F439338

General Info

Members Datasets Scaffolds Average Seq Length
418 230 836 303

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0012420|Ga0373937_0012420_1116_2069
Length 317
Sequence LTKGDRAPENRVQFKPSEGVSVTALITSNLGDIPLLSRGKVRDLYAIGDALLLVATDRLSAFDHVLATGIPGKGKILTQISLFWFDLLSDIVPNHVITAEVREFPAALQPFHEQLEGRSMLVKRANMFPVECVARGYLAGSGWKDYQRTGAVCGIALPTGLEDGSRLPEPIFTPATKSQDGAHDENISFAAIEARIGAEQAAELRRLTLAIYAKAAAHAESRGLILADTKFEFGTVGEKIILADEVLTPDSSRFWDAGAWKPGGAQPSFDKQFVRDYLEAIRWNKQAPAPGLPEDVAERTRDKYLEAFHRLTGRHLT

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 1.91
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0012420 3300036401 Bacteria 7491
2 LJNas_1000248 3300000546 Bacteria 9312
3 Ga0070658_10000963 3300005327 Bacteria 24659
4 Ga0070658_10378767 3300005327 Bacteria 1214
5 Ga0070676_10000027 3300005328 Bacteria 44608
6 Ga0070683_100043151 3300005329 Bacteria 4156
7 Ga0070683_100145257 3300005329 Bacteria 2248
8 Ga0070683_100233698 3300005329 Bacteria 1748
9 Ga0070683_100267771 3300005329 Bacteria 1625
10 Ga0070690_100000043 3300005330 Bacteria 58835
11 Ga0070670_100040621 3300005331 Bacteria 3998
12 Ga0070677_10000116 3300005333 Bacteria 26456
13 Ga0068869_100009233 3300005334 Bacteria 6391
14 Ga0068869_100045580 3300005334 Bacteria 3158
15 Ga0070666_10002027 3300005335 Bacteria 12320
16 Ga0070680_100018677 3300005336 Bacteria 5484
17 Ga0070680_100046506 3300005336 Bacteria 3531
18 Ga0068868_100000283 3300005338 Bacteria 34191
19 Ga0070660_100000070 3300005339 Bacteria 60814
20 Ga0070660_100011290 3300005339 Bacteria 6341
21 Ga0070660_100216956 3300005339 Bacteria 1554
22 Ga0070689_100001917 3300005340 Bacteria 13449
23 Ga0070687_100000009 3300005343 Bacteria 59511
24 Ga0070661_100000103 3300005344 Bacteria 69885
25 Ga0070668_100000220 3300005347 Bacteria 36819
26 Ga0070669_100000241 3300005353 Bacteria 45411
27 Ga0070675_100003360 3300005354 Bacteria 12119
28 Ga0070671_100000575 3300005355 Bacteria 26151
29 Ga0070671_100083327 3300005355 Bacteria 2674
30 Ga0070674_100000135 3300005356 Bacteria 33888
31 Ga0070673_100003863 3300005364 Bacteria 9406
32 Ga0070673_100026548 3300005364 Bacteria 4279
33 Ga0070688_100000005 3300005365 Bacteria 92266
34 Ga0070688_100288203 3300005365 Bacteria 1182
35 Ga0070659_100000074 3300005366 Bacteria 78529
36 Ga0070667_100065592 3300005367 Bacteria 3083
37 Ga0070709_10169434 3300005434 Bacteria 1525
38 Ga0070713_100009773 3300005436 Bacteria 6894
39 Ga0070713_100037638 3300005436 Bacteria 3913
40 Ga0070701_10013387 3300005438 Bacteria 3731
41 Ga0070705_100000759 3300005440 Bacteria 18290
42 Ga0070708_100006136 3300005445 Bacteria 9561
43 Ga0070663_100028948 3300005455 Bacteria 3778
44 Ga0070678_100002559 3300005456 Bacteria 9990
45 Ga0070662_100002551 3300005457 Bacteria 11216
46 Ga0070662_100030654 3300005457 Bacteria 3766
47 Ga0070681_10000830 3300005458 Bacteria 25813
48 Ga0068867_100015283 3300005459 Bacteria 5441
49 Ga0070685_10000311 3300005466 Bacteria 30524
50 Ga0070706_100000326 3300005467 Bacteria 57972
51 Ga0070698_100130664 3300005471 Bacteria 2467
52 Ga0070679_100001213 3300005530 Bacteria 22698
53 Ga0070679_100005577 3300005530 Bacteria 11665
54 Ga0070684_100028683 3300005535 Bacteria 4709
55 Ga0070684_100086604 3300005535 Bacteria 2780
56 Ga0070697_100004887 3300005536 Bacteria 10283
57 Ga0070697_100179423 3300005536 Bacteria 1795
58 Ga0068853_100000091 3300005539 Bacteria 61548
59 Ga0068853_100065349 3300005539 Bacteria 3157
60 Ga0068853_100306254 3300005539 Bacteria 1470
61 Ga0070672_100002278 3300005543 Bacteria 12118
62 Ga0070686_100001037 3300005544 Bacteria 15979
63 Ga0070686_100157947 3300005544 Bacteria 1594
64 Ga0070695_100087474 3300005545 Bacteria 2073
65 Ga0070696_100333092 3300005546 Bacteria 1171
66 Ga0070693_100008704 3300005547 Bacteria 5021
67 Ga0070693_100096939 3300005547 Bacteria 1789
68 Ga0070665_100030136 3300005548 Bacteria 5459
69 Ga0068855_100000445 3300005563 Bacteria 51170
70 Ga0068855_100005656 3300005563 Bacteria 15263
