F439356

General Info

Members Datasets Scaffolds Average Seq Length
418 252 836 250

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0710675|Ga0466967_0710675_43_855
Length 270
Sequence MSWAAVDPAILAPAFLAGLLVLATHVPLGAQVLRKGIVFIDLAIAQIAALGVVVAGLFEVASDGWPIQLAAAAAALAGALLLDWSERRWPQVQEAQIGVVFVLAATAGILLLANNPHGGEHLRDLLAGQILWVGYPRLAVPLVVTTALLGLWLARGARLSTRGFYLLFAVAVTVSVQLVGXXXVFASLIVPSLGSRDWPEGRRLPVAYAIGVAGYGAGLVLSAALDLPSGALIVWCLAVLAVLAHAAAPRRRGAPMPVQVHGVDRQAADG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
232 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
233 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
239 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
240 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
244 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
245 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
246 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
247 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
248 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
249 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
250 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
251 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
252 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 1.2
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0710675 3300045976 Bacteria 996
2 JGI25154J39366_1001046 3300002738 Bacteria 11018
3 JGI25153J46596_10000974 3300003215 Bacteria 17386
4 Ga0055526_1000023 3300003771 Bacteria 163444
5 Ga0065165_1001844 3300005262 Bacteria 20678
6 Ga0070676_10003060 3300005328 Bacteria 8639
7 Ga0070676_10003203 3300005328 Bacteria 8487
8 Ga0070676_10218191 3300005328 Bacteria 1258
9 Ga0070690_100002334 3300005330 Bacteria 10201
10 Ga0070670_100035011 3300005331 Bacteria 4322
11 Ga0070670_100094105 3300005331 Bacteria 2577
12 Ga0070670_100149786 3300005331 Bacteria 2019
13 Ga0070670_100306915 3300005331 Bacteria 1389
14 Ga0070670_100314275 3300005331 Bacteria 1372
15 Ga0070677_10006352 3300005333 Bacteria 3923
16 Ga0070677_10021494 3300005333 Bacteria 2368
17 Ga0068869_100000889 3300005334 Bacteria 17243
18 Ga0070666_10024231 3300005335 Bacteria 3952
19 Ga0070682_100012077 3300005337 Bacteria 4943
20 Ga0068868_100015625 3300005338 Bacteria 5621
21 Ga0068868_100018257 3300005338 Bacteria 5240
22 Ga0068868_100056521 3300005338 Bacteria 3098
23 Ga0068868_100070593 3300005338 Bacteria 2785
24 Ga0070687_100038491 3300005343 Bacteria 2398
25 Ga0070661_100153045 3300005344 Bacteria 1744
26 Ga0070668_100001329 3300005347 Bacteria 17646
27 Ga0070668_100019369 3300005347 Bacteria 5122
28 Ga0070668_100068077 3300005347 Bacteria 2767
29 Ga0070668_100292594 3300005347 Bacteria 1363
30 Ga0070669_100002377 3300005353 Bacteria 13608
31 Ga0070669_100074227 3300005353 Bacteria 2521
32 Ga0070669_100317310 3300005353 Bacteria 1258
33 Ga0070675_100047263 3300005354 Bacteria 3526
34 Ga0070675_100072042 3300005354 Bacteria 2868
35 Ga0070675_100075538 3300005354 Bacteria 2801
36 Ga0070671_100055230 3300005355 Bacteria 3304
37 Ga0070674_100001004 3300005356 Bacteria 14721
38 Ga0070674_100013612 3300005356 Bacteria 5034
39 Ga0070673_100003898 3300005364 Bacteria 9374
40 Ga0070673_100075960 3300005364 Bacteria 2711
41 Ga0070667_100000294 3300005367 Bacteria 56218
42 Ga0070667_100199468 3300005367 Bacteria 1775
43 Ga0070700_100103011 3300005441 Bacteria 1884
44 Ga0070678_100008075 3300005456 Bacteria 6280
45 Ga0070678_100434791 3300005456 Bacteria 1146
46 Ga0070678_100472754 3300005456 Bacteria 1102
47 Ga0070662_100137637 3300005457 Bacteria 1889
48 Ga0068867_100001003 3300005459 Bacteria 19259
49 Ga0068867_100008508 3300005459 Bacteria 7244
50 Ga0068867_100011686 3300005459 Bacteria 6200
51 Ga0068867_100066669 3300005459 Bacteria 2682
52 Ga0070706_100786522 3300005467 Bacteria 881
53 Ga0070672_100002739 3300005543 Bacteria 11283
54 Ga0070672_100030083 3300005543 Bacteria 4076
55 Ga0070672_100051658 3300005543 Bacteria 3207
56 Ga0070686_100016813 3300005544 Bacteria 4260
57 Ga0070665_100103201 3300005548 Bacteria 2855
58 Ga0070664_100084093 3300005564 Bacteria 2746
59 Ga0070664_100087025 3300005564 Bacteria 2700
60 Ga0068854_100028660 3300005578 Bacteria 3850
61 Ga0068854_100217784 3300005578 Bacteria 1509
62 Ga0068856_100137606 3300005614 Bacteria 2448
63 Ga0068856_100526111 3300005614 Bacteria 1204
64 Ga0068852_100183412 3300005616 Bacteria 1969
