F439362

General Info

Members Datasets Scaffolds Average Seq Length
418 231 836 202

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0154693|Ga0495605_0154693_72_677
Length 201
Sequence MSDKMSDIGALDTVHIGVLSVSDRASAGVYEDKGIPALQSWLQSAVRNPIVWEPRLIPDEQQLISDALIDLVDRAGCDLVLTTGAAARDVTPEATLAVATKVMPGFGEQMRQISLNFVPTAILSRQVAVIRHKALIINLPGQPKAIAETLGGIPNAQPPVGGIFAAVPYCVDLIGGPYIDTDPAVCKAFRPKSAQRPVASP

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 0
Rhizoplane 1.67
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0154693 3300046474 Bacteria 1021
2 Ga0070676_10018036 3300005328 Bacteria 3909
3 Ga0070676_10186093 3300005328 Bacteria 1353
4 Ga0070683_100237396 3300005329 Bacteria 1734
5 Ga0070690_100029058 3300005330 Bacteria 3426
6 Ga0070670_100003129 3300005331 Bacteria 13693
7 Ga0070670_100079386 3300005331 Bacteria 2820
8 Ga0070677_10067259 3300005333 Bacteria 1496
9 Ga0068869_100046053 3300005334 Bacteria 3143
10 Ga0068869_100050335 3300005334 Bacteria 3019
11 Ga0070680_100001873 3300005336 Bacteria 15421
12 Ga0070680_100149072 3300005336 Bacteria 1964
13 Ga0068868_100126480 3300005338 Bacteria 2088
14 Ga0068868_100594017 3300005338 Bacteria 980
15 Ga0070689_100009503 3300005340 Bacteria 6894
16 Ga0070689_100333187 3300005340 Bacteria 1270
17 Ga0070691_10043452 3300005341 Bacteria 2129
18 Ga0070692_10262172 3300005345 Bacteria 1039
19 Ga0070668_100004749 3300005347 Bacteria 10080
20 Ga0070669_100021017 3300005353 Bacteria 4664
21 Ga0070669_100045796 3300005353 Bacteria 3188
22 Ga0070669_100306118 3300005353 Bacteria 1279
23 Ga0070675_100007695 3300005354 Bacteria 8339
24 Ga0070675_100093079 3300005354 Bacteria 2528
25 Ga0070675_100139624 3300005354 Bacteria 2070
26 Ga0070671_100011653 3300005355 Bacteria 7073
27 Ga0070671_100323279 3300005355 Bacteria 1315
28 Ga0070674_100008402 3300005356 Bacteria 6147
29 Ga0070674_100034557 3300005356 Bacteria 3377
30 Ga0070674_100051467 3300005356 Bacteria 2838
31 Ga0070674_100168973 3300005356 Bacteria 1666
32 Ga0070674_100334175 3300005356 Bacteria 1219
33 Ga0070673_100022540 3300005364 Bacteria 4586
34 Ga0070673_100027067 3300005364 Bacteria 4246
35 Ga0070673_100054663 3300005364 Bacteria 3142
36 Ga0070673_100159435 3300005364 Bacteria 1918
37 Ga0070673_100441904 3300005364 Bacteria 1169
38 Ga0070659_100287722 3300005366 Bacteria 1368
39 Ga0070667_100001171 3300005367 Bacteria 23847
40 Ga0070667_100062553 3300005367 Bacteria 3153
41 Ga0070705_100373752 3300005440 Bacteria 1047
42 Ga0070700_100005633 3300005441 Bacteria 6642
43 Ga0070700_100093275 3300005441 Bacteria 1969
44 Ga0070694_100110885 3300005444 Bacteria 1954
45 Ga0070708_100000040 3300005445 Bacteria 84054
46 Ga0070663_100249969 3300005455 Bacteria 1403
47 Ga0070678_100009576 3300005456 Bacteria 5877
48 Ga0070678_100022866 3300005456 Bacteria 4154
49 Ga0070678_100026712 3300005456 Bacteria 3908
50 Ga0070662_100113728 3300005457 Bacteria 2065
51 Ga0070662_100208267 3300005457 Bacteria 1555
52 Ga0070662_100219943 3300005457 Bacteria 1515
53 Ga0070662_100448923 3300005457 Bacteria 1070
54 Ga0070681_10131220 3300005458 Bacteria 2438
55 Ga0068867_100012224 3300005459 Bacteria 6067
56 Ga0070679_100006195 3300005530 Bacteria 11138
57 Ga0068853_100157319 3300005539 Bacteria 2048
58 Ga0070672_100002003 3300005543 Bacteria 12792
59 Ga0070672_100026453 3300005543 Bacteria 4318
60 Ga0070672_100028846 3300005543 Bacteria 4155
61 Ga0070672_100033634 3300005543 Bacteria 3884
62 Ga0070672_100038231 3300005543 Bacteria 3666
63 Ga0070672_100053569 3300005543 Bacteria 3154
64 Ga0070672_100336441 3300005543 Bacteria 1285
65 Ga0070686_100021059 3300005544 Bacteria 3869
66 Ga0070695_100072495 3300005545 Bacteria 2258
67 Ga0070704_100803639 3300005549 Bacteria 840
68 Ga0070664_100458489 3300005564 Bacteria 1171
69 Ga0068857_100068142 3300005577 Bacteria 3168
