F439341

General Info

Members Datasets Scaffolds Average Seq Length
418 253 836 169

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0111601|Ga0395899_0111601_639_1235
Length 193
Sequence MRFPPRVPGCTTDTARSSRPGVEAGDRTVTDQVIRVYVPATVTTLATLQKHGELGPAPVAAHAVTPALREWYAEGDEEELEYVAFTRAAQGALRLLRGDVAAPPRRVVISADLGASEVMREDFELGSSVVRLRSPIPLGAVAAIHVDGPAAAADVAEEEALAGDPDAQFTVDGAEDHELEWYDVSELDTLIDG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
201 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2501939600 Micromonospora sp. L5 Isolate Unclassified
208 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
209 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
210 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
211 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
212 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
213 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
214 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
215 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
216 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
217 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
218 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
219 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
220 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
221 2855683550 Micromonospora sp. RP3T Isolate Unclassified
222 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
223 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
224 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
225 2858868258 Micromonospora sp. MH33 Isolate Unclassified
226 2858882152 Micromonospora noduli MED15 Isolate Nodule
227 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
228 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
229 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
230 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
231 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
232 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
233 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
234 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
235 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
236 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
237 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
238 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
239 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
240 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
241 2902582711 Micromonospora sp. AP08 Isolate Unclassified
242 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
243 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
244 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
245 649633069 Micromonospora sp. L5 Isolate Unclassified
246 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
247 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
248 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
249 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
250 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
251 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
252 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
253 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.04
Metatranscriptomes 0.48
Isolates 11.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 1.44
Rhizoplane 4.78
Rhizosphere 79.9
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0111601 3300037312 Bacteria 1965
2 JGI25406J46586_10002353 3300003203 Bacteria 8937
3 rootH1_10028861 3300003316 Bacteria 2300
4 rootH2_10091392 3300003320 Bacteria 4055
5 Ga0070658_10002291 3300005327 Bacteria 16049
6 Ga0070658_11022065 3300005327 Bacteria 719
7 Ga0070676_10464000 3300005328 Bacteria 893
8 Ga0070683_100091104 3300005329 Bacteria 2863
9 Ga0070683_100116573 3300005329 Bacteria 2522
10 Ga0068869_100003606 3300005334 Bacteria 9499
11 Ga0068869_101346238 3300005334 Bacteria 631
12 Ga0070680_100293625 3300005336 Bacteria 1378
13 Ga0070682_100229755 3300005337 Bacteria 1325
14 Ga0070682_100772105 3300005337 Bacteria 778
15 Ga0068868_100010826 3300005338 Bacteria 6617
16 Ga0070660_100076370 3300005339 Bacteria 2624
17 Ga0070660_100249479 3300005339 Bacteria 1447
18 Ga0070687_100030958 3300005343 Bacteria 2620