65 Ga0068852_100269628 3300005616 Bacteria 1637
66 Ga0068859_100053455 3300005617 Bacteria 4063
67 Ga0068864_100104006 3300005618 Bacteria 2522
68 Ga0068861_100120171 3300005719 Bacteria 2118
69 Ga0068861_100187966 3300005719 Bacteria 1724
70 Ga0068863_100001702 3300005841 Bacteria 21786
71 Ga0068863_100283562 3300005841 Bacteria 1605
72 Ga0068858_100001135 3300005842 Bacteria 27560
73 Ga0068860_100002478 3300005843 Bacteria 19367
74 Ga0068862_100018333 3300005844 Bacteria 5828
75 Ga0070715_10080679 3300006163 Bacteria 1476
76 Ga0075366_10191377 3300006195 Bacteria 1243
77 Ga0075370_10025652 3300006353 Bacteria 3262
78 Ga0068865_100053713 3300006881 Bacteria 2796
79 Ga0097620_100053455 3300006931 Bacteria 4063
80 Ga0105240_10251902 3300009093 Bacteria 2042
81 Ga0105243_10062055 3300009148 Bacteria 2991
82 Ga0105243_10094480 3300009148 Bacteria 2469
83 Ga0105248_10112117 3300009177 Bacteria 3076
84 Ga0105248_10383133 3300009177 Bacteria 1583
85 Ga0105248_10528405 3300009177 Bacteria 1330
86 Ga0105237_10080698 3300009545 Bacteria 3243
87 Ga0105249_10052907 3300009553 Bacteria 3710
88 Ga0105249_10666905 3300009553 Bacteria 1098
89 Ga0157370_10529596 3300013104 Bacteria 1081
90 Ga0157369_10624023 3300013105 Bacteria 1112
91 Ga0157378_10173599 3300013297 Bacteria 2023
92 Ga0163162_10016325 3300013306 Bacteria 7259
93 Ga0157372_10299719 3300013307 Bacteria 1870
94 Ga0157372_10301628 3300013307 Bacteria 1863
95 Ga0157372_10339189 3300013307 Bacteria 1750
96 Ga0157375_10068955 3300013308 Bacteria 3541
97 Ga0157375_10080797 3300013308 Bacteria 3290
98 Ga0157380_10061216 3300014326 Bacteria 3011
99 Ga0157377_10087259 3300014745 Bacteria 1836
100 Ga0157377_10245211 3300014745 Bacteria 1158
101 Ga0157379_10095087 3300014968 Bacteria 2674
102 Ga0157376_10219499 3300014969 Bacteria 1760
103 Ga0157376_10234517 3300014969 Bacteria 1706
104 Ga0163161_10010482 3300017792 Bacteria 6417
105 Ga0163161_10052445 3300017792 Bacteria 2956
106 Ga0213872_10000087 3300021361 Bacteria 84858
107 Ga0213872_10000157 3300021361 Bacteria 62892
108 Ga0209646_1000049 3300025246 Bacteria 301924
109 Ga0209026_1026569 3300025250 Bacteria 869
110 Ga0209564_1000002 3300025295 Bacteria 1636803
111 Ga0209758_1000057 3300025297 Bacteria 333111
112 Ga0209050_1000268 3300025298 Bacteria 111281
113 Ga0207697_10017271 3300025315 Bacteria 2966
114 Ga0207697_10022189 3300025315 Bacteria 2601
115 Ga0207656_10106603 3300025321 Bacteria 1290
116 Ga0207682_10000158 3300025893 Bacteria 30682
117 Ga0207682_10008631 3300025893 Bacteria 4028
118 Ga0207682_10012352 3300025893 Bacteria 3334
119 Ga0207680_10002802 3300025903 Bacteria 8158
120 Ga0207685_10049131 3300025905 Bacteria 1619
121 Ga0207645_10005861 3300025907 Bacteria 8853
122 Ga0207645_10013766 3300025907 Bacteria 5429
123 Ga0207645_10018732 3300025907 Bacteria 4547
124 Ga0207643_10027161 3300025908 Bacteria 3172
125 Ga0207695_10063109 3300025913 Bacteria 3820
126 Ga0207662_10031118 3300025918 Bacteria 3100
127 Ga0207649_10103522 3300025920 Bacteria 1889
128 Ga0207681_10000420 3300025923 Bacteria 29486
129 Ga0207681_10022630 3300025923 Bacteria 4011
130 Ga0207650_10000480 3300025925 Bacteria 33274
131 Ga0207650_10004705 3300025925 Bacteria 9326
132 Ga0207650_10424266 3300025925 Bacteria 1104
133 Ga0207659_10000118 3300025926 Bacteria 46531
134 Ga0207659_10034848 3300025926 Bacteria 3475
135 Ga0207659_10050972 3300025926 Bacteria 2942
136 Ga0207687_10021920 3300025927 Bacteria 4247
137 Ga0207644_10051277 3300025931 Bacteria 2961
138 Ga0207644_10133954 3300025931 Bacteria 1900
139 Ga0207706_10091106 3300025933 Bacteria 2681
140 Ga0207709_10003563 3300025935 Bacteria 9207
141 Ga0207669_10000706 3300025937 Bacteria 14412
142 Ga0207669_10011807 3300025937 Bacteria 4267
143 Ga0207704_10008820 3300025938 Bacteria 4841
144 Ga0207704_10013117 3300025938 Bacteria 4137
145 Ga0207704_10327835 3300025938 Bacteria 1183
146 Ga0207691_10000238 3300025940 Bacteria 53833
147 Ga0207691_10007468 3300025940 Bacteria 10522
148 Ga0207711_10088112 3300025941 Bacteria 2724
149 Ga0207689_10428688 3300025942 Bacteria 1104
150 Ga0207679_10660337 3300025945 Bacteria 946
151 Ga0207651_10001131 3300025960 Bacteria 11895
152 Ga0207651_10015153 3300025960 Bacteria 4471
153 Ga0207712_10050049 3300025961 Bacteria 2916
154 Ga0207712_10579405 3300025961 Bacteria 968
155 Ga0207668_10091743 3300025972 Bacteria 2233
156 Ga0207668_10117006 3300025972 Bacteria 2011