71 Ga0068855_100007763 3300005563 Bacteria 12956
72 Ga0068855_100011446 3300005563 Bacteria 10716
73 Ga0070664_100001703 3300005564 Bacteria 17601
74 Ga0070664_100474654 3300005564 Bacteria 1150
75 Ga0068857_100001318 3300005577 Bacteria 19527
76 Ga0068857_100003624 3300005577 Bacteria 12939
77 Ga0068854_100002717 3300005578 Bacteria 10973
78 Ga0068856_100002616 3300005614 Bacteria 18507
79 Ga0068856_100042251 3300005614 Bacteria 4484
80 Ga0068856_100213144 3300005614 Bacteria 1947
81 Ga0068856_100365357 3300005614 Bacteria 1462
82 Ga0068852_100000213 3300005616 Bacteria 39636
83 Ga0068852_100003812 3300005616 Bacteria 10582
84 Ga0068859_100000252 3300005617 Bacteria 53087
85 Ga0068859_100545097 3300005617 Bacteria 1255
86 Ga0068864_100002552 3300005618 Bacteria 15039
87 Ga0068866_10000098 3300005718 Bacteria 36592
88 Ga0068861_100000024 3300005719 Bacteria 72294
89 Ga0068851_10000083 3300005834 Bacteria 52378
90 Ga0068851_10055493 3300005834 Bacteria 2018
91 Ga0068870_10000013 3300005840 Bacteria 64323
92 Ga0068863_100026192 3300005841 Bacteria 5565
93 Ga0068858_100006689 3300005842 Bacteria 11216
94 Ga0068860_100009908 3300005843 Bacteria 9448
95 Ga0068860_100104217 3300005843 Bacteria 2708
96 Ga0068862_100004951 3300005844 Bacteria 11216
97 Ga0070717_10017146 3300006028 Bacteria 5627
98 Ga0070717_10162834 3300006028 Bacteria 1936
99 Ga0070712_100041909 3300006175 Bacteria 3146
100 Ga0097621_100008241 3300006237 Bacteria 7496
101 Ga0097621_100044651 3300006237 Bacteria 3576
102 Ga0097621_100130266 3300006237 Bacteria 2141
103 Ga0097621_100173260 3300006237 Bacteria 1861
104 Ga0068871_100002584 3300006358 Bacteria 12359
105 Ga0068871_100060440 3300006358 Bacteria 3092
106 Ga0068871_100305213 3300006358 Bacteria 1398
107 Ga0075430_100038564 3300006846 Unclassified 4046
108 Ga0075431_100003079 3300006847 Bacteria 16157
109 Ga0075429_100197138 3300006880 Bacteria 1764
110 Ga0068865_100000729 3300006881 Bacteria 18522
111 Ga0097620_100000252 3300006931 Bacteria 53087
112 Ga0097620_100545110 3300006931 Bacteria 1255
113 Ga0099794_10000005 3300007265 Bacteria 131875
114 Ga0105240_10000077 3300009093 Bacteria 197213
115 Ga0105240_10001850 3300009093 Bacteria 35399
116 Ga0105240_10004605 3300009093 Bacteria 20901
117 Ga0105240_10005262 3300009093 Bacteria 19318
118 Ga0105240_10283359 3300009093 Bacteria 1903
119 Ga0105245_10000469 3300009098 Bacteria 36926
120 Ga0105245_10005529 3300009098 Bacteria 11099
121 Ga0105245_10010335 3300009098 Bacteria 8130
122 Ga0105245_10026265 3300009098 Bacteria 5125
123 Ga0105245_10066768 3300009098 Bacteria 3256
124 Ga0105245_10257332 3300009098 Bacteria 1698
125 Ga0105245_10485469 3300009098 Bacteria 1249
126 Ga0105247_10003922 3300009101 Bacteria 9593
127 Ga0105247_10072077 3300009101 Bacteria 2162
128 Ga0114129_10159861 3300009147 Bacteria 3079
129 Ga0105243_10045295 3300009148 Bacteria 3456
130 Ga0105243_10050697 3300009148 Bacteria 3280
131 Ga0105241_10004689 3300009174 Bacteria 10092
132 Ga0105241_10005889 3300009174 Bacteria 9049
133 Ga0105242_10012008 3300009176 Bacteria 6669
134 Ga0105242_10030241 3300009176 Bacteria 4324
135 Ga0105248_10001317 3300009177 Bacteria 27662
136 Ga0105248_10002427 3300009177 Bacteria 20684
137 Ga0105248_10009791 3300009177 Bacteria 10558
138 Ga0105248_10047510 3300009177 Bacteria 4814
139 Ga0105248_10144365 3300009177 Bacteria 2685
140 Ga0105248_10539777 3300009177 Bacteria 1315
141 Ga0105237_10000433 3300009545 Bacteria 59532
142 Ga0105237_10001784 3300009545 Bacteria 27828
143 Ga0105237_10005706 3300009545 Bacteria 13994
144 Ga0105237_10078055 3300009545 Bacteria 3301
145 Ga0105237_10093615 3300009545 Bacteria 2994
146 Ga0105238_10000565 3300009551 Bacteria 38818
147 Ga0105238_10004812 3300009551 Bacteria 13364
148 Ga0105238_10008673 3300009551 Bacteria 10171
149 Ga0105238_10012387 3300009551 Bacteria 8599
150 Ga0105238_10036659 3300009551 Bacteria 4986
151 Ga0105238_10057392 3300009551 Bacteria 3903
152 Ga0105238_10211606 3300009551 Bacteria 1915