70 Ga0068857_100337554 3300005577 Bacteria 1394
71 Ga0068854_100066703 3300005578 Bacteria 2620
72 Ga0070702_100006482 3300005615 Bacteria 5544
73 Ga0068852_100081171 3300005616 Bacteria 2878
74 Ga0068852_100199735 3300005616 Bacteria 1892
75 Ga0068852_100444406 3300005616 Bacteria 1282
76 Ga0068859_100059484 3300005617 Bacteria 3849
77 Ga0068859_100098525 3300005617 Bacteria 2977
78 Ga0068864_100125334 3300005618 Bacteria 2301
79 Ga0068864_100153585 3300005618 Bacteria 2087
80 Ga0068866_10002667 3300005718 Bacteria 7371
81 Ga0068866_10032021 3300005718 Bacteria 2539
82 Ga0068866_10352045 3300005718 Bacteria 936
83 Ga0068861_100011784 3300005719 Bacteria 6085
84 Ga0068861_100014098 3300005719 Bacteria 5604
85 Ga0068851_10122710 3300005834 Bacteria 1398
86 Ga0068851_10435552 3300005834 Bacteria 777
87 Ga0068870_10009162 3300005840 Bacteria 4488
88 Ga0068863_100031883 3300005841 Bacteria 5027
89 Ga0068863_100047492 3300005841 Bacteria 4071
90 Ga0068863_100273414 3300005841 Bacteria 1636
91 Ga0068863_100342953 3300005841 Bacteria 1453
92 Ga0068863_100845874 3300005841 Bacteria 914
93 Ga0068858_100011483 3300005842 Bacteria 8358
94 Ga0068858_100056552 3300005842 Bacteria 3625
95 Ga0068858_101461249 3300005842 Bacteria 674
96 Ga0068860_100014499 3300005843 Bacteria 7714
97 Ga0068860_100034080 3300005843 Bacteria 4883
98 Ga0068862_100014569 3300005844 Bacteria 6528
99 Ga0075368_10120548 3300006042 Bacteria 1086
100 Ga0075364_10146035 3300006051 Bacteria 1592
101 Ga0070716_100482361 3300006173 Bacteria 911
102 Ga0075362_10000766 3300006177 Bacteria 9569
103 Ga0075362_10030335 3300006177 Bacteria 2335
104 Ga0075367_10021765 3300006178 Bacteria 3588
105 Ga0075367_10042138 3300006178 Bacteria 2670
106 Ga0075367_10077658 3300006178 Bacteria 2005
107 Ga0075369_10004800 3300006186 Bacteria 5026
108 Ga0075366_10000673 3300006195 Bacteria 16127
109 Ga0075366_10024219 3300006195 Bacteria 3541
110 Ga0075366_10426888 3300006195 Bacteria 817
111 Ga0097621_100005843 3300006237 Bacteria 8692
112 Ga0097621_100100684 3300006237 Bacteria 2431
113 Ga0097621_100207413 3300006237 Bacteria 1703
114 Ga0075370_10000167 3300006353 Bacteria 22616
115 Ga0075370_10001602 3300006353 Bacteria 9980
116 Ga0075370_10087068 3300006353 Bacteria 1800
117 Ga0068871_100086480 3300006358 Bacteria 2605
118 Ga0068865_100031257 3300006881 Bacteria 3549
119 Ga0097620_100059481 3300006931 Bacteria 3849
120 Ga0097620_100098527 3300006931 Bacteria 2977
121 Ga0105240_10004619 3300009093 Bacteria 20879
122 Ga0111539_10654996 3300009094 Bacteria 1223
123 Ga0105245_10001278 3300009098 Bacteria 22694
124 Ga0114129_11553843 3300009147 Bacteria 811
125 Ga0105243_10024526 3300009148 Bacteria 4600
126 Ga0105243_10043131 3300009148 Bacteria 3535
127 Ga0105243_10074563 3300009148 Bacteria 2752
128 Ga0105243_10227152 3300009148 Bacteria 1654
129 Ga0105243_10806944 3300009148 Bacteria 925
130 Ga0105242_10021901 3300009176 Bacteria 5023
131 Ga0105242_10058685 3300009176 Bacteria 3156
132 Ga0105242_11080540 3300009176 Bacteria 815
133 Ga0105248_10852450 3300009177 Bacteria 1028
134 Ga0105237_10061045 3300009545 Bacteria 3770
135 Ga0105237_10223900 3300009545 Bacteria 1881
136 Ga0105249_10029780 3300009553 Bacteria 4932
137 Ga0105249_10058080 3300009553 Bacteria 3546
138 Ga0105249_11169257 3300009553 Bacteria 840
139 Ga0105239_10026856 3300010375 Bacteria 6336
140 Ga0105239_10067979 3300010375 Bacteria 3915
141 Ga0157371_10376994 3300013102 Bacteria 1035
142 Ga0157369_10556974 3300013105 Bacteria 1185
143 Ga0157374_10276244 3300013296 Bacteria 1658
144 Ga0157378_10010618 3300013297 Bacteria 8049
145 Ga0157378_10518177 3300013297 Bacteria 1193
146 Ga0163162_10009181 3300013306 Bacteria 9623
147 Ga0163162_10113717 3300013306 Bacteria 2806
148 Ga0163162_10496402 3300013306 Bacteria 1351