157 Ga0207640_10061281 3300025981 Bacteria 2491
158 Ga0207658_10007911 3300025986 Bacteria 7241
159 Ga0207658_10208291 3300025986 Bacteria 1637
160 Ga0207677_10005476 3300026023 Bacteria 6890
161 Ga0207677_10075513 3300026023 Bacteria 2396
162 Ga0207703_10006990 3300026035 Bacteria 8981
163 Ga0207639_10302392 3300026041 Bacteria 1414
164 Ga0207678_10087155 3300026067 Bacteria 2668
165 Ga0207708_10039501 3300026075 Bacteria 3596
166 Ga0207708_10130782 3300026075 Bacteria 1962
167 Ga0207702_10140470 3300026078 Bacteria 2185
168 Ga0207702_10244926 3300026078 Bacteria 1681
169 Ga0207641_10003717 3300026088 Bacteria 13438
170 Ga0207648_10002514 3300026089 Bacteria 19686
171 Ga0207648_10003526 3300026089 Bacteria 16384
172 Ga0207648_10029392 3300026089 Bacteria 4874
173 Ga0207648_10044866 3300026089 Bacteria 3879
174 Ga0207676_10034951 3300026095 Bacteria 3809
175 Ga0207676_10351883 3300026095 Bacteria 1362
176 Ga0207674_10206218 3300026116 Bacteria 1915
177 Ga0207675_100001432 3300026118 Bacteria 23904
178 Ga0207683_10013866 3300026121 Bacteria 6873
179 Ga0207683_10091918 3300026121 Bacteria 2704
180 Ga0207698_10039318 3300026142 Bacteria 3503
181 Ga0207698_10240983 3300026142 Bacteria 1648
182 Ga0207698_10489061 3300026142 Bacteria 1195
183 Ga0268266_10170929 3300028379 Bacteria 1973
184 Ga0268265_10016316 3300028380 Bacteria 5099
185 Ga0268264_10050289 3300028381 Bacteria 3470
186 Ga0307517_10069576 3300028786 Bacteria 3186
187 Ga0307515_10000727 3300028794 Bacteria 75922
188 Ga0307515_10000998 3300028794 Bacteria 64720
189 Ga0307512_10028189 3300030522 Bacteria 4928
190 Ga0307513_10134993 3300031456 Bacteria 2404
191 Ga0307508_10000004 3300031616 Bacteria 287547
192 Ga0307514_10101369 3300031649 Bacteria 2066
193 Ga0265314_10023311 3300031711 Bacteria 4720
194 Ga0307516_10425266 3300031730 Bacteria 986
195 Ga0307405_10005514 3300031731 Bacteria 6111
196 Ga0307413_10020711 3300031824 Bacteria 3505
197 Ga0307410_10057513 3300031852 Bacteria 2648
198 Ga0307407_10018688 3300031903 Bacteria 3512
199 Ga0307412_10006337 3300031911 Bacteria 6684
200 Ga0307409_100234675 3300031995 Bacteria 1665
201 Ga0307416_100197065 3300032002 Bacteria 1906
202 Ga0307414_10034527 3300032004 Bacteria 3355
203 Ga0307411_10001107 3300032005 Bacteria 10491
204 Ga0307411_10818282 3300032005 Bacteria 822
205 Ga0307415_100013879 3300032126 Bacteria 4717
206 Ga0373946_0088728 3300035171 Bacteria 1367
207 Ga0373947_0139235 3300035725 Bacteria 1555
208 Ga0373925_0223367 3300037068 Bacteria 1504
209 Ga0395899_0000012 3300037312 Bacteria 517561
210 Ga0395899_0000473 3300037312 Bacteria 45449
211 Ga0395899_0003993 3300037312 Bacteria 11622
212 Ga0395899_0020807 3300037312 Bacteria 4975
213 Ga0395900_0137282 3300037418 Bacteria 2505
214 Ga0395900_0196942 3300037418 Bacteria 2040
215 Ga0395898_0036856 3300037466 Bacteria 4853
216 Ga0395898_0057993 3300037466 Bacteria 3771
217 Ga0395905_0028841 3300037471 Bacteria 5231
218 Ga0395905_0095975 3300037471 Unclassified 2783
219 Ga0395905_0110777 3300037471 Bacteria 2578
220 Ga0395905_0586791 3300037471 Bacteria 1016
221 Ga0395901_0011855 3300038443 Bacteria 8838
222 Ga0395901_0044778 3300038443 Bacteria 4589
223 Ga0395901_0212867 3300038443 Bacteria 2022
224 Ga0395901_0272545 3300038443 Bacteria 1760
225 Ga0436361_0535327 3300039447 Bacteria 8954
226 Ga0436361_0537843 3300039447 Bacteria 16101
227 Ga0436361_0595316 3300039447 Bacteria 75842
228 Ga0436361_0883268 3300039447 Bacteria 15184
229 Ga0451789_0342494 3300041443 Bacteria 2194
230 Ga0451853_0277111 3300041512 Bacteria 1186
231 Ga0450904_000300 3300042139 Bacteria 10579
232 Ga0451577_0019454 3300042876 Bacteria 6244
233 Ga0451577_0048095 3300042876 Bacteria 3812
234 Ga0451577_0099964 3300042876 Bacteria 2591
235 Ga0451577_0104629 3300042876 Bacteria 2529
236 Ga0453683_0054961 3300044673 Bacteria 2492
237 Ga0466965_0001048 3300044683 Bacteria 10728
238 Ga0453684_0000189 3300044712 Bacteria 269690
239 Ga0453684_0000731 3300044712 Bacteria 115326
240 Ga0453684_0001597 3300044712 Bacteria 62266
241 Ga0453684_0171506 3300044712 Bacteria 2556
242 Ga0466968_0004157 3300044735 Bacteria 5393
243 Ga0466970_0023414 3300044765 Bacteria 3225
244 Ga0466959_0004039 3300045049 Bacteria 9760
245 Ga0451576_0000147 3300045051 Bacteria 179223
246 Ga0451576_0000272 3300045051 Bacteria 126530
247 Ga0451576_0012487 3300045051 Bacteria 9539
