_10005103
576 Ga0207657_10030675
577 Ga0207649_10133394
578 Ga0207652_10004084
579 Ga0207652_10084545
580 Ga0207681_10077138
581 Ga0207681_10104480
582 Ga0207650_10000016
583 Ga0207650_10084191
584 Ga0207644_10002697
585 Ga0207644_10207355
586 Ga0207690_10000077
587 Ga0207690_10002585
588 Ga0207690_10041687
589 Ga0207711_10025718
590 Ga0207711_10030112
591 Ga0207711_10250226
592 Ga0207711_10457235
593 Ga0207711_10598658
594 Ga0207679_10212588
595 Ga0207667_10006652
596 Ga0207667_10053584
597 Ga0207667_10292672
598 Ga0207712_10000641
599 Ga0207712_10126699
600 Ga0207712_10228016
601 Ga0207712_10268656
602 Ga0207668_10000002
603 Ga0207668_10000401
604 Ga0207668_10000936
605 Ga0207668_10002504
606 Ga0207668_10011205
607 Ga0207640_10157770
608 Ga0207658_10000399
609 Ga0207658_10006383
610 Ga0207658_10016082
611 Ga0207658_10298830
612 Ga0207658_10492221
613 Ga0207703_10000082
614 Ga0207703_10004006
615 Ga0207703_10010904
616 Ga0207703_10038738
617 Ga0207703_10357971
618 Ga0207678_10123128
619 Ga0207702_10234986
620 Ga0207702_10597421
621 Ga0207702_10993508
622 Ga0207641_10000007
623 Ga0207641_10001614
624 Ga0207641_10004115
625 Ga0207641_10042480
626 Ga0207641_10119842
627 Ga0207676_10000191
628 Ga0207676_10019470
629 Ga0207676_10040773
630 Ga0207676_10051019
631 Ga0207674_10652085
632 Ga0207675_100012562
633 Ga0207675_100793121
634 Ga0207675_100829736
635 Ga0207683_10074908
636 Ga0207698_10169587
637 Ga0207698_10381132
638 Ga0268266_10000005
639 Ga0268266_10004298
640 Ga0268266_10009515
641 Ga0268266_10678865
642 Ga0268265_10000178
643 Ga0268265_10035886
644 Ga0268265_10071511
645 Ga0268265_10228808
646 Ga0268265_10705021
647 Ga0268264_10000008
648 Ga0268264_10001205
649 Ga0268264_10018464
650 Ga0268264_10034431
651 Ga0268264_10717429
652 Ga0307517_10045118
653 Ga0307515_10139640
654 Ga0265327_10001677
655 Ga0307513_10000077
656 Ga0307513_10002125
657 Ga0307513_10005206
658 Ga0307508_10207656
659 Ga0307516_10000001
660 Ga0307411_10177564
661 Ga0307510_10106131
662 Ga0307510_10196046
663 Ga0373936_0003022
664 Ga0395899_0104979
665 Ga0395900_0464224
666 Ga0395898_0570010
667 Ga0395905_0252116
668 Ga0395905_0323369
669 Ga0395905_0366661
670 Ga0395905_0406639
671 Ga0395901_0012954
672 Ga0395901_0228345
673 Ga0436365_0248244
674 Ga0436361_0799712
675 Ga0439465_0013590
676 Ga0451853_2849604
677 Ga0466961_0219300
678 Ga0495629_0009552
679 Ga0495638_0000884
680 Ga0495638_0001082
681 Ga0495638_0011795
682 Ga0495638_0076433
683 Ga0495650_0000046
684 Ga0495585_0089436
685 Ga0495583_0000003
686 Ga0495610_0000779
687 Ga0495610_0003404
688 Ga0495616_0000473
689 Ga0495616_0017364
690 Ga0495620_0013580
691 Ga0495620_0031039
692 Ga0495632_0003085
693 Ga0495632_0093430
694 Ga0495637_0001422
695 Ga0495643_0029286
696 Ga0495643_0101183
697 Ga0495643_0133777
698 Ga0495644_0134832
699 Ga0495648_0000066
700 Ga0495648_0040202
701 Ga0495648_0063498
702 Ga0495642_0011894
703 Ga0495642_0024411
704 Ga0495654_0000023
705 Ga0495654_0049666
706 Ga0495609_0038043
707 Ga0495597_0060985
708 Ga0495597_0263557
709 Ga0495668_0005347
710 Ga0495668_0008691
711 Ga0495668_0014733
712 Ga0495668_0091782
713 Ga0495668_0277269
714 Ga0495611_0008182
715 Ga0495625_0001472
716 Ga0495625_0011015
717 Ga0495625_0107598
718 Ga0495625_0354530
719 Ga0495659_0058848
720 Ga0495669_0000002
721 Ga0495669_0009146
722 Ga0495669_0046846
723 Ga0495669_0073573
724 Ga0495670_0087361
725 Ga0495671_0028071
726 Ga0495671_0317118
727 Ga0495660_0012126
728 Ga0495581_0109239
729 Ga0495672_0000311
730 Ga0495683_0086311
731 Ga0495677_0013716
732 Ga0495679_013323
733 Ga0495673_0000710
734 Ga0495673_0001008
735 Ga0495681_0043583
736 Ga0495681_0057281
737 Ga0495686_0011532
738 Ga0495686_0028160
739 Ga0495686_0067895
740 Ga0495686_0078038
741 Ga0495686_0251514
742 Ga0496100_0342364
743 Ga0496102_0019937
744 Ga0496103_0210981
745 Ga0496104_0141812
746 Ga0496106_0015925
747 Ga0496107_0000112
748 Ga0496108_0686688
749 Ga0496109_0039706
750 Ga0496112_0097281
751 Ga0496112_0181416
752 Ga0496113_0533679
753 Ga0496115_0004474
754 Ga0496115_0009878
755 Ga0496115_0036586
756 Ga0496117_0011384
757 Ga0496118_0004288
758 Ga0496121_0000035
759 Ga0496121_0001796
760 Ga0496121_0292447
761 Ga0496124_0014384
762 Ga0496126_0004925
763 Ga0496126_0375305
764 Ga0501033_0002814
765 Ga0501033_0009084
766 Ga0501034_0007932
767 Ga0501037_0287530
768 Ga0501043_0041181
769 Ga0501047_0002235
770 Ga0501047_0111569
771 Ga0501047_0246918
772 Ga0501047_0669518
773 Ga0501044_0008351
774 Ga0501044_0011677
775 Ga0501044_0239206
776 Ga0501044_0467870
777 Ga0501044_0811370
778 nmdc:mga00v17_1616_c1
779 nmdc:mga06z11_141924_c1
780 nmdc:mga07m45_6207_c1
781 nmdc:mga0sz30_107581_c1
782 Ga0500635_0000133
783 Ga0500644_0000084
784 Ga0500583_0151188
785 Ga0500651_0237573
786 Ga0500566_0116957
787 Ga0500554_001287
788 Ga0500555_001169
789 Ga0500556_0000314
790 Ga0500562_000327
791 Ga0500562_043711
792 Ga0500569_009406
793 Ga0500595_005961
794 Ga0500608_000831
795 Ga0500618_000092
796 Ga0500642_0025648
797 Ga0500658_0002597
798 Ga0500559_0000046
799 Ga0500559_0001854
800 Ga0500559_0002680
801 Ga0500559_0011386
802 Ga0500564_000080
803 Ga0500590_010870
804 Ga0500616_0068741
805 Ga0500616_0120808
806 Ga0500619_044307
807 Ga0500622_0005190
808 Ga0500622_0010791
809 Ga0500622_0018551
810 Ga0500624_004743
811 Ga0500627_0051129
812 Ga0500638_063286
813 Ga0500637_0001963
814 Ga0500637_0043423
815 Ga0500611_001212
816 Ga0500645_001187
817 Ga0500645_004400
818 Ga0500609_009655
819 Ga0500661_041813
820 2511122619
821 2585148012
822 2643749142
823 2643930918
824 2644000550
825 2644088684
826 2644343919
827 2644368602
828 2644509083
829 2792460446
830 2843745134
831 2849564075
832 2849577376
833 2851155208
834 2857508649
835 2884961446
836 2898331183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07021