153 Ga0105238_10374655 3300009551 Bacteria 1414
154 Ga0105249_10000132 3300009553 Bacteria 98963
155 Ga0105249_10017008 3300009553 Bacteria 6452
156 Ga0105239_10000837 3300010375 Bacteria 43680
157 Ga0105239_10004918 3300010375 Bacteria 15799
158 Ga0105239_10041738 3300010375 Bacteria 5027
159 Ga0105239_10061813 3300010375 Bacteria 4111
160 Ga0105246_10000153 3300011119 Bacteria 32719
161 Ga0105246_10030025 3300011119 Bacteria 3586
162 Ga0157373_10004301 3300013100 Bacteria 10724
163 Ga0157371_10000442 3300013102 Bacteria 50765
164 Ga0157370_10003555 3300013104 Bacteria 18244
165 Ga0157370_10008845 3300013104 Bacteria 10824
166 Ga0157370_10080384 3300013104 Bacteria 3069
167 Ga0157370_10229723 3300013104 Bacteria 1717
168 Ga0157369_10000633 3300013105 Bacteria 45513
169 Ga0157369_10002063 3300013105 Bacteria 24253
170 Ga0157369_10015033 3300013105 Bacteria 8734
171 Ga0157369_10029620 3300013105 Bacteria 6047
172 Ga0157369_10084118 3300013105 Bacteria 3401
173 Ga0157374_10003675 3300013296 Bacteria 12895
174 Ga0157374_10034193 3300013296 Unclassified 4641
175 Ga0157374_10038187 3300013296 Bacteria 4413
176 Ga0157374_10452841 3300013296 Bacteria 1285
177 Ga0157378_10001032 3300013297 Bacteria 25432
178 Ga0157378_10003262 3300013297 Bacteria 14422
179 Ga0163162_10000929 3300013306 Bacteria 27184
180 Ga0163162_10075689 3300013306 Unclassified 3427
181 Ga0163162_10198348 3300013306 Bacteria 2136
182 Ga0163162_10468036 3300013306 Bacteria 1392
183 Ga0163162_10915837 3300013306 Bacteria 989
184 Ga0157372_10000076 3300013307 Bacteria 102440
185 Ga0157372_10000927 3300013307 Bacteria 31970
186 Ga0157372_10014408 3300013307 Bacteria 8456
187 Ga0157372_10022753 3300013307 Bacteria 6785
188 Ga0157372_10097887 3300013307 Bacteria 3346
189 Ga0157375_10001531 3300013308 Bacteria 19892
190 Ga0163163_10043359 3300014325 Bacteria 4410
191 Ga0163163_10141372 3300014325 Bacteria 2449
192 Ga0163163_10245780 3300014325 Bacteria 1839
193 Ga0157380_10004430 3300014326 Bacteria 9726
194 Ga0157377_10000209 3300014745 Bacteria 31916
195 Ga0157377_10143381 3300014745 Bacteria 1470
196 Ga0157379_10003709 3300014968 Bacteria 13000
197 Ga0157379_10048232 3300014968 Bacteria 3801
198 Ga0157379_10495313 3300014968 Bacteria 1132
199 Ga0157376_10000781 3300014969 Bacteria 20810
200 Ga0163161_10030220 3300017792 Bacteria 3854
201 Ga0209437_104162 3300025233 Bacteria 2564
202 Ga0209233_1007319 3300025261 Bacteria 3503
203 Ga0207697_10005617 3300025315 Bacteria 5797
204 Ga0207682_10000150 3300025893 Bacteria 31458
205 Ga0207642_10001119 3300025899 Bacteria 8290
206 Ga0207710_10002013 3300025900 Bacteria 9686
207 Ga0207688_10004215 3300025901 Bacteria 7844
208 Ga0207680_10000785 3300025903 Bacteria 15007
209 Ga0207647_10010069 3300025904 Bacteria 6688
210 Ga0207699_10168160 3300025906 Bacteria 1465
211 Ga0207645_10000005 3300025907 Bacteria 210700
212 Ga0207643_10000061 3300025908 Bacteria 71630
213 Ga0207684_10000056 3300025910 Bacteria 215717
214 Ga0207654_10011777 3300025911 Bacteria 4466
215 Ga0207654_10034801 3300025911 Bacteria 2801
216 Ga0207654_10043106 3300025911 Bacteria 2556
217 Ga0207707_10001254 3300025912 Bacteria 23781
218 Ga0207707_10040432 3300025912 Bacteria 4073
219 Ga0207707_10104697 3300025912 Bacteria 2473
220 Ga0207695_10000509 3300025913 Bacteria 82842
221 Ga0207695_10000707 3300025913 Bacteria 64975
222 Ga0207695_10004088 3300025913 Bacteria 20048
223 Ga0207695_10033832 3300025913 Bacteria 5567
224 Ga0207671_10007204 3300025914 Bacteria 9691
225 Ga0207671_10111033 3300025914 Bacteria 2086
226 Ga0207671_10384006 3300025914 Bacteria 1116
227 Ga0207693_10054734 3300025915 Bacteria 3129
228 Ga0207663_10039943 3300025916 Bacteria 2847
229 Ga0207663_10479545 3300025916 Bacteria 963
230 Ga0207660_10028472 3300025917 Bacteria 3822
231 Ga0207660_10028688 3300025917 Bacteria 3808
232 Ga0207660_10068992 3300025917 Bacteria 2566
233 Ga0207662_10000187 3300025918 Bacteria 29200
234 Ga0207657_10000024 3300025919 Bacteria 152152
235 Ga0207657_10004815 3300025919 Bacteria 14228