248 Ga0451576_0121173 3300045051 Bacteria 2723
249 Ga0495617_000178 3300046452 Bacteria 40156
250 Ga0495590_0000016 3300046457 Bacteria 225874
251 Ga0495629_0003994 3300046459 Bacteria 11088
252 Ga0495629_0101294 3300046459 Bacteria 2010
253 Ga0495638_0000057 3300046460 Bacteria 193690
254 Ga0495653_0039837 3300046463 Bacteria 3677
255 Ga0495650_0000317 3300046471 Bacteria 86483
256 Ga0495650_0001664 3300046471 Bacteria 20540
257 Ga0495605_0015521 3300046474 Bacteria 4139
258 Ga0495605_0069206 3300046474 Bacteria 1671
259 Ga0495605_0198255 3300046474 Bacteria 876
260 Ga0495584_0000001 3300046491 Bacteria 649329
261 Ga0495584_0001227 3300046491 Bacteria 15641
262 Ga0495584_0004782 3300046491 Bacteria 7240
263 Ga0495584_0075318 3300046491 Bacteria 1697
264 Ga0495585_0000002 3300046492 Bacteria 529316
265 Ga0495585_0000584 3300046492 Bacteria 34249
266 Ga0495585_0033124 3300046492 Bacteria 2926
267 Ga0495585_0045472 3300046492 Bacteria 2450
268 Ga0495594_0123608 3300046499 Bacteria 1463
269 Ga0495594_0217006 3300046499 Unclassified 1091
270 Ga0495596_0001241 3300046500 Bacteria 14835
271 Ga0495596_0010878 3300046500 Bacteria 3944
272 Ga0495596_0025972 3300046500 Bacteria 2362
273 Ga0495607_0001955 3300046501 Bacteria 17395
274 Ga0495607_0041055 3300046501 Bacteria 2750
275 Ga0495583_0000009 3300046506 Bacteria 372527
276 Ga0495583_0000026 3300046506 Bacteria 256777
277 Ga0495583_0000178 3300046506 Bacteria 108556
278 Ga0495583_0074573 3300046506 Bacteria 1485
279 Ga0495606_0000058 3300046507 Bacteria 194187
280 Ga0495606_0000066 3300046507 Bacteria 181028
281 Ga0495606_0013590 3300046507 Bacteria 6422
282 Ga0495606_0039730 3300046507 Bacteria 3167
283 Ga0495606_0040337 3300046507 Bacteria 3138
284 Ga0495606_0078582 3300046507 Bacteria 2057
285 Ga0495616_0001580 3300046513 Bacteria 15667
286 Ga0495616_0003358 3300046513 Bacteria 10273
287 Ga0495616_0105682 3300046513 Unclassified 1314
288 Ga0495620_0081238 3300046515 Bacteria 1311
289 Ga0495630_0022497 3300046517 Bacteria 4656
290 Ga0495631_0004465 3300046518 Bacteria 7449
291 Ga0495631_0024628 3300046518 Bacteria 2779
292 Ga0495632_0002326 3300046519 Bacteria 14624
293 Ga0495643_0000121 3300046522 Bacteria 125932
294 Ga0495643_0000491 3300046522 Bacteria 49785
295 Ga0495643_0068372 3300046522 Bacteria 1869
296 Ga0495643_0077733 3300046522 Bacteria 1733
297 Ga0495644_0002423 3300046523 Bacteria 7441
298 Ga0495648_0000002 3300046524 Bacteria 593972
299 Ga0495648_0000012 3300046524 Bacteria 294111
300 Ga0495648_0016459 3300046524 Bacteria 5333
301 Ga0495663_0002120 3300046525 Bacteria 6071
302 Ga0495663_0003757 3300046525 Bacteria 4328
303 Ga0495666_0002508 3300046526 Bacteria 9115
304 Ga0495642_0003031 3300046528 Bacteria 6689
305 Ga0495642_0005162 3300046528 Bacteria 5024
306 Ga0495642_0006414 3300046528 Bacteria 4513
307 Ga0495642_0020144 3300046528 Bacteria 2617
308 Ga0495642_0026084 3300046528 Bacteria 2319
309 Ga0495665_0001104 3300046531 Bacteria 14266
310 Ga0495665_0054698 3300046531 Bacteria 2108
311 Ga0495665_0251273 3300046531 Bacteria 910
312 Ga0495586_0005061 3300046535 Bacteria 7054
313 Ga0495587_0047420 3300046536 Bacteria 2547
314 Ga0495609_0026773 3300046538 Bacteria 2638
315 Ga0495609_0036602 3300046538 Bacteria 2215
316 Ga0495597_0000294 3300046542 Bacteria 44923
317 Ga0495597_0001705 3300046542 Bacteria 15220
318 Ga0495597_0092070 3300046542 Bacteria 1286
319 Ga0495645_0006342 3300046543 Bacteria 8207
320 Ga0495622_0000155 3300046557 Bacteria 58297
321 Ga0495622_0000344 3300046557 Bacteria 33349
322 Ga0495622_0002342 3300046557 Bacteria 9213
323 Ga0495622_0012071 3300046557 Bacteria 3995
324 Ga0495622_0012840 3300046557 Bacteria 3883
325 Ga0495622_0063918 3300046557 Bacteria 1702
326 Ga0495633_0001220 3300046558 Bacteria 20680
327 Ga0495633_0004566 3300046558 Bacteria 8736
328 Ga0495633_0019432 3300046558 Bacteria 3436
329 Ga0495633_0082561 3300046558 Bacteria 1495
330 Ga0495656_0176441 3300046615 Bacteria 1048
331 Ga0495668_0000495 3300046616 Bacteria 49167
332 Ga0495668_0005529 3300046616 Bacteria 8519
333 Ga0495668_0022880 3300046616 Bacteria 3569
334 Ga0495668_0157946 3300046616 Bacteria 1242
335 Ga0495634_0298853 3300046642 Bacteria 974
336 Ga0495611_0041169 3300046648 Bacteria 2060
337 Ga0495625_0000622 3300046660 Bacteria 51463
338 Ga0495625_0003036 3300046660 Bacteria 17217
339 Ga0495625_0046027 3300046660 Bacteria 3150
340 Ga0495661_0049384 3300046665 Bacteria 2551