19 Ga0070661_100070701 3300005344 Bacteria 2567
20 Ga0070661_100072167 3300005344 Bacteria 2540
21 Ga0070668_100014004 3300005347 Bacteria 5997
22 Ga0070668_100050088 3300005347 Bacteria 3215
23 Ga0070669_100220266 3300005353 Bacteria 1500
24 Ga0070675_100000474 3300005354 Bacteria 27485
25 Ga0070675_100059224 3300005354 Bacteria 3159
26 Ga0070659_100033471 3300005366 Bacteria 3992
27 Ga0070659_100104124 3300005366 Bacteria 2286
28 Ga0070667_100136791 3300005367 Bacteria 2142
29 Ga0070713_100519203 3300005436 Bacteria 1125
30 Ga0070710_10070158 3300005437 Bacteria 2018
31 Ga0070700_100021673 3300005441 Bacteria 3738
32 Ga0070700_100151348 3300005441 Bacteria 1587
33 Ga0070663_100187978 3300005455 Bacteria 1606
34 Ga0070663_100843984 3300005455 Bacteria 788
35 Ga0070663_100992031 3300005455 Bacteria 730
36 Ga0070678_100056603 3300005456 Bacteria 2869
37 Ga0070678_100393758 3300005456 Bacteria 1202
38 Ga0070681_10195040 3300005458 Bacteria 1944
39 Ga0070681_11194026 3300005458 Bacteria 683
40 Ga0070706_100869917 3300005467 Bacteria 833
41 Ga0070679_100084340 3300005530 Bacteria 3165
42 Ga0070679_100295127 3300005530 Bacteria 1572
43 Ga0070684_100004315 3300005535 Bacteria 10800
44 Ga0070684_100014776 3300005535 Bacteria 6335
45 Ga0070684_100246988 3300005535 Bacteria 1631
46 Ga0070672_100876518 3300005543 Bacteria 792
47 Ga0070695_100623138 3300005545 Bacteria 849
48 Ga0070693_100067912 3300005547 Bacteria 2091
49 Ga0070665_100430368 3300005548 Bacteria 1329
50 Ga0070664_100002642 3300005564 Bacteria 14460
51 Ga0070664_100065295 3300005564 Bacteria 3105
52 Ga0070664_100120807 3300005564 Bacteria 2294
53 Ga0068857_100546451 3300005577 Bacteria 1091
54 Ga0068854_100110700 3300005578 Bacteria 2071
55 Ga0068856_100487322 3300005614 Bacteria 1254
56 Ga0070702_100226661 3300005615 Bacteria 1253
57 Ga0068852_100212702 3300005616 Bacteria 1835
58 Ga0068852_101030637 3300005616 Bacteria 842
59 Ga0068859_100027347 3300005617 Bacteria 5721
60 Ga0068859_100449356 3300005617 Bacteria 1385
61 Ga0068859_101102839 3300005617 Bacteria 873
62 Ga0068864_100479604 3300005618 Bacteria 1193
63 Ga0068861_100063287 3300005719 Bacteria 2844
64 Ga0068870_10206382 3300005840 Bacteria 1194
65 Ga0068863_100006850 3300005841 Bacteria 11173
66 Ga0068863_100516215 3300005841 Bacteria 1178
67 Ga0068863_100542634 3300005841 Bacteria 1148
68 Ga0068858_100007354 3300005842 Bacteria 10657
69 Ga0068858_100054008 3300005842 Bacteria 3716
70 Ga0068858_100348218 3300005842 Bacteria 1419
71 Ga0068862_100023243 3300005844 Bacteria 5193
72 Ga0068862_100047418 3300005844 Bacteria 3667
73 Ga0068862_100220759 3300005844 Bacteria 1716
74 Ga0081540_1025663 3300005983 Bacteria 3385
75 Ga0081540_1053477 3300005983 Bacteria 1980
76 Ga0081539_10000580 3300005985 Bacteria 75235
77 Ga0081539_10002494 3300005985 Bacteria 25836
78 Ga0081539_10002579 3300005985 Bacteria 25009
79 Ga0081539_10010149 3300005985 Bacteria 7720
80 Ga0081539_10022423 3300005985 Bacteria 4178
81 Ga0081539_10125625 3300005985 Bacteria 1268
82 Ga0081539_10130807 3300005985 Bacteria 1233
83 Ga0081539_10310347 3300005985 Bacteria 674
84 Ga0075432_10097904 3300006058 Bacteria 1081
85 Ga0068871_100892282 3300006358 Bacteria 824
86 Ga0075428_100000806 3300006844 Bacteria 32759
87 Ga0075428_100002800 3300006844 Bacteria 18979
88 Ga0075428_100003332 3300006844 Bacteria 17575
89 Ga0075428_100131277 3300006844 Bacteria 2724
90 Ga0075428_100239218 3300006844 Bacteria 1959
91 Ga0075428_100329280 3300006844 Bacteria 1641
92 Ga0075428_101546415 3300006844 Bacteria 694
93 Ga0075430_100000718 3300006846 Bacteria 25302
94 Ga0075430_100003019 3300006846 Bacteria 14084
95 Ga0075430_100010462 3300006846 Bacteria 7855
96 Ga0075430_100190621 3300006846 Bacteria 1704
97 Ga0075430_100403017 3300006846 Bacteria 1129
98 Ga0075430_100680739 3300006846 Bacteria 848
99 Ga0075431_100000952 3300006847 Bacteria 25594
100 Ga0075431_100033937 3300006847 Bacteria 5258
101 Ga0075431_100091583 3300006847 Bacteria 3138
102 Ga0075431_100495737 3300006847 Bacteria 1213
103 Ga0075431_101237305 3300006847 Unclassified 709
104 Ga0075429_100003116 3300006880 Bacteria 14084
105 Ga0075429_100010863 3300006880 Bacteria 7874
106 Ga0075429_100474014 3300006880 Bacteria 1097
107 Ga0068865_100062547 3300006881 Bacteria 2613