MetW

Methionine biosynthesis protein MetW

13

207

0.99

PF08241

Methyltransf_11

Methyltransferase domain

30

117

0.9

PF13649

Methyltransf_25

Methyltransferase domain

29

116

0.9

PF13847

Methyltransf_31

Methyltransferase domain

23

121

0.9

PF13489

Methyltransf_23

Methyltransferase domain

11

176

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uak-assembly1.cif.gz_A-2 lahsb - c-terminal methyltransferase involved in ripp biosynthesis 0.781 1 111
3cc8-assembly1.cif.gz_A-2 crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution 0.778 8 200
7o4o-assembly1.cif.gz_A structure of staphylococcus aureus m1a22-trna methyltransferase in complex with s-adenosylhomocysteine 0.7646 1 200
6isv-assembly1.cif.gz_B structure of acetophenone reductase from geotrichum candidum nbrc 4597 in complex with nad 0.758 2 104
6qe6-assembly2.cif.gz_B structure of m. capricolum trmk in complex with the natural cofactor product s-adenosyl-homocysteine (sah) 0.7544 1 200
ID Description Score Start End Superfamily
af_Q50584_122_315_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8874 6 104 3.40.50.150
af_Q9VBZ6_765_943_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8853 40 63 3.40.50.1010
af_Q54U59_216_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8561 18 104 3.40.50.150
af_I6X5U4_8_196_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8554 4 104 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8433 5 104 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7Y2JBE9-F1-model_v4 Methionine biosynthesis protein MetW 0.9942 3 68
AF-A0A7X6ZLT5-F1-model_v4 Homoserine O-acetyltransferase (EC 2.3.1.31) 0.9917 3 65 GO:0004414
GO:0009086
GO:0009092
AF-A0A4R9PH07-F1-model_v4 Methionine biosynthesis protein MetW 0.9898 5 65
AF-A0A6N7AMB5-F1-model_v4 SAM-dependent methyltransferase 0.9837 1 104 GO:0008168
GO:0032259
AF-A0A3C0A9P2-F1-model_v4 Methionine biosynthesis protein MetW 0.9825 5 65

Map