341 Ga0495661_0091172 3300046665 Bacteria 1733
342 Ga0495661_0235259 3300046665 Bacteria 942
343 Ga0495588_0034689 3300046674 Bacteria 2553
344 Ga0495588_0043923 3300046674 Bacteria 2287
345 Ga0495647_0005737 3300046681 Bacteria 4083
346 Ga0495613_0064005 3300046689 Bacteria 2690
347 Ga0495624_0001419 3300046690 Bacteria 18653
348 Ga0495670_0001177 3300046691 Bacteria 12692
349 Ga0495671_0157792 3300046692 Bacteria 1104
350 Ga0495671_0161579 3300046692 Bacteria 1089
351 Ga0495671_0210505 3300046692 Bacteria 942
352 Ga0495589_0016112 3300046794 Bacteria 3840
353 Ga0495600_0002782 3300046809 Bacteria 10150
354 Ga0495660_0004214 3300046810 Bacteria 8738
355 Ga0495581_0008207 3300047315 Bacteria 6051
356 Ga0495604_0019962 3300047317 Bacteria 5357
357 Ga0495604_0043239 3300047317 Bacteria 3528
358 Ga0495674_0042916 3300047319 Bacteria 4029
359 Ga0495680_0249018 3300047322 Bacteria 1260
360 Ga0495683_0000009 3300047323 Bacteria 241385
361 Ga0495687_000209 3300047443 Bacteria 83956
362 Ga0495687_000623 3300047443 Bacteria 40772
363 Ga0495685_001136 3300047447 Bacteria 8138
364 Ga0495673_0005353 3300047469 Bacteria 7779
365 Ga0495681_0006041 3300047470 Bacteria 8007
366 Ga0495681_0025221 3300047470 Bacteria 3114
367 Ga0495681_0065852 3300047470 Bacteria 1655
368 Ga0495686_0095660 3300047472 Bacteria 1799
369 Ga0495593_0007398 3300047673 Bacteria 6431
370 Ga0495593_0023838 3300047673 Bacteria 3396
371 Ga0495615_0018623 3300048090 Bacteria 1531
372 Ga0495626_0009377 3300048091 Bacteria 5292
373 Ga0495626_0011972 3300048091 Bacteria 4565
374 Ga0495626_0026337 3300048091 Bacteria 2835
375 Ga0496102_0000234 3300048905 Bacteria 72781
376 Ga0496109_0274966 3300048912 Bacteria 1587
377 Ga0496115_0005488 3300048918 Bacteria 9230
378 Ga0496115_0176257 3300048918 Bacteria 1768
379 Ga0495678_045140 3300049459 Bacteria 1740
380 Ga0495682_0003380 3300049460 Bacteria 7108
381 Ga0501034_0062963 3300049571 Bacteria 3724
382 Ga0501034_0125583 3300049571 Bacteria 2551
383 Ga0501036_0114701 3300049572 Bacteria 2277
384 Ga0501047_0078846 3300049581 Bacteria 3167
385 Ga0501044_0151756 3300049823 Bacteria 2299
386 nmdc:mga0k408_66901_c1 3300050493 Bacteria 1510
387 nmdc:mga06z11_54487_c1 3300050494 Bacteria 2061
388 nmdc:mga07m45_18829_c1 3300050496 Bacteria 3734
389 nmdc:mga08y16_571559_c1 3300050511 Bacteria 1142
390 Ga0495601_0097962 3300053077 Bacteria 1892
391 Ga0495619_0012269 3300053085 Bacteria 5391
392 Ga0500578_0000011 3300053086 Bacteria 217243
393 Ga0500646_0081691 3300053090 Bacteria 987
394 Ga0500583_0044010 3300053092 Bacteria 2042
395 Ga0500651_0014582 3300053093 Bacteria 4809
396 Ga0500607_019867 3300053121 Bacteria 3798
397 Ga0500623_042556 3300053127 Bacteria 2317
398 Ga0500628_000724 3300053129 Bacteria 5857
399 Ga0500642_0008659 3300053130 Bacteria 3496
400 Ga0500652_000099 3300053131 Bacteria 34685
401 Ga0500658_0071748 3300053134 Bacteria 1463
402 Ga0500568_0054506 3300053139 Bacteria 1563
403 Ga0500577_0009170 3300053142 Bacteria 2861
404 Ga0500579_113932 3300053143 Bacteria 1346
405 Ga0500619_000122 3300053154 Bacteria 20397
406 Ga0500622_0000097 3300053156 Bacteria 89802
407 Ga0500622_0072464 3300053156 Bacteria 1739
408 Ga0500636_0000020 3300053177 Bacteria 96868
409 Ga0500570_095717 3300053724 Bacteria 1272
410 Ga0500584_046244 3300053726 Bacteria 1980
411 Ga0500625_011422 3300053729 Bacteria 4033
412 2587727945 2585428057 Bacteria 6737412
413 2587733748 2585428058 Bacteria 6853932
414 2588291724 2588253510 Bacteria 6901809
415 2643972446 2643221592 Bacteria 6608788
416 2644027880 2643221603 Bacteria 6147767
417 2644138546 2643221625 Bacteria 6512927
418 2644272954 2643221648 Bacteria 6521465
419 Ga0466967_0710675
420 JGI25154J39366_1001046
421 JGI25153J46596_10000974
422 Ga0055526_1000023
423 Ga0065165_1001844
424 Ga0070676_10003060
425 Ga0070676_10003203
426 Ga0070676_10218191
427 Ga0070690_100002334
428 Ga0070670_100035011
429 Ga0070670_100094105
430 Ga0070670_100149786
431 Ga0070670_100306915
432 Ga0070670_100314275
433 Ga0070677_10006352
434 Ga0070677_10021494
435 Ga0068869_100000889
436 Ga0070666_10024231
437 Ga0070682_100012077
438 Ga0068868_100015625
439 Ga0068868_100018257
440 Ga0068868_100056521
441 Ga0068868_100070593
442 Ga0070687_100038491
443 Ga0070661_100153045
444 Ga0070668_100001329
445 Ga0070668_100019369
446 Ga0070668_100068077
447 Ga0070668_100292594
448 Ga0070669_100002377