108 Ga0097620_100027348 3300006931 Bacteria 5721
109 Ga0097620_100449358 3300006931 Bacteria 1385
110 Ga0097620_101102925 3300006931 Bacteria 873
111 Ga0105250_10268256 3300009092 Bacteria 732
112 Ga0111539_10010088 3300009094 Bacteria 11906
113 Ga0105245_10011114 3300009098 Bacteria 7837
114 Ga0105245_10615144 3300009098 Bacteria 1114
115 Ga0105245_11835411 3300009098 Bacteria 659
116 Ga0114129_10000860 3300009147 Bacteria 39443
117 Ga0114129_10005289 3300009147 Bacteria 18212
118 Ga0114129_10012667 3300009147 Bacteria 12007
119 Ga0114129_10409398 3300009147 Bacteria 1786
120 Ga0105243_10863863 3300009148 Bacteria 897
121 Ga0105243_11769743 3300009148 Bacteria 648
122 Ga0105242_10434310 3300009176 Bacteria 1234
123 Ga0105248_10040543 3300009177 Bacteria 5220
124 Ga0105248_10346741 3300009177 Bacteria 1672
125 Ga0105248_11023253 3300009177 Bacteria 933
126 Ga0105237_10550568 3300009545 Bacteria 1160
127 Ga0105239_10040086 3300010375 Bacteria 5131
128 Ga0105239_11265343 3300010375 Bacteria 851
129 Ga0157371_10849267 3300013102 Bacteria 690
130 Ga0157369_10164289 3300013105 Bacteria 2342
131 Ga0157378_10488200 3300013297 Bacteria 1228
132 Ga0163162_10229286 3300013306 Bacteria 1987
133 Ga0157372_10504964 3300013307 Bacteria 1410
134 Ga0157375_11373159 3300013308 Bacteria 832
135 Ga0163163_10022605 3300014325 Bacteria 5960
136 Ga0163163_10184602 3300014325 Bacteria 2133
137 Ga0163163_10219619 3300014325 Bacteria 1949
138 Ga0163163_11273334 3300014325 Bacteria 798
139 Ga0163163_11418643 3300014325 Bacteria 756
140 Ga0157380_10396015 3300014326 Bacteria 1308
141 Ga0157380_10816690 3300014326 Bacteria 951
142 Ga0157377_10068922 3300014745 Bacteria 2039
143 Ga0157377_10701547 3300014745 Bacteria 735
144 Ga0157379_10028196 3300014968 Bacteria 4998
145 Ga0157379_11077357 3300014968 Bacteria 769
146 Ga0157376_10962018 3300014969 Bacteria 875
147 Ga0206353_10423147 3300020082 Bacteria 2010
148 Ga0224712_10127606 3300022467 Bacteria 1108
149 Ga0207688_10129379 3300025901 Bacteria 1479
150 Ga0207699_10252469 3300025906 Bacteria 1216
151 Ga0207645_10370169 3300025907 Bacteria 961
152 Ga0207643_10265232 3300025908 Bacteria 1061
153 Ga0207705_10076216 3300025909 Bacteria 2438
154 Ga0207705_10527379 3300025909 Bacteria 918
155 Ga0207693_10102589 3300025915 Bacteria 2243
156 Ga0207660_10674275 3300025917 Bacteria 843
157 Ga0207662_10115274 3300025918 Bacteria 1679
158 Ga0207657_10073727 3300025919 Bacteria 2884
159 Ga0207649_10349822 3300025920 Bacteria 1093
160 Ga0207652_10177905 3300025921 Bacteria 1911
161 Ga0207652_10535135 3300025921 Bacteria 1054
162 Ga0207652_10542876 3300025921 Bacteria 1045
163 Ga0207681_10072500 3300025923 Bacteria 2406
164 Ga0207650_10437129 3300025925 Bacteria 1087
165 Ga0207650_10541239 3300025925 Bacteria 976
166 Ga0207659_10008584 3300025926 Bacteria 6352
167 Ga0207687_10229066 3300025927 Bacteria 1467
168 Ga0207687_10515933 3300025927 Bacteria 999
169 Ga0207700_10207149 3300025928 Bacteria 1656
170 Ga0207690_10049295 3300025932 Bacteria 2807
171 Ga0207690_10481057 3300025932 Bacteria 1002
172 Ga0207706_10018946 3300025933 Bacteria 6189
173 Ga0207686_10777432 3300025934 Bacteria 766
174 Ga0207709_10315183 3300025935 Bacteria 1168
175 Ga0207704_10365584 3300025938 Bacteria 1128
176 Ga0207665_10036508 3300025939 Bacteria 3268
177 Ga0207691_10803148 3300025940 Bacteria 791
178 Ga0207711_10139342 3300025941 Bacteria 2181
179 Ga0207689_10017358 3300025942 Bacteria 6090
180 Ga0207689_10331972 3300025942 Bacteria 1263
181 Ga0207661_10007445 3300025944 Bacteria 7791
182 Ga0207661_10018102 3300025944 Bacteria 5231
183 Ga0207661_10327378 3300025944 Bacteria 1378
184 Ga0207679_10005249 3300025945 Bacteria 8119
185 Ga0207679_10128589 3300025945 Bacteria 2028
186 Ga0207679_10427921 3300025945 Bacteria 1170
187 Ga0207679_10495524 3300025945 Bacteria 1089
188 Ga0207668_10036258 3300025972 Bacteria 3290
189 Ga0207668_10043889 3300025972 Bacteria 3037
190 Ga0207640_10366270 3300025981 Bacteria 1163
191 Ga0207658_10951720 3300025986 Bacteria 783
192 Ga0207677_10017847 3300026023 Bacteria 4244
193 Ga0207703_10100046 3300026035 Bacteria 2456
194 Ga0207703_10179986 3300026035 Bacteria 1865
195 Ga0207678_10037648 3300026067 Bacteria 4207
196 Ga0207678_10479333 3300026067 Bacteria 1083