149 Ga0163162_10650131 3300013306 Bacteria 1178
150 Ga0157375_10015776 3300013308 Bacteria 6770
151 Ga0157375_10024899 3300013308 Bacteria 5548
152 Ga0157375_10039281 3300013308 Bacteria 4554
153 Ga0163163_10347112 3300014325 Bacteria 1540
154 Ga0157380_10011688 3300014326 Bacteria 6348
155 Ga0157380_10031042 3300014326 Bacteria 4099
156 Ga0157379_10017086 3300014968 Bacteria 6387
157 Ga0157379_10108628 3300014968 Bacteria 2491
158 Ga0157376_10720584 3300014969 Bacteria 1004
159 Ga0163161_10017349 3300017792 Bacteria 5038
160 Ga0163161_10377334 3300017792 Bacteria 1132
161 Ga0163161_10652620 3300017792 Bacteria 872
162 Ga0207666_1007034 3300025271 Bacteria 1472
163 Ga0209051_1002574 3300025303 Bacteria 12777
164 Ga0209051_1004247 3300025303 Bacteria 8926
165 Ga0209257_1098525 3300025304 Bacteria 717
166 Ga0207656_10095306 3300025321 Bacteria 1357
167 Ga0207656_10306630 3300025321 Bacteria 787
168 Ga0207682_10074524 3300025893 Bacteria 1443
169 Ga0207682_10082870 3300025893 Bacteria 1378
170 Ga0207642_10010087 3300025899 Bacteria 3313
171 Ga0207642_10012923 3300025899 Bacteria 3029
172 Ga0207688_10081357 3300025901 Bacteria 1850
173 Ga0207688_10176792 3300025901 Bacteria 1271
174 Ga0207680_10016228 3300025903 Bacteria 3905
175 Ga0207645_10007602 3300025907 Bacteria 7638
176 Ga0207645_10040637 3300025907 Bacteria 2979
177 Ga0207643_10003209 3300025908 Bacteria 8811
178 Ga0207643_10031468 3300025908 Bacteria 2958
179 Ga0207707_10192524 3300025912 Bacteria 1779
180 Ga0207695_10216235 3300025913 Bacteria 1825
181 Ga0207671_10019714 3300025914 Bacteria 5151
182 Ga0207671_10346966 3300025914 Bacteria 1177
183 Ga0207662_10059408 3300025918 Bacteria 2291
184 Ga0207652_10002539 3300025921 Bacteria 15323
185 Ga0207681_10011771 3300025923 Bacteria 5381
186 Ga0207681_10340857 3300025923 Bacteria 1197
187 Ga0207650_10007691 3300025925 Bacteria 7340
188 Ga0207650_10096119 3300025925 Bacteria 2272
189 Ga0207650_10362409 3300025925 Bacteria 1194
190 Ga0207650_10367434 3300025925 Bacteria 1186
191 Ga0207659_10050556 3300025926 Bacteria 2953
192 Ga0207659_10222695 3300025926 Bacteria 1518
193 Ga0207659_10290174 3300025926 Bacteria 1340
194 Ga0207687_10030625 3300025927 Bacteria 3629
195 Ga0207644_10001435 3300025931 Bacteria 15350
196 Ga0207644_10258179 3300025931 Bacteria 1392
197 Ga0207690_10280831 3300025932 Bacteria 1297
198 Ga0207690_10604058 3300025932 Bacteria 896
199 Ga0207706_10000845 3300025933 Bacteria 31549
200 Ga0207706_10021167 3300025933 Bacteria 5844
201 Ga0207706_10113711 3300025933 Bacteria 2381
202 Ga0207706_10687225 3300025933 Bacteria 875
203 Ga0207686_10019153 3300025934 Bacteria 3887
204 Ga0207686_10086564 3300025934 Bacteria 2058
205 Ga0207686_10097221 3300025934 Bacteria 1958
206 Ga0207709_10014445 3300025935 Bacteria 4361
207 Ga0207709_10021946 3300025935 Bacteria 3618
208 Ga0207709_10300056 3300025935 Bacteria 1194
209 Ga0207709_10457692 3300025935 Bacteria 988
210 Ga0207709_10521079 3300025935 Bacteria 930
211 Ga0207670_10146931 3300025936 Bacteria 1744
212 Ga0207669_10218690 3300025937 Bacteria 1396
213 Ga0207704_10009470 3300025938 Bacteria 4701
214 Ga0207704_10045846 3300025938 Bacteria 2600
215 Ga0207665_10345241 3300025939 Bacteria 1123
216 Ga0207691_10010194 3300025940 Bacteria 9015
217 Ga0207691_10021773 3300025940 Bacteria 6051
218 Ga0207691_10028125 3300025940 Bacteria 5266
219 Ga0207691_10069901 3300025940 Bacteria 3171
220 Ga0207691_10070074 3300025940 Bacteria 3167
221 Ga0207691_10135301 3300025940 Bacteria 2174
222 Ga0207691_10143124 3300025940 Bacteria 2106
223 Ga0207691_10149866 3300025940 Bacteria 2051
224 Ga0207691_10274034 3300025940 Bacteria 1452
225 Ga0207711_10103709 3300025941 Bacteria 2519
226 Ga0207711_10487187 3300025941 Bacteria 1149
227 Ga0207711_10668795 3300025941 Bacteria 969