449 Ga0070669_100074227
450 Ga0070669_100317310
451 Ga0070675_100047263
452 Ga0070675_100072042
453 Ga0070675_100075538
454 Ga0070671_100055230
455 Ga0070674_100001004
456 Ga0070674_100013612
457 Ga0070673_100003898
458 Ga0070673_100075960
459 Ga0070667_100000294
460 Ga0070667_100199468
461 Ga0070700_100103011
462 Ga0070678_100008075
463 Ga0070678_100434791
464 Ga0070678_100472754
465 Ga0070662_100137637
466 Ga0068867_100001003
467 Ga0068867_100008508
468 Ga0068867_100011686
469 Ga0068867_100066669
470 Ga0070706_100786522
471 Ga0070672_100002739
472 Ga0070672_100030083
473 Ga0070672_100051658
474 Ga0070686_100016813
475 Ga0070665_100103201
476 Ga0070664_100084093
477 Ga0070664_100087025
478 Ga0068854_100028660
479 Ga0068854_100217784
480 Ga0068856_100137606
481 Ga0068856_100526111
482 Ga0068852_100183412
483 Ga0068852_100269628
484 Ga0068859_100053455
485 Ga0068864_100104006
486 Ga0068861_100120171
487 Ga0068861_100187966
488 Ga0068863_100001702
489 Ga0068863_100283562
490 Ga0068858_100001135
491 Ga0068860_100002478
492 Ga0068862_100018333
493 Ga0070715_10080679
494 Ga0075366_10191377
495 Ga0075370_10025652
496 Ga0068865_100053713
497 Ga0097620_100053455
498 Ga0105240_10251902
499 Ga0105243_10062055
500 Ga0105243_10094480
501 Ga0105248_10112117
502 Ga0105248_10383133
503 Ga0105248_10528405
504 Ga0105237_10080698
505 Ga0105249_10052907
506 Ga0105249_10666905
507 Ga0157370_10529596
508 Ga0157369_10624023
509 Ga0157378_10173599
510 Ga0163162_10016325
511 Ga0157372_10299719
512 Ga0157372_10301628
513 Ga0157372_10339189
514 Ga0157375_10068955
515 Ga0157375_10080797
516 Ga0157380_10061216
517 Ga0157377_10087259
518 Ga0157377_10245211
519 Ga0157379_10095087
520 Ga0157376_10219499
521 Ga0157376_10234517
522 Ga0163161_10010482
523 Ga0163161_10052445
524 Ga0213872_10000087
525 Ga0213872_10000157
526 Ga0209646_1000049
527 Ga0209026_1026569
528 Ga0209564_1000002
529 Ga0209758_1000057
530 Ga0209050_1000268
531 Ga0207697_10017271
532 Ga0207697_10022189
533 Ga0207656_10106603
534 Ga0207682_10000158
535 Ga0207682_10008631
536 Ga0207682_10012352
537 Ga0207680_10002802
538 Ga0207685_10049131
539 Ga0207645_10005861
540 Ga0207645_10013766
541 Ga0207645_10018732
542 Ga0207643_10027161
543 Ga0207695_10063109
544 Ga0207662_10031118
545 Ga0207649_10103522
546 Ga0207681_10000420
547 Ga0207681_10022630
548 Ga0207650_10000480
549 Ga0207650_10004705
550 Ga0207650_10424266
551 Ga0207659_10000118
552 Ga0207659_10034848
553 Ga0207659_10050972
554 Ga0207687_10021920
555 Ga0207644_10051277
556 Ga0207644_10133954
557 Ga0207706_10091106
558 Ga0207709_10003563
559 Ga0207669_10000706
560 Ga0207669_10011807
561 Ga0207704_10008820
562 Ga0207704_10013117
563 Ga0207704_10327835
564 Ga0207691_10000238
565 Ga0207691_10007468
566 Ga0207711_10088112
567 Ga0207689_10428688
568 Ga0207679_10660337
569 Ga0207651_10001131
570 Ga0207651_10015153
571 Ga0207712_10050049
572 Ga0207712_10579405
573 Ga0207668_10091743
574 Ga0207668_10117006
575 Ga0207640_10061281
576 Ga0207658_10007911
577 Ga0207658_10208291
578 Ga0207677_10005476
579 Ga0207677_10075513
580 Ga0207703_10006990
581 Ga0207639_10302392
582 Ga0207678_10087155
583 Ga0207708_10039501
584 Ga0207708_10130782
585 Ga0207702_10140470
586 Ga0207702_10244926
587 Ga0207641_10003717
588 Ga0207648_10002514
589 Ga0207648_10003526
590 Ga0207648_10029392
591 Ga0207648_10044866
592 Ga0207676_10034951
593 Ga0207676_10351883
594 Ga0207674_10206218
595 Ga0207675_100001432
596 Ga0207683_10013866
597 Ga0207683_10091918
598 Ga0207698_10039318
599 Ga0207698_10240983
600 Ga0207698_10489061
601 Ga0268266_10170929
602 Ga0268265_10016316
603 Ga0268264_10050289
604 Ga0307517_10069576
605 Ga0307515_10000727
606 Ga0307515_10000998
607 Ga0307512_10028189
608 Ga0307513_10134993
609 Ga0307508_10000004
610 Ga0307514_10101369
611 Ga0265314_10023311
612 Ga0307516_10425266
613 Ga0307405_10005514
614 Ga0307413_10020711
615 Ga0307410_10057513
616 Ga0307407_10018688
617 Ga0307412_10006337
618 Ga0307409_100234675
619 Ga0307416_100197065
620 Ga0307414_10034527
621 Ga0307411_10001107
622 Ga0307411_10818282
623 Ga0307415_100013879
624 Ga0373946_0088728
625 Ga0373947_0139235
626 Ga0373925_0223367
627 Ga0395899_0000012
628 Ga0395899_0000473
629 Ga0395899_0003993
630 Ga0395899_0020807
631 Ga0395900_0137282
632 Ga0395900_0196942
633 Ga0395898_0036856
634 Ga0395898_0057993
635 Ga0395905_0028841
636 Ga0395905_0095975
637 Ga0395905_0110777