197 Ga0207708_10173304 3300026075 Bacteria 1710
198 Ga0207702_10859032 3300026078 Bacteria 898
199 Ga0207702_11274163 3300026078 Bacteria 729
200 Ga0207641_10031956 3300026088 Bacteria 4368
201 Ga0207641_10811741 3300026088 Bacteria 926
202 Ga0207641_11228095 3300026088 Bacteria 749
203 Ga0207676_10102864 3300026095 Bacteria 2372
204 Ga0207676_10228860 3300026095 Bacteria 1661
205 Ga0207674_10021848 3300026116 Bacteria 6885
206 Ga0207674_10039302 3300026116 Bacteria 4905
207 Ga0207675_100012015 3300026118 Bacteria 8093
208 Ga0207675_101440860 3300026118 Bacteria 709
209 Ga0207683_10094511 3300026121 Bacteria 2664
210 Ga0207683_10126892 3300026121 Bacteria 2293
211 Ga0207698_10031097 3300026142 Bacteria 3849
212 Ga0207428_10231339 3300027907 Bacteria 1383
213 Ga0268266_10013700 3300028379 Bacteria 6983
214 Ga0268266_10502843 3300028379 Bacteria 1157
215 Ga0268266_11409720 3300028379 Bacteria 672
216 Ga0268265_10052596 3300028380 Bacteria 3081
217 Ga0268265_10205986 3300028380 Bacteria 1710
218 Ga0268264_10256112 3300028381 Bacteria 1628
219 Ga0307515_10000205 3300028794 Bacteria 144874
220 Ga0307515_10037515 3300028794 Bacteria 7791
221 Ga0307515_10044433 3300028794 Bacteria 6864
222 Ga0307515_10053464 3300028794 Bacteria 5958
223 Ga0307512_10029769 3300030522 Bacteria 4762
224 Ga0307512_10029964 3300030522 Bacteria 4741
225 Ga0307513_10025696 3300031456 Bacteria 6815
226 Ga0307513_10047087 3300031456 Bacteria 4693
227 Ga0307509_10020745 3300031507 Bacteria 7454
228 Ga0307408_100146925 3300031548 Bacteria 1857
229 Ga0307508_10002304 3300031616 Bacteria 20274
230 Ga0307508_10555016 3300031616 Bacteria 747
231 Ga0307514_10283659 3300031649 Bacteria 945
232 Ga0307516_10009973 3300031730 Bacteria 10519
233 Ga0307516_10021531 3300031730 Bacteria 6630
234 Ga0307516_10023643 3300031730 Bacteria 6291
235 Ga0307516_10051560 3300031730 Bacteria 4032
236 Ga0307405_10010307 3300031731 Bacteria 4833
237 Ga0307405_10069605 3300031731 Bacteria 2257
238 Ga0307405_10188884 3300031731 Bacteria 1486
239 Ga0307405_10251975 3300031731 Bacteria 1314
240 Ga0307405_10289025 3300031731 Bacteria 1238
241 Ga0307413_10047855 3300031824 Bacteria 2553
242 Ga0307413_10576999 3300031824 Bacteria 917
243 Ga0307410_10213096 3300031852 Bacteria 1481
244 Ga0307410_10287560 3300031852 Bacteria 1293
245 Ga0307410_10460737 3300031852 Bacteria 1039
246 Ga0326468_10000681 3300031889 Bacteria 3464
247 Ga0307406_10002775 3300031901 Bacteria 9562
248 Ga0307406_10063287 3300031901 Bacteria 2396
249 Ga0307406_10111951 3300031901 Bacteria 1881
250 Ga0307406_10732903 3300031901 Bacteria 828
251 Ga0307407_10030689 3300031903 Bacteria 2902
252 Ga0307407_10352937 3300031903 Bacteria 1042
253 Ga0307412_10015111 3300031911 Bacteria 4568
254 Ga0307412_10285340 3300031911 Bacteria 1298
255 Ga0307409_100001123 3300031995 Bacteria 12683
256 Ga0307409_100081624 3300031995 Bacteria 2614
257 Ga0307409_100120229 3300031995 Bacteria 2223
258 Ga0307409_101100223 3300031995 Bacteria 816
259 Ga0307409_102023262 3300031995 Bacteria 606
260 Ga0307416_100002435 3300032002 Bacteria 10686
261 Ga0307416_100411388 3300032002 Bacteria 1393
262 Ga0307416_100605305 3300032002 Bacteria 1176
263 Ga0307416_101309681 3300032002 Bacteria 830
264 Ga0307411_11142753 3300032005 Bacteria 704
265 Ga0307415_100000071 3300032126 Bacteria 42220
266 Ga0307415_100039861 3300032126 Bacteria 3108
267 Ga0307415_100089738 3300032126 Bacteria 2221
268 Ga0307415_100115735 3300032126 Bacteria 1999
269 Ga0307415_100213718 3300032126 Bacteria 1541
270 Ga0307415_100615471 3300032126 Bacteria 969
271 Ga0307415_100711788 3300032126 Bacteria 907
272 Ga0307415_100883084 3300032126 Bacteria 823
273 Ga0373948_0040727 3300034817 Bacteria 971
274 Ga0373950_0049519 3300034818 Bacteria 822
275 Ga0373938_0035848 3300034957 Bacteria 1083
276 Ga0373928_0010032 3300035084 Bacteria 1856
277 Ga0373940_0014516 3300035088 Bacteria 1923
278 Ga0373932_0143594 3300035112 Bacteria 814
279 Ga0373953_0098837 3300035117 Bacteria 1227
280 Ga0373942_0022404 3300035207 Bacteria 1602
281 Ga0373962_0107221 3300035242 Bacteria 877
282 Ga0373927_0153093 3300035695 Bacteria 1510
283 Ga0373937_0613389 3300036401 Bacteria 1033
284 Ga0395900_0002497 3300037418 Bacteria 20218
285 Ga0395900_0189182 3300037418 Bacteria 2089