228 Ga0207689_10005034 3300025942 Bacteria 11908
229 Ga0207689_10015754 3300025942 Bacteria 6402
230 Ga0207679_10801062 3300025945 Bacteria 859
231 Ga0207651_10036901 3300025960 Bacteria 3196
232 Ga0207651_10189531 3300025960 Bacteria 1639
233 Ga0207651_10191647 3300025960 Bacteria 1631
234 Ga0207651_10250122 3300025960 Bacteria 1450
235 Ga0207651_10497733 3300025960 Bacteria 1053
236 Ga0207651_10574790 3300025960 Bacteria 982
237 Ga0207712_10068958 3300025961 Bacteria 2536
238 Ga0207712_10740666 3300025961 Bacteria 860
239 Ga0207668_10030247 3300025972 Bacteria 3557
240 Ga0207668_10171801 3300025972 Bacteria 1701
241 Ga0207668_10377747 3300025972 Bacteria 1192
242 Ga0207640_10224264 3300025981 Bacteria 1441
243 Ga0207658_10000959 3300025986 Bacteria 23778
244 Ga0207658_10109869 3300025986 Bacteria 2177
245 Ga0207658_11179249 3300025986 Bacteria 700
246 Ga0207677_10087043 3300026023 Bacteria 2260
247 Ga0207703_10035556 3300026035 Bacteria 3958
248 Ga0207703_10038363 3300026035 Bacteria 3822
249 Ga0207703_10718663 3300026035 Bacteria 951
250 Ga0207639_10782098 3300026041 Bacteria 889
251 Ga0207639_11007306 3300026041 Bacteria 780
252 Ga0207708_10000767 3300026075 Bacteria 24167
253 Ga0207708_10594943 3300026075 Bacteria 936
254 Ga0207641_10029108 3300026088 Bacteria 4567
255 Ga0207641_10085698 3300026088 Bacteria 2745
256 Ga0207641_10342970 3300026088 Bacteria 1422
257 Ga0207648_10003104 3300026089 Bacteria 17543
258 Ga0207648_10005079 3300026089 Bacteria 13337
259 Ga0207648_10112167 3300026089 Bacteria 2394
260 Ga0207648_10126487 3300026089 Bacteria 2248
261 Ga0207648_10218751 3300026089 Bacteria 1692
262 Ga0207648_10365619 3300026089 Bacteria 1302
263 Ga0207676_10019189 3300026095 Bacteria 4983
264 Ga0207676_10070617 3300026095 Bacteria 2801
265 Ga0207676_10208702 3300026095 Bacteria 1731
266 Ga0207676_10232318 3300026095 Bacteria 1649
267 Ga0207674_10027378 3300026116 Bacteria 6032
268 Ga0207674_10205482 3300026116 Bacteria 1919
269 Ga0207675_100002571 3300026118 Bacteria 17972
270 Ga0207675_100004297 3300026118 Bacteria 13767
271 Ga0207683_10014677 3300026121 Bacteria 6671
272 Ga0207683_10029024 3300026121 Bacteria 4788
273 Ga0207683_10040448 3300026121 Bacteria 4068
274 Ga0207683_10092858 3300026121 Bacteria 2689
275 Ga0207683_10137739 3300026121 Bacteria 2198
276 Ga0207698_10001243 3300026142 Bacteria 14895
277 Ga0207698_10017788 3300026142 Bacteria 4831
278 Ga0207698_10083685 3300026142 Bacteria 2583
279 Ga0207698_10385048 3300026142 Bacteria 1335
280 Ga0207698_10422524 3300026142 Bacteria 1279
281 Ga0207698_10603726 3300026142 Bacteria 1082
282 Ga0209813_10117407 3300027866 Bacteria 923
283 Ga0268265_10054973 3300028380 Bacteria 3023
284 Ga0268264_10011851 3300028381 Bacteria 7185
285 Ga0268264_10398200 3300028381 Bacteria 1322
286 Ga0268264_10718574 3300028381 Bacteria 993
287 Ga0307517_10315753 3300028786 Bacteria 867
288 Ga0307515_10000020 3300028794 Bacteria 411735
289 Ga0307515_10000053 3300028794 Bacteria 266512
290 Ga0307515_10006495 3300028794 Bacteria 23397
291 Ga0307515_10117949 3300028794 Bacteria 3033
292 Ga0307513_10006695 3300031456 Bacteria 15034
293 Ga0307513_10059231 3300031456 Bacteria 4065
294 Ga0307513_10379345 3300031456 Bacteria 1154
295 Ga0307509_10001851 3300031507 Bacteria 34975
296 Ga0307408_100401301 3300031548 Bacteria 1177
297 Ga0307508_10004920 3300031616 Bacteria 12859
298 Ga0307514_10117885 3300031649 Bacteria 1861
299 Ga0307516_10003104 3300031730 Bacteria 21606
300 Ga0307516_10096888 3300031730 Bacteria 2770
301 Ga0307405_10236260 3300031731 Bacteria 1351
302 Ga0307413_10000382 3300031824 Bacteria 14204
303 Ga0307518_10094086 3300031838 Bacteria 2153
304 Ga0307410_10214634 3300031852 Bacteria 1476
305 Ga0307407_10553340 3300031903 Bacteria 851
306 Ga0307409_100110678 3300031995 Bacteria 2302