638 Ga0395905_0586791
639 Ga0395901_0011855
640 Ga0395901_0044778
641 Ga0395901_0212867
642 Ga0395901_0272545
643 Ga0436361_0535327
644 Ga0436361_0537843
645 Ga0436361_0595316
646 Ga0436361_0883268
647 Ga0451789_0342494
648 Ga0451853_0277111
649 Ga0450904_000300
650 Ga0451577_0019454
651 Ga0451577_0048095
652 Ga0451577_0099964
653 Ga0451577_0104629
654 Ga0453683_0054961
655 Ga0466965_0001048
656 Ga0453684_0000189
657 Ga0453684_0000731
658 Ga0453684_0001597
659 Ga0453684_0171506
660 Ga0466968_0004157
661 Ga0466970_0023414
662 Ga0466959_0004039
663 Ga0451576_0000147
664 Ga0451576_0000272
665 Ga0451576_0012487
666 Ga0451576_0121173
667 Ga0495617_000178
668 Ga0495590_0000016
669 Ga0495629_0003994
670 Ga0495629_0101294
671 Ga0495638_0000057
672 Ga0495653_0039837
673 Ga0495650_0000317
674 Ga0495650_0001664
675 Ga0495605_0015521
676 Ga0495605_0069206
677 Ga0495605_0198255
678 Ga0495584_0000001
679 Ga0495584_0001227
680 Ga0495584_0004782
681 Ga0495584_0075318
682 Ga0495585_0000002
683 Ga0495585_0000584
684 Ga0495585_0033124
685 Ga0495585_0045472
686 Ga0495594_0123608
687 Ga0495594_0217006
688 Ga0495596_0001241
689 Ga0495596_0010878
690 Ga0495596_0025972
691 Ga0495607_0001955
692 Ga0495607_0041055
693 Ga0495583_0000009
694 Ga0495583_0000026
695 Ga0495583_0000178
696 Ga0495583_0074573
697 Ga0495606_0000058
698 Ga0495606_0000066
699 Ga0495606_0013590
700 Ga0495606_0039730
701 Ga0495606_0040337
702 Ga0495606_0078582
703 Ga0495616_0001580
704 Ga0495616_0003358
705 Ga0495616_0105682
706 Ga0495620_0081238
707 Ga0495630_0022497
708 Ga0495631_0004465
709 Ga0495631_0024628
710 Ga0495632_0002326
711 Ga0495643_0000121
712 Ga0495643_0000491
713 Ga0495643_0068372
714 Ga0495643_0077733
715 Ga0495644_0002423
716 Ga0495648_0000002
717 Ga0495648_0000012
718 Ga0495648_0016459
719 Ga0495663_0002120
720 Ga0495663_0003757
721 Ga0495666_0002508
722 Ga0495642_0003031
723 Ga0495642_0005162
724 Ga0495642_0006414
725 Ga0495642_0020144
726 Ga0495642_0026084
727 Ga0495665_0001104
728 Ga0495665_0054698
729 Ga0495665_0251273
730 Ga0495586_0005061
731 Ga0495587_0047420
732 Ga0495609_0026773
733 Ga0495609_0036602
734 Ga0495597_0000294
735 Ga0495597_0001705
736 Ga0495597_0092070
737 Ga0495645_0006342
738 Ga0495622_0000155
739 Ga0495622_0000344
740 Ga0495622_0002342
741 Ga0495622_0012071
742 Ga0495622_0012840
743 Ga0495622_0063918
744 Ga0495633_0001220
745 Ga0495633_0004566
746 Ga0495633_0019432
747 Ga0495633_0082561
748 Ga0495656_0176441
749 Ga0495668_0000495
750 Ga0495668_0005529
751 Ga0495668_0022880
752 Ga0495668_0157946
753 Ga0495634_0298853
754 Ga0495611_0041169
755 Ga0495625_0000622
756 Ga0495625_0003036
757 Ga0495625_0046027
758 Ga0495661_0049384
759 Ga0495661_0091172
760 Ga0495661_0235259
761 Ga0495588_0034689
762 Ga0495588_0043923
763 Ga0495647_0005737
764 Ga0495613_0064005
765 Ga0495624_0001419
766 Ga0495670_0001177
767 Ga0495671_0157792
768 Ga0495671_0161579
769 Ga0495671_0210505
770 Ga0495589_0016112
771 Ga0495600_0002782
772 Ga0495660_0004214
773 Ga0495581_0008207
774 Ga0495604_0019962
775 Ga0495604_0043239
776 Ga0495674_0042916
777 Ga0495680_0249018
778 Ga0495683_0000009
779 Ga0495687_000209
780 Ga0495687_000623
781 Ga0495685_001136
782 Ga0495673_0005353
783 Ga0495681_0006041
784 Ga0495681_0025221
785 Ga0495681_0065852
786 Ga0495686_0095660
787 Ga0495593_0007398
788 Ga0495593_0023838
789 Ga0495615_0018623
790 Ga0495626_0009377
791 Ga0495626_0011972
792 Ga0495626_0026337
793 Ga0496102_0000234
794 Ga0496109_0274966
795 Ga0496115_0005488
796 Ga0496115_0176257
797 Ga0495678_045140
798 Ga0495682_0003380
799 Ga0501034_0062963
800 Ga0501034_0125583
801 Ga0501036_0114701
802 Ga0501047_0078846
803 Ga0501044_0151756
804 nmdc:mga0k408_66901_c1
805 nmdc:mga06z11_54487_c1
806 nmdc:mga07m45_18829_c1
807 nmdc:mga08y16_571559_c1
808 Ga0495601_0097962
809 Ga0495619_0012269
810 Ga0500578_0000011
811 Ga0500646_0081691
812 Ga0500583_0044010
813 Ga0500651_0014582
814 Ga0500607_019867
815 Ga0500623_042556
816 Ga0500628_000724
817 Ga0500642_0008659
818 Ga0500652_000099
819 Ga0500658_0071748
820 Ga0500568_0054506
821 Ga0500577_0009170
822 Ga0500579_113932
823 Ga0500619_000122
824 Ga0500622_0000097
825 Ga0500622_0072464
826 Ga0500636_0000020
827 Ga0500570_095717
828 Ga0500584_046244
829 Ga0500625_011422
830 2587727945
831 2587733748
832 2588291724
833 2643972446
834 2644027880
835 2644138546
836 2644272954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00950