286 Ga0395898_0001600 3300037466 Bacteria 30893
287 Ga0395898_0046140 3300037466 Bacteria 4280
288 Ga0395905_0002372 3300037471 Bacteria 20988
289 Ga0395905_0238184 3300037471 Bacteria 1701
290 Ga0436364_0029805 3300037853 Bacteria 519
291 Ga0395901_0005296 3300038443 Bacteria 13039
292 Ga0395901_0029795 3300038443 Bacteria 5621
293 Ga0451791_0682123 3300041451 Bacteria 1016
294 Ga0451802_0023024 3300041460 Bacteria 569
295 Ga0451802_0345369 3300041460 Bacteria 745
296 Ga0466966_0713277 3300044684 Bacteria 604
297 Ga0495629_0050044 3300046459 Bacteria 2928
298 Ga0495629_0070221 3300046459 Bacteria 2444
299 Ga0495638_0198110 3300046460 Bacteria 1135
300 Ga0495585_0367204 3300046492 Bacteria 697
301 Ga0495594_0008339 3300046499 Bacteria 5337
302 Ga0495594_0108683 3300046499 Bacteria 1563
303 Ga0495606_0001361 3300046507 Bacteria 33067
304 Ga0495632_0013488 3300046519 Bacteria 4662
305 Ga0495640_0336162 3300046533 Bacteria 934
306 Ga0495668_0000540 3300046616 Bacteria 47111
307 Ga0495625_0000464 3300046660 Bacteria 60878
308 Ga0495674_0410788 3300047319 Bacteria 1092
309 Ga0495593_0309902 3300047673 Bacteria 789
310 Ga0495626_0000278 3300048091 Bacteria 56260
311 Ga0496105_0023949 3300048908 Bacteria 4959
312 Ga0496105_0233073 3300048908 Bacteria 1496
313 Ga0496108_0000117 3300048911 Bacteria 78204
314 Ga0496108_0005676 3300048911 Bacteria 10102
315 Ga0496108_0490048 3300048911 Bacteria 1074
316 Ga0496109_0042047 3300048912 Bacteria 4139
317 Ga0496110_0040069 3300048913 Bacteria 4082
318 Ga0496110_0478812 3300048913 Bacteria 1134
319 Ga0496112_0017600 3300048915 Bacteria 6719
320 Ga0496112_0039622 3300048915 Bacteria 4605
321 Ga0496112_0081283 3300048915 Bacteria 3204
322 Ga0496112_0151381 3300048915 Bacteria 2287
323 Ga0496112_0259061 3300048915 Bacteria 1689
324 Ga0496112_0356573 3300048915 Bacteria 1405
325 Ga0496112_0579732 3300048915 Bacteria 1054
326 Ga0496113_0002915 3300048916 Bacteria 10094
327 Ga0496113_0667703 3300048916 Bacteria 831
328 Ga0501032_0051750 3300049569 Bacteria 2769
329 Ga0501037_0044883 3300049573 Bacteria 3245
330 Ga0501040_1054361 3300049576 Bacteria 589
331 Ga0501046_0138853 3300049580 Bacteria 1840
332 Ga0501047_0439622 3300049581 Bacteria 1134
333 Ga0501048_0365852 3300049582 Bacteria 1029
334 Ga0501074_0072564 3300049590 Bacteria 2473
335 Ga0501035_0596029 3300049822 Bacteria 901
336 Ga0501044_0257635 3300049823 Bacteria 1683
337 Ga0501044_0555522 3300049823 Bacteria 1045
338 Ga0501045_0306165 3300049824 Bacteria 1183
339 Ga0501045_1098556 3300049824 Bacteria 582
340 nmdc:mga05p37_1019966_c1 3300050507 Bacteria 877
341 nmdc:mga05p37_448_c1 3300050507 Bacteria 44738
342 nmdc:mga05p37_6983_c1 3300050507 Bacteria 13307
343 nmdc:mga09592_130224_c1 3300050508 Bacteria 2164
344 nmdc:mga09592_13_c1 3300050508 Bacteria 101979
345 nmdc:mga09592_23367_c1 3300050508 Bacteria 5107
346 nmdc:mga09592_735770_c1 3300050508 Bacteria 838
347 nmdc:mga0qj67_1152_c1 3300050509 Bacteria 18289
348 nmdc:mga0qj67_266_c1 3300050509 Bacteria 35948
349 nmdc:mga0qj67_353407_c1 3300050509 Unclassified 1188
350 nmdc:mga0qj67_392570_c1 3300050509 Bacteria 1120
351 nmdc:mga0qj67_992833_c1 3300050509 Bacteria 659
352 nmdc:mga06r32_24_c1 3300050510 Bacteria 92238
353 nmdc:mga06r32_260277_c1 3300050510 Bacteria 1722
354 nmdc:mga06r32_26437_c1 3300050510 Bacteria 5411
355 nmdc:mga06r32_49118_c2 3300050510 Bacteria 2451
356 nmdc:mga06r32_7360_c1 3300050510 Bacteria 9908
357 nmdc:mga08y16_215376_c1 3300050511 Bacteria 1989
358 Ga0495601_0428807 3300053077 Bacteria 856
359 Ga0500644_0192542 3300053088 Bacteria 840
360 Ga0500651_0027214 3300053093 Bacteria 3595
361 Ga0500650_0055024 3300053098 Bacteria 1853
362 Ga0500556_0028055 3300053104 Bacteria 1886
363 Ga0500562_063472 3300053108 Bacteria 994
364 Ga0500569_076308 3300053109 Bacteria 1064
365 Ga0500594_0001708 3300053118 Bacteria 4790
366 Ga0500652_011127 3300053131 Bacteria 3109
367 Ga0500568_0002143 3300053139 Bacteria 11908
368 Ga0500577_0115573 3300053142 Bacteria 1112
369 Ga0500633_0034334 3300053160 Bacteria 1663
370 Ga0530510_0084630 3300061734 Bacteria 2310
371 2501944659 2501939600 Bacteria 6907073
372 2515493666 2515154088 Bacteria 5526283
373 2515720577 2515154129 Bacteria 5584369
374 2515755056 2515154137 Bacteria 5711575