307 Ga0307409_100297948 3300031995 Bacteria 1499
308 Ga0307416_100464965 3300032002 Bacteria 1321
309 Ga0307414_10400247 3300032004 Bacteria 1192
310 Ga0307411_10046325 3300032005 Bacteria 2802
311 Ga0307411_10075658 3300032005 Bacteria 2299
312 Ga0307510_10009361 3300033180 Bacteria 11669
313 Ga0373932_0009360 3300035112 Bacteria 2355
314 Ga0373956_0217390 3300035119 Bacteria 907
315 Ga0373943_0148064 3300035170 Bacteria 1270
316 Ga0373946_0190814 3300035171 Bacteria 977
317 Ga0373962_0071781 3300035242 Bacteria 1036
318 Ga0373927_0231145 3300035695 Bacteria 1215
319 Ga0373937_0122739 3300036401 Bacteria 2422
320 Ga0373937_0184879 3300036401 Bacteria 1957
321 Ga0373925_0058875 3300037068 Bacteria 2881
322 Ga0373925_0404107 3300037068 Bacteria 1114
323 Ga0395905_0071619 3300037471 Bacteria 3249
324 Ga0395905_0104710 3300037471 Bacteria 2656
325 Ga0395905_0148998 3300037471 Bacteria 2201
326 Ga0451793_0570148 3300041452 Bacteria 767
327 Ga0451577_0026925 3300042876 Bacteria 5205
328 Ga0466969_0000385 3300044656 Bacteria 24302
329 Ga0466972_0050146 3300044658 Bacteria 2015
330 Ga0453683_0308144 3300044673 Bacteria 1013
331 Ga0453684_0061734 3300044712 Bacteria 4808
332 Ga0453684_0464706 3300044712 Bacteria 1406
333 Ga0466970_0149302 3300044765 Bacteria 1290
334 Ga0466960_0120325 3300044901 Bacteria 1374
335 Ga0466959_0056397 3300045049 Bacteria 2866
336 Ga0451576_0002187 3300045051 Bacteria 30196
337 Ga0451576_0168520 3300045051 Bacteria 2285
338 Ga0495592_0000028 3300046454 Bacteria 132590
339 Ga0495590_0003199 3300046457 Bacteria 6694
340 Ga0495629_0063966 3300046459 Bacteria 2569
341 Ga0495629_0426595 3300046459 Bacteria 899
342 Ga0495629_0723868 3300046459 Bacteria 660
343 Ga0495664_0405456 3300046477 Bacteria 818
344 Ga0495620_0212672 3300046515 Bacteria 741
345 Ga0495628_0590250 3300046516 Bacteria 794
346 Ga0495632_0049793 3300046519 Bacteria 2069
347 Ga0495642_0018831 3300046528 Bacteria 2704
348 Ga0495586_0315633 3300046535 Bacteria 896
349 Ga0495621_0023670 3300046539 Bacteria 2044
350 Ga0495645_0042282 3300046543 Bacteria 3323
351 Ga0495645_0103562 3300046543 Bacteria 2022
352 Ga0495668_0020830 3300046616 Bacteria 3766
353 Ga0495668_0330294 3300046616 Bacteria 836
354 Ga0495611_0089374 3300046648 Bacteria 1423
355 Ga0495647_0009507 3300046681 Bacteria 3296
356 Ga0495658_0075594 3300046683 Bacteria 1966
357 Ga0495624_0016781 3300046690 Bacteria 4928
358 Ga0495649_0001518 3300046694 Bacteria 17442
359 Ga0495674_0265755 3300047319 Bacteria 1409
360 Ga0495676_0038527 3300047321 Bacteria 3969
361 Ga0495684_0091526 3300047471 Bacteria 2304
362 Ga0495686_0083884 3300047472 Bacteria 1943
363 Ga0495593_0019598 3300047673 Bacteria 3792
364 Ga0495626_0061141 3300048091 Bacteria 1714
365 Ga0496101_0566805 3300048904 Bacteria 898
366 Ga0496102_0002801 3300048905 Bacteria 14872
367 Ga0496108_0080372 3300048911 Bacteria 2761
368 Ga0496109_0081688 3300048912 Bacteria 2978
369 Ga0496110_0783820 3300048913 Bacteria 857
370 Ga0496114_0294840 3300048917 Bacteria 1431
371 Ga0496124_0000317 3300048927 Bacteria 89188
372 Ga0496125_0009263 3300048928 Bacteria 10166
373 Ga0501034_0000406 3300049571 Bacteria 72755
374 Ga0501034_0095781 3300049571 Bacteria 2964
375 Ga0501043_0000004 3300049579 Bacteria 291085
376 Ga0501046_0000016 3300049580 Bacteria 234374
377 Ga0501047_0000012 3300049581 Bacteria 368824
378 Ga0501048_0007739 3300049582 Bacteria 8144
379 Ga0501068_0000303 3300049584 Bacteria 24685
380 Ga0501072_0004011 3300049588 Bacteria 11140
381 Ga0501073_0017254 3300049589 Bacteria 5229
382 Ga0501080_0114322 3300049742 Bacteria 2502
383 Ga0501080_0200616 3300049742 Bacteria 1832
384 Ga0501282_010596 3300049778 Bacteria 990
385 nmdc:mga03683_306291_c1 3300050489 Bacteria 746
386 nmdc:mga03683_59257_c1 3300050489 Bacteria 1615
387 nmdc:mga03n38_399951_c1 3300050490 Bacteria 756