ABC-3

ABC 3 transport family

7

156

0.92

PF00950

ABC-3

ABC 3 transport family

154

248

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.619 1 242
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.6172 10 243
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5957 1 242
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5748 10 243
4x8k-assembly1.cif.gz_A mycobacterium tuberculosis rbpa-sid in complex with sigmaa domain 2 0.3953 135 239
ID Description Score Start End Superfamily
af_O86339_1_133_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8056 135 239 1.10.1760.20
af_O86339_1_133_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6496 135 239 1.10.1760.20
af_Q2G2D9_6_271_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6116 10 239 1.10.3470.10
af_P39832_7_260_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5976 13 245 1.10.3470.10
af_P0A0J0_129_207_1.20.120.1810 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5907 182 245 1.20.120.1810
ID Description Score Start End GO Terms
AF-A0A3B9L8W4-F1-model_v4 Zinc/manganese transporter permease 0.8919 120 239 GO:0010043
GO:0043190
GO:0055085
AF-A0A7X9DGB3-F1-model_v4 Metal ABC transporter permease 0.8699 157 239 GO:0043190
GO:0055085
AF-A0A3B9L8W4-F1-model_v4 Zinc/manganese transporter permease 0.8656 120 239 GO:0010043
GO:0043190
GO:0055085
AF-J9UPL2-F1-model_v4 ABC 3 transport family protein 0.831 88 239 GO:0010043
GO:0043190
GO:0055085
AF-A0A7X9DGB3-F1-model_v4 Metal ABC transporter permease 0.8174 157 239 GO:0043190
GO:0055085

Map