236 Ga0207649_10003956 3300025920 Bacteria 8080
237 Ga0207652_10000747 3300025921 Bacteria 31268
238 Ga0207652_10144628 3300025921 Bacteria 2127
239 Ga0207646_10303836 3300025922 Bacteria 1441
240 Ga0207681_10000443 3300025923 Bacteria 28974
241 Ga0207694_10001537 3300025924 Bacteria 19615
242 Ga0207694_10006786 3300025924 Bacteria 8692
243 Ga0207694_10009878 3300025924 Bacteria 7203
244 Ga0207694_10013230 3300025924 Bacteria 6212
245 Ga0207694_10029989 3300025924 Bacteria 4153
246 Ga0207694_10063962 3300025924 Bacteria 2866
247 Ga0207694_10256058 3300025924 Bacteria 1433
248 Ga0207650_10000451 3300025925 Bacteria 34968
249 Ga0207659_10000174 3300025926 Bacteria 38550
250 Ga0207687_10000260 3300025927 Bacteria 35976
251 Ga0207687_10000437 3300025927 Bacteria 28299
252 Ga0207687_10005243 3300025927 Bacteria 8595
253 Ga0207687_10010764 3300025927 Bacteria 5977
254 Ga0207687_10016021 3300025927 Bacteria 4918
255 Ga0207687_10276202 3300025927 Bacteria 1345
256 Ga0207687_10323270 3300025927 Bacteria 1249
257 Ga0207700_10100755 3300025928 Bacteria 2303
258 Ga0207644_10005849 3300025931 Bacteria 8015
259 Ga0207690_10001497 3300025932 Bacteria 14602
260 Ga0207706_10000063 3300025933 Bacteria 109098
261 Ga0207706_10047128 3300025933 Bacteria 3815
262 Ga0207686_10036479 3300025934 Bacteria 2960
263 Ga0207686_10043232 3300025934 Bacteria 2760
264 Ga0207686_10051964 3300025934 Bacteria 2555
265 Ga0207709_10090405 3300025935 Bacteria 1999
266 Ga0207709_10258818 3300025935 Bacteria 1275
267 Ga0207670_10002942 3300025936 Bacteria 8998
268 Ga0207669_10003774 3300025937 Bacteria 6585
269 Ga0207704_10000148 3300025938 Bacteria 37546
270 Ga0207704_10036860 3300025938 Bacteria 2818
271 Ga0207665_10413221 3300025939 Bacteria 1029
272 Ga0207691_10000118 3300025940 Bacteria 71154
273 Ga0207711_10000045 3300025941 Bacteria 155245
274 Ga0207711_10002734 3300025941 Bacteria 15558
275 Ga0207711_10006203 3300025941 Bacteria 10101
276 Ga0207711_10184755 3300025941 Bacteria 1897
277 Ga0207689_10000022 3300025942 Bacteria 109850
278 Ga0207689_10032967 3300025942 Bacteria 4305
279 Ga0207689_10259176 3300025942 Bacteria 1438
280 Ga0207661_10006661 3300025944 Bacteria 8169
281 Ga0207661_10026266 3300025944 Bacteria 4434
282 Ga0207661_10027112 3300025944 Bacteria 4374
283 Ga0207661_10114723 3300025944 Bacteria 2284
284 Ga0207661_10223232 3300025944 Bacteria 1666
285 Ga0207679_10000301 3300025945 Bacteria 37052
286 Ga0207667_10000155 3300025949 Bacteria 102541
287 Ga0207667_10002651 3300025949 Bacteria 22103
288 Ga0207667_10018865 3300025949 Bacteria 7718
289 Ga0207667_10025583 3300025949 Bacteria 6458
290 Ga0207667_10059944 3300025949 Bacteria 3984
291 Ga0207651_10000151 3300025960 Bacteria 30246
292 Ga0207651_10376973 3300025960 Bacteria 1201
293 Ga0207712_10000613 3300025961 Bacteria 28188
294 Ga0207712_10025818 3300025961 Bacteria 3907
295 Ga0207712_10137344 3300025961 Bacteria 1871
296 Ga0207668_10001465 3300025972 Bacteria 13853
297 Ga0207640_10001634 3300025981 Bacteria 12011
298 Ga0207658_10000644 3300025986 Bacteria 30587
299 Ga0207677_10001311 3300026023 Bacteria 13362
300 Ga0207677_10441627 3300026023 Bacteria 1113
301 Ga0207703_10001780 3300026035 Bacteria 19226
302 Ga0207703_10011573 3300026035 Bacteria 6860
303 Ga0207639_10005502 3300026041 Bacteria 8563
304 Ga0207639_10057732 3300026041 Bacteria 2982
305 Ga0207639_10600160 3300026041 Bacteria 1015
306 Ga0207678_10007210 3300026067 Bacteria 9857
307 Ga0207678_10038115 3300026067 Bacteria 4178
308 Ga0207708_10011109 3300026075 Bacteria 6697
309 Ga0207702_10007898 3300026078 Bacteria 9020
310 Ga0207702_10026273 3300026078 Bacteria 4832
311 Ga0207702_10044910 3300026078 Bacteria 3715
312 Ga0207702_10509808 3300026078 Bacteria 1173
313 Ga0207641_10001939 3300026088 Bacteria 19865
314 Ga0207648_10000239 3300026089 Bacteria 59022
315 Ga0207648_10525453 3300026089 Bacteria 1085
316 Ga0207648_10577553 3300026089 Bacteria 1034
317 Ga0207676_10000653 3300026095 Bacteria 27819