388 nmdc:mga00v17_82966_c1 3300050491 Bacteria 2004
389 nmdc:mga0k408_101244_c1 3300050493 Bacteria 1699
390 nmdc:mga0k408_1729_c1 3300050493 Bacteria 11722
391 nmdc:mga0k408_2776_c1 3300050493 Bacteria 9308
392 nmdc:mga0k408_28506_c1 3300050493 Bacteria 3175
393 nmdc:mga0k408_5832_c1 3300050493 Bacteria 6562
394 nmdc:mga0k408_6487_c1 3300050493 Bacteria 6236
395 nmdc:mga0k408_732_c1 3300050493 Bacteria 18001
396 nmdc:mga0k408_82661_c1 3300050493 Bacteria 1882
397 nmdc:mga06z11_105485_c1 3300050494 Bacteria 1553
398 nmdc:mga06z11_123048_c1 3300050494 Bacteria 1449
399 nmdc:mga06z11_43994_c1 3300050494 Bacteria 2250
400 nmdc:mga07m45_13775_c1 3300050496 Bacteria 4295
401 nmdc:mga07m45_1544_c1 3300050496 Bacteria 10590
402 nmdc:mga07m45_434_c1 3300050496 Bacteria 17366
403 nmdc:mga07m45_46676_c1 3300050496 Bacteria 2434
404 nmdc:mga07m45_75677_c1 3300050496 Bacteria 1919
405 nmdc:mga08y16_640133_c1 3300050511 Bacteria 1068
406 Ga0495601_0031942 3300053077 Bacteria 3275
407 Ga0495595_0012992 3300053084 Bacteria 3513
408 Ga0495619_0046311 3300053085 Bacteria 2859
409 Ga0500644_0022549 3300053088 Bacteria 1900
410 Ga0500651_0006242 3300053093 Bacteria 6859
411 Ga0500651_0088952 3300053093 Bacteria 1904
412 Ga0500652_051194 3300053131 Bacteria 1687
413 Ga0500658_0003009 3300053134 Bacteria 6470
414 Ga0500559_0002434 3300053136 Bacteria 9633
415 Ga0500568_0036624 3300053139 Bacteria 1995
416 Ga0500622_0004444 3300053156 Bacteria 8804
417 Ga0501084_0175005 3300054114 Bacteria 1811
418 Ga0590071_000859 3300059421 Bacteria 8461
419 Ga0495605_0154693
420 Ga0070676_10018036
421 Ga0070676_10186093
422 Ga0070683_100237396
423 Ga0070690_100029058
424 Ga0070670_100003129
425 Ga0070670_100079386
426 Ga0070677_10067259
427 Ga0068869_100046053
428 Ga0068869_100050335
429 Ga0070680_100001873
430 Ga0070680_100149072
431 Ga0068868_100126480
432 Ga0068868_100594017
433 Ga0070689_100009503
434 Ga0070689_100333187
435 Ga0070691_10043452
436 Ga0070692_10262172
437 Ga0070668_100004749
438 Ga0070669_100021017
439 Ga0070669_100045796
440 Ga0070669_100306118
441 Ga0070675_100007695
442 Ga0070675_100093079
443 Ga0070675_100139624
444 Ga0070671_100011653
445 Ga0070671_100323279
446 Ga0070674_100008402
447 Ga0070674_100034557
448 Ga0070674_100051467
449 Ga0070674_100168973
450 Ga0070674_100334175
451 Ga0070673_100022540
452 Ga0070673_100027067
453 Ga0070673_100054663
454 Ga0070673_100159435
455 Ga0070673_100441904
456 Ga0070659_100287722
457 Ga0070667_100001171
458 Ga0070667_100062553
459 Ga0070705_100373752
460 Ga0070700_100005633
461 Ga0070700_100093275
462 Ga0070694_100110885
463 Ga0070708_100000040
464 Ga0070663_100249969
465 Ga0070678_100009576
466 Ga0070678_100022866
467 Ga0070678_100026712
468 Ga0070662_100113728
469 Ga0070662_100208267
470 Ga0070662_100219943
471 Ga0070662_100448923
472 Ga0070681_10131220
473 Ga0068867_100012224
474 Ga0070679_100006195
475 Ga0068853_100157319
476 Ga0070672_100002003
477 Ga0070672_100026453
478 Ga0070672_100028846
479 Ga0070672_100033634
480 Ga0070672_100038231
481 Ga0070672_100053569
482 Ga0070672_100336441
483 Ga0070686_100021059
484 Ga0070695_100072495
485 Ga0070704_100803639
486 Ga0070664_100458489
487 Ga0068857_100068142
488 Ga0068857_100337554
489 Ga0068854_100066703
490 Ga0070702_100006482
491 Ga0068852_100081171
492 Ga0068852_100199735
493 Ga0068852_100444406
494 Ga0068859_100059484
495 Ga0068859_100098525
496 Ga0068864_100125334
497 Ga0068864_100153585
498 Ga0068866_10002667
499 Ga0068866_10032021
500 Ga0068866_10352045
501 Ga0068861_100011784
502 Ga0068861_100014098
503 Ga0068851_10122710
504 Ga0068851_10435552
505 Ga0068870_10009162
506 Ga0068863_100031883
507 Ga0068863_100047492
508 Ga0068863_100273414
509 Ga0068863_100342953
510 Ga0068863_100845874
511 Ga0068858_100011483