375 2516084145 2515154202 Bacteria 5471270
376 2516087802 2515154203 Bacteria 5458536
377 2623586782 2622736626 Bacteria 7181580
378 2676480438 2675903059 Bacteria 8644972
379 2753263542 2751185782 Bacteria 11227053
380 2772646230 2772190715 Bacteria 6959372
381 2831938657 2831935698 Bacteria 5963223
382 2832006395 2832004796 Bacteria 6538017
383 2855671428 2855670206 Bacteria 7120389
384 2855680671 2855676851 Bacteria 7063653
385 2855684818 2855683550 Bacteria 7134265
386 2856860692 2856858025 Bacteria 7255264
387 2857292124 2857288857 Bacteria 7189066
388 2858854594 2858848962 Bacteria 6963058
389 2858870800 2858868258 Bacteria 7683772
390 2858883720 2858882152 Bacteria 7230291
391 2858894200 2858888857 Bacteria 7060307
392 2858901070 2858895516 Bacteria 7378898
393 2858903468 2858902515 Bacteria 7086037
394 2866067241 2866065130 Bacteria 6518152
395 2867306549 2867302475 Bacteria 7087181
396 2867313037 2867312974 Bacteria 7058875
397 2867325061 2867319477 Bacteria 7069771
398 2867509632 2867507094 Bacteria 6506033
399 2869050076 2869048445 Bacteria 6875584
400 2869068067 2869061728 Bacteria 7112407
401 2869070791 2869068681 Bacteria 7205615
402 2880493424 2880489317 Bacteria 7096270
403 2880498883 2880495981 Bacteria 7340502
404 2887483935 2887478801 Bacteria 8972725
405 2902585562 2902582711 Bacteria 6187705
406 2929220889 2929219909 Bacteria 6984360
407 2929227474 2929226422 Bacteria 7248583
408 2996225732 2996221748 Bacteria 6799777
409 649811427 649633069 Bacteria 6962533
410 8001783708 8001781756 Bacteria 9586736
411 8001784828 8001781756 Bacteria 9586736
412 8003834798 8003830390 Bacteria 6541657
413 8003860034 8003856774 Bacteria 7675274
414 8003876984 8003870546 Bacteria 7396674
415 8054710881 8054704163 Bacteria 7247792
416 8054727532 8054727385 Bacteria 7558670
417 8054734978 8054734606 Bacteria 6947278
418 8055413709 8055412473 Bacteria 6257500
419 Ga0395899_0111601
420 JGI25406J46586_10002353
421 rootH1_10028861
422 rootH2_10091392
423 Ga0070658_10002291
424 Ga0070658_11022065
425 Ga0070676_10464000
426 Ga0070683_100091104
427 Ga0070683_100116573
428 Ga0068869_100003606
429 Ga0068869_101346238
430 Ga0070680_100293625
431 Ga0070682_100229755
432 Ga0070682_100772105
433 Ga0068868_100010826
434 Ga0070660_100076370
435 Ga0070660_100249479
436 Ga0070687_100030958
437 Ga0070661_100070701
438 Ga0070661_100072167
439 Ga0070668_100014004
440 Ga0070668_100050088
441 Ga0070669_100220266
442 Ga0070675_100000474
443 Ga0070675_100059224
444 Ga0070659_100033471
445 Ga0070659_100104124
446 Ga0070667_100136791
447 Ga0070713_100519203
448 Ga0070710_10070158
449 Ga0070700_100021673
450 Ga0070700_100151348
451 Ga0070663_100187978
452 Ga0070663_100843984
453 Ga0070663_100992031
454 Ga0070678_100056603
455 Ga0070678_100393758
456 Ga0070681_10195040
457 Ga0070681_11194026
458 Ga0070706_100869917
459 Ga0070679_100084340
460 Ga0070679_100295127
461 Ga0070684_100004315
462 Ga0070684_100014776
463 Ga0070684_100246988
464 Ga0070672_100876518
465 Ga0070695_100623138
466 Ga0070693_100067912
467 Ga0070665_100430368
468 Ga0070664_100002642
469 Ga0070664_100065295
470 Ga0070664_100120807
471 Ga0068857_100546451
472 Ga0068854_100110700
473 Ga0068856_100487322
474 Ga0070702_100226661
475 Ga0068852_100212702
476 Ga0068852_101030637
477 Ga0068859_100027347
478 Ga0068859_100449356
479 Ga0068859_101102839
480 Ga0068864_100479604
481 Ga0068861_100063287
482 Ga0068870_10206382
483 Ga0068863_100006850
484 Ga0068863_100516215
485 Ga0068863_100542634
486 Ga0068858_100007354
487 Ga0068858_100054008
488 Ga0068858_100348218
489 Ga0068862_100023243
490 Ga0068862_100047418
491 Ga0068862_100220759
492 Ga0081540_1025663
493 Ga0081540_1053477
494 Ga0081539_10000580
495 Ga0081539_10002494
496 Ga0081539_10002579
497 Ga0081539_10010149
498 Ga0081539_10022423
499 Ga0081539_10125625
500 Ga0081539_10130807
501 Ga0081539_10310347
502 Ga0075432_10097904
503 Ga0068871_100892282
504 Ga0075428_100000806
505 Ga0075428_100002800
506 Ga0075428_100003332
507 Ga0075428_100131277
508 Ga0075428_100239218
509 Ga0075428_100329280
510 Ga0075428_101546415
511 Ga0075430_100000718
512 Ga0075430_100003019
513 Ga0075430_100010462
514 Ga0075430_100190621
515 Ga0075430_100403017
516 Ga0075430_100680739
517 Ga0075431_100000952