318 Ga0207676_10453114 3300026095 Bacteria 1210
319 Ga0207674_10000787 3300026116 Bacteria 41353
320 Ga0207674_10006079 3300026116 Bacteria 14270
321 Ga0207674_10014745 3300026116 Bacteria 8623
322 Ga0207674_10104929 3300026116 Bacteria 2804
323 Ga0207675_100000027 3300026118 Bacteria 109986
324 Ga0207675_100406952 3300026118 Bacteria 1342
325 Ga0207683_10000151 3300026121 Bacteria 57695
326 Ga0207683_10323962 3300026121 Bacteria 1412
327 Ga0207698_10003186 3300026142 Bacteria 9846
328 Ga0207698_10304529 3300026142 Bacteria 1485
329 Ga0209588_1000006 3300027671 Bacteria 184445
330 Ga0268266_10000915 3300028379 Bacteria 37966
331 Ga0268265_10001009 3300028380 Bacteria 25463
332 Ga0268264_10000409 3300028381 Bacteria 60923
333 Ga0268264_10083867 3300028381 Bacteria 2731
334 Ga0265318_10097598 3300028577 Bacteria 1081
335 Ga0265322_10035849 3300028654 Unclassified 1413
336 Ga0265338_10006297 3300028800 Bacteria 15173
337 Ga0265338_10006678 3300028800 Bacteria 14584
338 Ga0265338_10149266 3300028800 Bacteria 1818
339 Ga0265330_10000079 3300031235 Bacteria 82255
340 Ga0265332_10002299 3300031238 Bacteria 9774
341 Ga0265328_10005331 3300031239 Bacteria 5517
342 Ga0265320_10070697 3300031240 Bacteria 1645
343 Ga0265325_10000308 3300031241 Bacteria 34353
344 Ga0265329_10026386 3300031242 Bacteria 1914
345 Ga0265340_10007954 3300031247 Bacteria 5748
346 Ga0265340_10054917 3300031247 Bacteria 1920
347 Ga0265339_10012250 3300031249 Bacteria 5244
348 Ga0265316_10000767 3300031344 Bacteria 35377
349 Ga0265316_10001222 3300031344 Bacteria 27661
350 Ga0265316_10002274 3300031344 Bacteria 20129
351 Ga0265316_10053641 3300031344 Bacteria 3159
352 Ga0265313_10002477 3300031595 Bacteria 15914
353 Ga0265313_10021459 3300031595 Bacteria 3532
354 Ga0265314_10000064 3300031711 Bacteria 158787
355 Ga0265314_10004335 3300031711 Bacteria 13230
356 Ga0265314_10010893 3300031711 Bacteria 7557
357 Ga0265314_10022333 3300031711 Bacteria 4848
358 Ga0265342_10000009 3300031712 Bacteria 220210
359 Ga0265342_10000626 3300031712 Bacteria 37095
360 Ga0265342_10005737 3300031712 Bacteria 9384
361 Ga0265342_10045658 3300031712 Bacteria 2636
362 Ga0373923_0073078 3300035111 Bacteria 1476
363 Ga0373954_0027862 3300035118 Bacteria 2595
364 Ga0373946_0077477 3300035171 Bacteria 1449
365 Ga0373955_0145239 3300035172 Bacteria 1393
366 Ga0373955_0349140 3300035172 Bacteria 896
367 Ga0373935_0046355 3300035692 Bacteria 2746
368 Ga0373927_0001103 3300035695 Bacteria 20538
369 Ga0373933_0006122 3300035724 Bacteria 6551
370 Ga0373947_0000686 3300035725 Bacteria 20165
371 Ga0373947_0077154 3300035725 Bacteria 2055
372 Ga0373937_0004420 3300036401 Bacteria 11953
373 Ga0373937_0474656 3300036401 Bacteria 1188
374 Ga0373937_0731535 3300036401 Bacteria 936
375 Ga0373925_0000090 3300037068 Bacteria 97041
376 Ga0495592_0018214 3300046454 Bacteria 5337
377 Ga0495651_0037889 3300046462 Bacteria 3755
378 Ga0495580_0046604 3300046472 Bacteria 3075
379 Ga0495582_0009139 3300046473 Bacteria 5466
380 Ga0495639_0071640 3300046475 Bacteria 1601
381 Ga0495628_0146828 3300046516 Bacteria 1798
382 Ga0495665_0018533 3300046531 Bacteria 3740
383 Ga0495586_0042004 3300046535 Bacteria 2463
384 Ga0495587_0019318 3300046536 Bacteria 4219
385 Ga0495587_0110008 3300046536 Bacteria 1583
386 Ga0495609_0077787 3300046538 Bacteria 1452
387 Ga0495588_0043796 3300046674 Bacteria 2291
388 Ga0495599_0007925 3300046678 Bacteria 6443
389 Ga0495581_0134127 3300047315 Bacteria 1443
390 Ga0495636_0058293 3300047318 Bacteria 1628
391 Ga0495675_0071043 3300047444 Bacteria 2198
392 Ga0495684_0058750 3300047471 Bacteria 2929
393 Ga0495686_0000035 3300047472 Bacteria 314930
394 Ga0495686_0002162 3300047472 Bacteria 19173
395 Ga0495686_0036535 3300047472 Bacteria 3153
396 Ga0495602_0285396 3300048088 Bacteria 1214
397 Ga0496102_0005855 3300048905 Bacteria 10462
398 Ga0496104_0001306 3300048907 Bacteria 21504
399 Ga0496106_0020180 3300048909 Bacteria 4944
400 Ga0496108_0023157 3300048911 Bacteria 5108
401 Ga0496109_0010169 3300048912 Bacteria 8030