512 Ga0068858_100056552
513 Ga0068858_101461249
514 Ga0068860_100014499
515 Ga0068860_100034080
516 Ga0068862_100014569
517 Ga0075368_10120548
518 Ga0075364_10146035
519 Ga0070716_100482361
520 Ga0075362_10000766
521 Ga0075362_10030335
522 Ga0075367_10021765
523 Ga0075367_10042138
524 Ga0075367_10077658
525 Ga0075369_10004800
526 Ga0075366_10000673
527 Ga0075366_10024219
528 Ga0075366_10426888
529 Ga0097621_100005843
530 Ga0097621_100100684
531 Ga0097621_100207413
532 Ga0075370_10000167
533 Ga0075370_10001602
534 Ga0075370_10087068
535 Ga0068871_100086480
536 Ga0068865_100031257
537 Ga0097620_100059481
538 Ga0097620_100098527
539 Ga0105240_10004619
540 Ga0111539_10654996
541 Ga0105245_10001278
542 Ga0114129_11553843
543 Ga0105243_10024526
544 Ga0105243_10043131
545 Ga0105243_10074563
546 Ga0105243_10227152
547 Ga0105243_10806944
548 Ga0105242_10021901
549 Ga0105242_10058685
550 Ga0105242_11080540
551 Ga0105248_10852450
552 Ga0105237_10061045
553 Ga0105237_10223900
554 Ga0105249_10029780
555 Ga0105249_10058080
556 Ga0105249_11169257
557 Ga0105239_10026856
558 Ga0105239_10067979
559 Ga0157371_10376994
560 Ga0157369_10556974
561 Ga0157374_10276244
562 Ga0157378_10010618
563 Ga0157378_10518177
564 Ga0163162_10009181
565 Ga0163162_10113717
566 Ga0163162_10496402
567 Ga0163162_10650131
568 Ga0157375_10015776
569 Ga0157375_10024899
570 Ga0157375_10039281
571 Ga0163163_10347112
572 Ga0157380_10011688
573 Ga0157380_10031042
574 Ga0157379_10017086
575 Ga0157379_10108628
576 Ga0157376_10720584
577 Ga0163161_10017349
578 Ga0163161_10377334
579 Ga0163161_10652620
580 Ga0207666_1007034
581 Ga0209051_1002574
582 Ga0209051_1004247
583 Ga0209257_1098525
584 Ga0207656_10095306
585 Ga0207656_10306630
586 Ga0207682_10074524
587 Ga0207682_10082870
588 Ga0207642_10010087
589 Ga0207642_10012923
590 Ga0207688_10081357
591 Ga0207688_10176792
592 Ga0207680_10016228
593 Ga0207645_10007602
594 Ga0207645_10040637
595 Ga0207643_10003209
596 Ga0207643_10031468
597 Ga0207707_10192524
598 Ga0207695_10216235
599 Ga0207671_10019714
600 Ga0207671_10346966
601 Ga0207662_10059408
602 Ga0207652_10002539
603 Ga0207681_10011771
604 Ga0207681_10340857
605 Ga0207650_10007691
606 Ga0207650_10096119
607 Ga0207650_10362409
608 Ga0207650_10367434
609 Ga0207659_10050556
610 Ga0207659_10222695
611 Ga0207659_10290174
612 Ga0207687_10030625
613 Ga0207644_10001435
614 Ga0207644_10258179
615 Ga0207690_10280831
616 Ga0207690_10604058
617 Ga0207706_10000845
618 Ga0207706_10021167
619 Ga0207706_10113711
620 Ga0207706_10687225
621 Ga0207686_10019153
622 Ga0207686_10086564
623 Ga0207686_10097221
624 Ga0207709_10014445
625 Ga0207709_10021946
626 Ga0207709_10300056
627 Ga0207709_10457692
628 Ga0207709_10521079
629 Ga0207670_10146931
630 Ga0207669_10218690
631 Ga0207704_10009470
632 Ga0207704_10045846
633 Ga0207665_10345241
634 Ga0207691_10010194
635 Ga0207691_10021773
636 Ga0207691_10028125
637 Ga0207691_10069901
638 Ga0207691_10070074
639 Ga0207691_10135301
640 Ga0207691_10143124
641 Ga0207691_10149866
642 Ga0207691_10274034
643 Ga0207711_10103709
644 Ga0207711_10487187
645 Ga0207711_10668795
646 Ga0207689_10005034
647 Ga0207689_10015754
648 Ga0207679_10801062
649 Ga0207651_10036901
650 Ga0207651_10189531
651 Ga0207651_10191647
652 Ga0207651_10250122
653 Ga0207651_10497733
654 Ga0207651_10574790
655 Ga0207712_10068958
656 Ga0207712_10740666
657 Ga0207668_10030247
658 Ga0207668_10171801
659 Ga0207668_10377747
660 Ga0207640_10224264
661 Ga0207658_10000959
662 Ga0207658_10109869
663 Ga0207658_11179249
664 Ga0207677_10087043
665 Ga0207703_10035556
666 Ga0207703_10038363
667 Ga0207703_10718663
668 Ga0207639_10782098
669 Ga0207639_11007306
670 Ga0207708_10000767
671 Ga0207708_10594943
672 Ga0207641_10029108
673 Ga0207641_10085698
674 Ga0207641_10342970
675 Ga0207648_10003104
676 Ga0207648_10005079