518 Ga0075431_100033937
519 Ga0075431_100091583
520 Ga0075431_100495737
521 Ga0075431_101237305
522 Ga0075429_100003116
523 Ga0075429_100010863
524 Ga0075429_100474014
525 Ga0068865_100062547
526 Ga0097620_100027348
527 Ga0097620_100449358
528 Ga0097620_101102925
529 Ga0105250_10268256
530 Ga0111539_10010088
531 Ga0105245_10011114
532 Ga0105245_10615144
533 Ga0105245_11835411
534 Ga0114129_10000860
535 Ga0114129_10005289
536 Ga0114129_10012667
537 Ga0114129_10409398
538 Ga0105243_10863863
539 Ga0105243_11769743
540 Ga0105242_10434310
541 Ga0105248_10040543
542 Ga0105248_10346741
543 Ga0105248_11023253
544 Ga0105237_10550568
545 Ga0105239_10040086
546 Ga0105239_11265343
547 Ga0157371_10849267
548 Ga0157369_10164289
549 Ga0157378_10488200
550 Ga0163162_10229286
551 Ga0157372_10504964
552 Ga0157375_11373159
553 Ga0163163_10022605
554 Ga0163163_10184602
555 Ga0163163_10219619
556 Ga0163163_11273334
557 Ga0163163_11418643
558 Ga0157380_10396015
559 Ga0157380_10816690
560 Ga0157377_10068922
561 Ga0157377_10701547
562 Ga0157379_10028196
563 Ga0157379_11077357
564 Ga0157376_10962018
565 Ga0206353_10423147
566 Ga0224712_10127606
567 Ga0207688_10129379
568 Ga0207699_10252469
569 Ga0207645_10370169
570 Ga0207643_10265232
571 Ga0207705_10076216
572 Ga0207705_10527379
573 Ga0207693_10102589
574 Ga0207660_10674275
575 Ga0207662_10115274
576 Ga0207657_10073727
577 Ga0207649_10349822
578 Ga0207652_10177905
579 Ga0207652_10535135
580 Ga0207652_10542876
581 Ga0207681_10072500
582 Ga0207650_10437129
583 Ga0207650_10541239
584 Ga0207659_10008584
585 Ga0207687_10229066
586 Ga0207687_10515933
587 Ga0207700_10207149
588 Ga0207690_10049295
589 Ga0207690_10481057
590 Ga0207706_10018946
591 Ga0207686_10777432
592 Ga0207709_10315183
593 Ga0207704_10365584
594 Ga0207665_10036508
595 Ga0207691_10803148
596 Ga0207711_10139342
597 Ga0207689_10017358
598 Ga0207689_10331972
599 Ga0207661_10007445
600 Ga0207661_10018102
601 Ga0207661_10327378
602 Ga0207679_10005249
603 Ga0207679_10128589
604 Ga0207679_10427921
605 Ga0207679_10495524
606 Ga0207668_10036258
607 Ga0207668_10043889
608 Ga0207640_10366270
609 Ga0207658_10951720
610 Ga0207677_10017847
611 Ga0207703_10100046
612 Ga0207703_10179986
613 Ga0207678_10037648
614 Ga0207678_10479333
615 Ga0207708_10173304
616 Ga0207702_10859032
617 Ga0207702_11274163
618 Ga0207641_10031956
619 Ga0207641_10811741
620 Ga0207641_11228095
621 Ga0207676_10102864
622 Ga0207676_10228860
623 Ga0207674_10021848
624 Ga0207674_10039302
625 Ga0207675_100012015
626 Ga0207675_101440860
627 Ga0207683_10094511
628 Ga0207683_10126892
629 Ga0207698_10031097
630 Ga0207428_10231339
631 Ga0268266_10013700
632 Ga0268266_10502843
633 Ga0268266_11409720
634 Ga0268265_10052596
635 Ga0268265_10205986
636 Ga0268264_10256112
637 Ga0307515_10000205
638 Ga0307515_10037515
639 Ga0307515_10044433
640 Ga0307515_10053464
641 Ga0307512_10029769
642 Ga0307512_10029964
643 Ga0307513_10025696
644 Ga0307513_10047087
645 Ga0307509_10020745
646 Ga0307408_100146925
647 Ga0307508_10002304
648 Ga0307508_10555016
649 Ga0307514_10283659
650 Ga0307516_10009973
651 Ga0307516_10021531
652 Ga0307516_10023643
653 Ga0307516_10051560
654 Ga0307405_10010307
655 Ga0307405_10069605
656 Ga0307405_10188884
657 Ga0307405_10251975
658 Ga0307405_10289025
659 Ga0307413_10047855
660 Ga0307413_10576999
661 Ga0307410_10213096
662 Ga0307410_10287560
663 Ga0307410_10460737
664 Ga0326468_10000681
665 Ga0307406_10002775
666 Ga0307406_10063287
667 Ga0307406_10111951
668 Ga0307406_10732903
669 Ga0307407_10030689
670 Ga0307407_10352937
671 Ga0307412_10015111
672 Ga0307412_10285340
673 Ga0307409_100001123
674 Ga0307409_100081624
675 Ga0307409_100120229
676 Ga0307409_101100223
677 Ga0307409_102023262
678 Ga0307416_100002435
679 Ga0307416_100411388
680 Ga0307416_100605305
681 Ga0307416_101309681
682 Ga0307411_11142753
683 Ga0307415_100000071
684 Ga0307415_100039861
685 Ga0307415_100089738
686 Ga0307415_100115735
687 Ga0307415_100213718
688 Ga0307415_100615471
689 Ga0307415_100711788
690 Ga0307415_100883084
691 Ga0373948_0040727
692 Ga0373950_0049519
693 Ga0373938_0035848
694 Ga0373928_0010032
695 Ga0373940_0014516
696 Ga0373932_0143594
697 Ga0373953_0098837
698 Ga0373942_0022404
699 Ga0373962_0107221
700 Ga0373927_0153093
701 Ga0373937_0613389