402 Ga0496109_0360630 3300048912 Bacteria 1373
403 Ga0496109_0684453 3300048912 Bacteria 963
404 Ga0496112_0007904 3300048915 Bacteria 9475
405 Ga0496121_0226157 3300048924 Bacteria 1314
406 Ga0496126_0000110 3300048929 Bacteria 196225
407 Ga0501071_0055982 3300049587 Bacteria 2848
408 Ga0501072_0544486 3300049588 Bacteria 917
409 Ga0501035_0000106 3300049822 Bacteria 104085
410 nmdc:mga05p37_237637_c1 3300050507 Bacteria 2192
411 nmdc:mga05p37_524518_c1 3300050507 Bacteria 1354
412 nmdc:mga09592_231515_c1 3300050508 Unclassified 1601
413 nmdc:mga0qj67_24786_c1 3300050509 Bacteria 4628
414 nmdc:mga06r32_20610_c1 3300050510 Bacteria 6072
415 nmdc:mga06r32_68144_c1 3300050510 Unclassified 1621
416 Ga0495601_0093335 3300053077 Bacteria 1939
417 Ga0500593_000301 3300053117 Bacteria 20066
418 Ga0500595_007882 3300053119 Bacteria 4386
419 Ga0373937_0012420
420 LJNas_1000248
421 Ga0070658_10000963
422 Ga0070658_10378767
423 Ga0070676_10000027
424 Ga0070683_100043151
425 Ga0070683_100145257
426 Ga0070683_100233698
427 Ga0070683_100267771
428 Ga0070690_100000043
429 Ga0070670_100040621
430 Ga0070677_10000116
431 Ga0068869_100009233
432 Ga0068869_100045580
433 Ga0070666_10002027
434 Ga0070680_100018677
435 Ga0070680_100046506
436 Ga0068868_100000283
437 Ga0070660_100000070
438 Ga0070660_100011290
439 Ga0070660_100216956
440 Ga0070689_100001917
441 Ga0070687_100000009
442 Ga0070661_100000103
443 Ga0070668_100000220
444 Ga0070669_100000241
445 Ga0070675_100003360
446 Ga0070671_100000575
447 Ga0070671_100083327
448 Ga0070674_100000135
449 Ga0070673_100003863
450 Ga0070673_100026548
451 Ga0070688_100000005
452 Ga0070688_100288203
453 Ga0070659_100000074
454 Ga0070667_100065592
455 Ga0070709_10169434
456 Ga0070713_100009773
457 Ga0070713_100037638
458 Ga0070701_10013387
459 Ga0070705_100000759
460 Ga0070708_100006136
461 Ga0070663_100028948
462 Ga0070678_100002559
463 Ga0070662_100002551
464 Ga0070662_100030654
465 Ga0070681_10000830
466 Ga0068867_100015283
467 Ga0070685_10000311
468 Ga0070706_100000326
469 Ga0070698_100130664
470 Ga0070679_100001213
471 Ga0070679_100005577
472 Ga0070684_100028683
473 Ga0070684_100086604
474 Ga0070697_100004887
475 Ga0070697_100179423
476 Ga0068853_100000091
477 Ga0068853_100065349
478 Ga0068853_100306254
479 Ga0070672_100002278
480 Ga0070686_100001037
481 Ga0070686_100157947
482 Ga0070695_100087474
483 Ga0070696_100333092
484 Ga0070693_100008704
485 Ga0070693_100096939
486 Ga0070665_100030136
487 Ga0068855_100000445
488 Ga0068855_100005656
489 Ga0068855_100007763
490 Ga0068855_100011446
491 Ga0070664_100001703
492 Ga0070664_100474654
493 Ga0068857_100001318
494 Ga0068857_100003624
495 Ga0068854_100002717
496 Ga0068856_100002616
497 Ga0068856_100042251
498 Ga0068856_100213144
499 Ga0068856_100365357
500 Ga0068852_100000213
501 Ga0068852_100003812
502 Ga0068859_100000252
503 Ga0068859_100545097
504 Ga0068864_100002552
505 Ga0068866_10000098
506 Ga0068861_100000024
507 Ga0068851_10000083
508 Ga0068851_10055493
509 Ga0068870_10000013
510 Ga0068863_100026192
511 Ga0068858_100006689
512 Ga0068860_100009908
513 Ga0068860_100104217
514 Ga0068862_100004951
515 Ga0070717_10017146
516 Ga0070717_10162834
517 Ga0070712_100041909
518 Ga0097621_100008241
519 Ga0097621_100044651
520 Ga0097621_100130266
521 Ga0097621_100173260
522 Ga0068871_100002584
523 Ga0068871_100060440
524 Ga0068871_100305213
525 Ga0075430_100038564
526 Ga0075431_100003079
527 Ga0075429_100197138
528 Ga0068865_100000729
529 Ga0097620_100000252
530 Ga0097620_100545110
531 Ga0099794_10000005
532 Ga0105240_10000077
533 Ga0105240_10001850
534 Ga0105240_10004605
535 Ga0105240_10005262
536 Ga0105240_10283359
537 Ga0105245_10000469
538 Ga0105245_10005529
539 Ga0105245_10010335
540 Ga0105245_10026265
541 Ga0105245_10066768
542 Ga0105245_10257332
543 Ga0105245_10485469
544 Ga0105247_10003922
545 Ga0105247_10072077
546 Ga0114129_10159861
547 Ga0105243_10045295
548 Ga0105243_10050697
549 Ga0105241_10004689
550 Ga0105241_10005889
551 Ga0105242_10012008
552 Ga0105242_10030241
553 Ga0105248_10001317
554 Ga0105248_10002427
555 Ga0105248_10009791
556 Ga0105248_10047510
557 Ga0105248_10144365
558 Ga0105248_10539777
559 Ga0105237_10000433
560 Ga0105237_10001784
561 Ga0105237_10005706
562 Ga0105237_10078055
563 Ga0105237_10093615
564 Ga0105238_10000565
565 Ga0105238_10004812
566 Ga0105238_10008673
567 Ga0105238_10012387
568 Ga0105238_10036659
569 Ga0105238_10057392
570 Ga0105238_10211606
571 Ga0105238_10374655
572 Ga0105249_10000132
573 Ga0105249_10017008
574 Ga0105239_10000837
575 Ga0105239_10004918
576 Ga0105239_10041738
577 Ga0105239_10061813
578 Ga0105246_10000153
579 Ga0105246_10030025
580 Ga0157373_10004301
581 Ga0157371_10000442
582 Ga0157370_10003555
583 Ga0157370_10008845
584 Ga0157370_10080384
585 Ga0157370_10229723
586 Ga0157369_10000633
587 Ga0157369_10002063
588 Ga0157369_10015033
589 Ga0157369_10029620
590 Ga0157369_10084118
591 Ga0157374_10003675
592 Ga0157374_10034193
593 Ga0157374_10038187
594 Ga0157374_10452841
595 Ga0157378_10001032
596 Ga0157378_10003262
597 Ga0163162_10000929
598 Ga0163162_10075689
599 Ga0163162_10198348
600 Ga0163162_10468036
601 Ga0163162_10915837
602 Ga0157372_10000076
603 Ga0157372_10000927
604 Ga0157372_10014408
605 Ga0157372_10022753
606 Ga0157372_10097887
607 Ga0157375_10001531
608 Ga0163163_10043359
609 Ga0163163_10141372
610 Ga0163163_10245780
611 Ga0157380_10004430
612 Ga0157377_10000209
613 Ga0157377_10143381
614 Ga0157379_10003709
615 Ga0157379_10048232
616 Ga0157379_10495313
617 Ga0157376_10000781
618 Ga0163161_10030220
619 Ga0209437_104162
620 Ga0209233_1007319
621 Ga0207697_10005617
622 Ga0207682_10000150
623 Ga0207642_10001119
624 Ga0207710_10002013
625 Ga0207688_10004215
626 Ga0207680_10000785
627 Ga0207647_10010069
628 Ga0207699_10168160
629 Ga0207645_10000005
630 Ga0207643_10000061
631 Ga0207684_10000056
632 Ga0207654_10011777
633 Ga0207654_10034801
634 Ga0207654_10043106
635 Ga0207707_10001254
636 Ga0207707_10040432
637 Ga0207707_10104697
638 Ga0207695_10000509
639 Ga0207695_10000707
640 Ga0207695_10004088
641 Ga0207695_10033832
642 Ga0207671_10007204
643 Ga0207671_10111033
644 Ga0207671_10384006
645 Ga0207693_10054734
646 Ga0207663_10039943
647 Ga0207663_10479545
648 Ga0207660_10028472
649 Ga0207660_10028688
650 Ga0207660_10068992
651 Ga0207662_10000187
652 Ga0207657_10000024
653 Ga0207657_10004815
654 Ga0207649_10003956
655 Ga0207652_10000747
656 Ga0207652_10144628
657 Ga0207646_10303836
658 Ga0207681_10000443
659 Ga0207694_10001537
660 Ga0207694_10006786
661 Ga0207694_10009878
662 Ga0207694_10013230
663 Ga0207694_10029989
664 Ga0207694_10063962
665 Ga0207694_10256058
666 Ga0207650_10000451
667 Ga0207659_10000174
668 Ga0207687_10000260
669 Ga0207687_10000437
670 Ga0207687_10005243
671 Ga0207687_10010764
672 Ga0207687_10016021
673 Ga0207687_10276202
674 Ga0207687_10323270
675 Ga0207700_10100755
676 Ga0207644_10005849
677 Ga0207690_10001497
678 Ga0207706_10000063
679 Ga0207706_10047128
680 Ga0207686_10036479
681 Ga0207686_10043232
682 Ga0207686_10051964
683 Ga0207709_10090405
684 Ga0207709_10258818
685 Ga0207670_10002942
686 Ga0207669_10003774
687 Ga0207704_10000148
688 Ga0207704_10036860
689 Ga0207665_10413221
690 Ga0207691_10000118
691 Ga0207711_10000045
692 Ga0207711_10002734
693 Ga0207711_10006203
694 Ga0207711_10184755
695 Ga0207689_10000022
696 Ga0207689_10032967
697 Ga0207689_10259176
698 Ga0207661_10006661
699 Ga0207661_10026266
700 Ga0207661_10027112
701 Ga0207661_10114723
702 Ga0207661_10223232
703 Ga0207679_10000301
704 Ga0207667_10000155
705 Ga0207667_10002651
706 Ga0207667_10018865
707 Ga0207667_10025583
708 Ga0207667_10059944
709 Ga0207651_10000151
710 Ga0207651_10376973
711 Ga0207712_10000613
712 Ga0207712_10025818
713 Ga0207712_10137344
714 Ga0207668_10001465
715 Ga0207640_10001634
716 Ga0207658_10000644
717 Ga0207677_10001311
718 Ga0207677_10441627
719 Ga0207703_10001780
720 Ga0207703_10011573
721 Ga0207639_10005502
722 Ga0207639_10057732
723 Ga0207639_10600160
724 Ga0207678_10007210