702 Ga0395900_0002497
703 Ga0395900_0189182
704 Ga0395898_0001600
705 Ga0395898_0046140
706 Ga0395905_0002372
707 Ga0395905_0238184
708 Ga0436364_0029805
709 Ga0395901_0005296
710 Ga0395901_0029795
711 Ga0451791_0682123
712 Ga0451802_0023024
713 Ga0451802_0345369
714 Ga0466966_0713277
715 Ga0495629_0050044
716 Ga0495629_0070221
717 Ga0495638_0198110
718 Ga0495585_0367204
719 Ga0495594_0008339
720 Ga0495594_0108683
721 Ga0495606_0001361
722 Ga0495632_0013488
723 Ga0495640_0336162
724 Ga0495668_0000540
725 Ga0495625_0000464
726 Ga0495674_0410788
727 Ga0495593_0309902
728 Ga0495626_0000278
729 Ga0496105_0023949
730 Ga0496105_0233073
731 Ga0496108_0000117
732 Ga0496108_0005676
733 Ga0496108_0490048
734 Ga0496109_0042047
735 Ga0496110_0040069
736 Ga0496110_0478812
737 Ga0496112_0017600
738 Ga0496112_0039622
739 Ga0496112_0081283
740 Ga0496112_0151381
741 Ga0496112_0259061
742 Ga0496112_0356573
743 Ga0496112_0579732
744 Ga0496113_0002915
745 Ga0496113_0667703
746 Ga0501032_0051750
747 Ga0501037_0044883
748 Ga0501040_1054361
749 Ga0501046_0138853
750 Ga0501047_0439622
751 Ga0501048_0365852
752 Ga0501074_0072564
753 Ga0501035_0596029
754 Ga0501044_0257635
755 Ga0501044_0555522
756 Ga0501045_0306165
757 Ga0501045_1098556
758 nmdc:mga05p37_1019966_c1
759 nmdc:mga05p37_448_c1
760 nmdc:mga05p37_6983_c1
761 nmdc:mga09592_130224_c1
762 nmdc:mga09592_13_c1
763 nmdc:mga09592_23367_c1
764 nmdc:mga09592_735770_c1
765 nmdc:mga0qj67_1152_c1
766 nmdc:mga0qj67_266_c1
767 nmdc:mga0qj67_353407_c1
768 nmdc:mga0qj67_392570_c1
769 nmdc:mga0qj67_992833_c1
770 nmdc:mga06r32_24_c1
771 nmdc:mga06r32_260277_c1
772 nmdc:mga06r32_26437_c1
773 nmdc:mga06r32_49118_c2
774 nmdc:mga06r32_7360_c1
775 nmdc:mga08y16_215376_c1
776 Ga0495601_0428807
777 Ga0500644_0192542
778 Ga0500651_0027214
779 Ga0500650_0055024
780 Ga0500556_0028055
781 Ga0500562_063472
782 Ga0500569_076308
783 Ga0500594_0001708
784 Ga0500652_011127
785 Ga0500568_0002143
786 Ga0500577_0115573
787 Ga0500633_0034334
788 Ga0530510_0084630
789 2501944659
790 2515493666
791 2515720577
792 2515755056
793 2516084145
794 2516087802
795 2623586782
796 2676480438
797 2753263542
798 2772646230
799 2831938657
800 2832006395
801 2855671428
802 2855680671
803 2855684818
804 2856860692
805 2857292124
806 2858854594
807 2858870800
808 2858883720
809 2858894200
810 2858901070
811 2858903468
812 2866067241
813 2867306549
814 2867313037
815 2867325061
816 2867509632
817 2869050076
818 2869068067
819 2869070791
820 2880493424
821 2880498883
822 2887483935
823 2902585562
824 2929220889
825 2929227474
826 2996225732
827 649811427
828 8001783708
829 8001784828
830 8003834798
831 8003860034
832 8003876984
833 8054710881
834 8054727532
835 8054734978
836 8055413709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21853

DUF6912

Family of unknown function (DUF6912)

34

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cb6-assembly4.cif.gz_O crystal structure of the catalytic domain of the mosquitocidal toxin from bacillus sphaericus, mutant e195q 0.6335 75 120
2jmc-assembly1.cif.gz_A chimer between spc-sh3 and p41 0.6311 80 106
2cb4-assembly1.cif.gz_A crystal structure of the catalytic domain of the mosquitocidal toxin from bacillus sphaericus, mutant e197q 0.6092 75 120
2vse-assembly2.cif.gz_B structure and mode of action of a mosquitocidal holotoxin 0.5993 75 120
7zhl-assembly1.cif.gz_A salmonella enterica rhs1 c-terminal toxin tretu 0.5586 4 102
ID Description Score Start End Superfamily
2jmcA00 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.6311 80 106 2.30.30.40
1tucA00 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.6272 80 107 2.30.30.40
2vseA01 Alpha Beta;Alpha-Beta Complex;Heat-Labile Enterotoxin; Chain A;Heat-Labile Enterotoxin, subunit A 0.599 75 120 3.90.210.10
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.5657 7 126 3.20.170.20
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.5522 7 126 3.20.170.20
ID Description Score Start End GO Terms
AF-A0A1Q7WEW4-F1-model_v4 Uncharacterized protein 0.9889 6 165
AF-A0A1N7FR84-F1-model_v4 Uncharacterized protein 0.9875 3 165
AF-A0A561VF47-F1-model_v4 Uncharacterized protein 0.9843 1 165
AF-A0A4V2XEC2-F1-model_v4 deleted 0.9794 1 148
AF-A0A543AT35-F1-model_v4 Uncharacterized protein 0.9721 6 165

Map