725 Ga0207678_10038115
726 Ga0207708_10011109
727 Ga0207702_10007898
728 Ga0207702_10026273
729 Ga0207702_10044910
730 Ga0207702_10509808
731 Ga0207641_10001939
732 Ga0207648_10000239
733 Ga0207648_10525453
734 Ga0207648_10577553
735 Ga0207676_10000653
736 Ga0207676_10453114
737 Ga0207674_10000787
738 Ga0207674_10006079
739 Ga0207674_10014745
740 Ga0207674_10104929
741 Ga0207675_100000027
742 Ga0207675_100406952
743 Ga0207683_10000151
744 Ga0207683_10323962
745 Ga0207698_10003186
746 Ga0207698_10304529
747 Ga0209588_1000006
748 Ga0268266_10000915
749 Ga0268265_10001009
750 Ga0268264_10000409
751 Ga0268264_10083867
752 Ga0265318_10097598
753 Ga0265322_10035849
754 Ga0265338_10006297
755 Ga0265338_10006678
756 Ga0265338_10149266
757 Ga0265330_10000079
758 Ga0265332_10002299
759 Ga0265328_10005331
760 Ga0265320_10070697
761 Ga0265325_10000308
762 Ga0265329_10026386
763 Ga0265340_10007954
764 Ga0265340_10054917
765 Ga0265339_10012250
766 Ga0265316_10000767
767 Ga0265316_10001222
768 Ga0265316_10002274
769 Ga0265316_10053641
770 Ga0265313_10002477
771 Ga0265313_10021459
772 Ga0265314_10000064
773 Ga0265314_10004335
774 Ga0265314_10010893
775 Ga0265314_10022333
776 Ga0265342_10000009
777 Ga0265342_10000626
778 Ga0265342_10005737
779 Ga0265342_10045658
780 Ga0373923_0073078
781 Ga0373954_0027862
782 Ga0373946_0077477
783 Ga0373955_0145239
784 Ga0373955_0349140
785 Ga0373935_0046355
786 Ga0373927_0001103
787 Ga0373933_0006122
788 Ga0373947_0000686
789 Ga0373947_0077154
790 Ga0373937_0004420
791 Ga0373937_0474656
792 Ga0373937_0731535
793 Ga0373925_0000090
794 Ga0495592_0018214
795 Ga0495651_0037889
796 Ga0495580_0046604
797 Ga0495582_0009139
798 Ga0495639_0071640
799 Ga0495628_0146828
800 Ga0495665_0018533
801 Ga0495586_0042004
802 Ga0495587_0019318
803 Ga0495587_0110008
804 Ga0495609_0077787
805 Ga0495588_0043796
806 Ga0495599_0007925
807 Ga0495581_0134127
808 Ga0495636_0058293
809 Ga0495675_0071043
810 Ga0495684_0058750
811 Ga0495686_0000035
812 Ga0495686_0002162
813 Ga0495686_0036535
814 Ga0495602_0285396
815 Ga0496102_0005855
816 Ga0496104_0001306
817 Ga0496106_0020180
818 Ga0496108_0023157
819 Ga0496109_0010169
820 Ga0496109_0360630
821 Ga0496109_0684453
822 Ga0496112_0007904
823 Ga0496121_0226157
824 Ga0496126_0000110
825 Ga0501071_0055982
826 Ga0501072_0544486
827 Ga0501035_0000106
828 nmdc:mga05p37_237637_c1
829 nmdc:mga05p37_524518_c1
830 nmdc:mga09592_231515_c1
831 nmdc:mga0qj67_24786_c1
832 nmdc:mga06r32_20610_c1
833 nmdc:mga06r32_68144_c1
834 Ga0495601_0093335
835 Ga0500593_000301
836 Ga0500595_007882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

35

290

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9428 3 296
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.931 3 296
1obd-assembly1.cif.gz_A saicar-synthase complexed with atp 0.929 3 295
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9275 3 296
2cnv-assembly1.cif.gz_A saicar-synthase from saccharomyces cerevisiae complexed saicar 0.9257 3 296
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.968 105 247 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9612 105 247 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9485 105 247 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9358 105 247 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9304 107 240 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A4Q1SD59-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 1 1 296 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A660RVY6-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9991 2 97 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-X0V669-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9947 1 147 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2V9U4I8-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9943 170 296 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A354F885-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9934 31 290 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map