677 Ga0207648_10112167
678 Ga0207648_10126487
679 Ga0207648_10218751
680 Ga0207648_10365619
681 Ga0207676_10019189
682 Ga0207676_10070617
683 Ga0207676_10208702
684 Ga0207676_10232318
685 Ga0207674_10027378
686 Ga0207674_10205482
687 Ga0207675_100002571
688 Ga0207675_100004297
689 Ga0207683_10014677
690 Ga0207683_10029024
691 Ga0207683_10040448
692 Ga0207683_10092858
693 Ga0207683_10137739
694 Ga0207698_10001243
695 Ga0207698_10017788
696 Ga0207698_10083685
697 Ga0207698_10385048
698 Ga0207698_10422524
699 Ga0207698_10603726
700 Ga0209813_10117407
701 Ga0268265_10054973
702 Ga0268264_10011851
703 Ga0268264_10398200
704 Ga0268264_10718574
705 Ga0307517_10315753
706 Ga0307515_10000020
707 Ga0307515_10000053
708 Ga0307515_10006495
709 Ga0307515_10117949
710 Ga0307513_10006695
711 Ga0307513_10059231
712 Ga0307513_10379345
713 Ga0307509_10001851
714 Ga0307408_100401301
715 Ga0307508_10004920
716 Ga0307514_10117885
717 Ga0307516_10003104
718 Ga0307516_10096888
719 Ga0307405_10236260
720 Ga0307413_10000382
721 Ga0307518_10094086
722 Ga0307410_10214634
723 Ga0307407_10553340
724 Ga0307409_100110678
725 Ga0307409_100297948
726 Ga0307416_100464965
727 Ga0307414_10400247
728 Ga0307411_10046325
729 Ga0307411_10075658
730 Ga0307510_10009361
731 Ga0373932_0009360
732 Ga0373956_0217390
733 Ga0373943_0148064
734 Ga0373946_0190814
735 Ga0373962_0071781
736 Ga0373927_0231145
737 Ga0373937_0122739
738 Ga0373937_0184879
739 Ga0373925_0058875
740 Ga0373925_0404107
741 Ga0395905_0071619
742 Ga0395905_0104710
743 Ga0395905_0148998
744 Ga0451793_0570148
745 Ga0451577_0026925
746 Ga0466969_0000385
747 Ga0466972_0050146
748 Ga0453683_0308144
749 Ga0453684_0061734
750 Ga0453684_0464706
751 Ga0466970_0149302
752 Ga0466960_0120325
753 Ga0466959_0056397
754 Ga0451576_0002187
755 Ga0451576_0168520
756 Ga0495592_0000028
757 Ga0495590_0003199
758 Ga0495629_0063966
759 Ga0495629_0426595
760 Ga0495629_0723868
761 Ga0495664_0405456
762 Ga0495620_0212672
763 Ga0495628_0590250
764 Ga0495632_0049793
765 Ga0495642_0018831
766 Ga0495586_0315633
767 Ga0495621_0023670
768 Ga0495645_0042282
769 Ga0495645_0103562
770 Ga0495668_0020830
771 Ga0495668_0330294
772 Ga0495611_0089374
773 Ga0495647_0009507
774 Ga0495658_0075594
775 Ga0495624_0016781
776 Ga0495649_0001518
777 Ga0495674_0265755
778 Ga0495676_0038527
779 Ga0495684_0091526
780 Ga0495686_0083884
781 Ga0495593_0019598
782 Ga0495626_0061141
783 Ga0496101_0566805
784 Ga0496102_0002801
785 Ga0496108_0080372
786 Ga0496109_0081688
787 Ga0496110_0783820
788 Ga0496114_0294840
789 Ga0496124_0000317
790 Ga0496125_0009263
791 Ga0501034_0000406
792 Ga0501034_0095781
793 Ga0501043_0000004
794 Ga0501046_0000016
795 Ga0501047_0000012
796 Ga0501048_0007739
797 Ga0501068_0000303
798 Ga0501072_0004011
799 Ga0501073_0017254
800 Ga0501080_0114322
801 Ga0501080_0200616
802 Ga0501282_010596
803 nmdc:mga03683_306291_c1
804 nmdc:mga03683_59257_c1
805 nmdc:mga03n38_399951_c1
806 nmdc:mga00v17_82966_c1
807 nmdc:mga0k408_101244_c1
808 nmdc:mga0k408_1729_c1
809 nmdc:mga0k408_2776_c1
810 nmdc:mga0k408_28506_c1
811 nmdc:mga0k408_5832_c1
812 nmdc:mga0k408_6487_c1
813 nmdc:mga0k408_732_c1
814 nmdc:mga0k408_82661_c1
815 nmdc:mga06z11_105485_c1
816 nmdc:mga06z11_123048_c1
817 nmdc:mga06z11_43994_c1
818 nmdc:mga07m45_13775_c1
819 nmdc:mga07m45_1544_c1
820 nmdc:mga07m45_434_c1
821 nmdc:mga07m45_46676_c1
822 nmdc:mga07m45_75677_c1
823 nmdc:mga08y16_640133_c1
824 Ga0495601_0031942
825 Ga0495595_0012992
826 Ga0495619_0046311
827 Ga0500644_0022549
828 Ga0500651_0006242
829 Ga0500651_0088952
830 Ga0500652_051194
831 Ga0500658_0003009
832 Ga0500559_0002434
833 Ga0500568_0036624
834 Ga0500622_0004444
835 Ga0501084_0175005
836 Ga0590071_000859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

17

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nwo-assembly1.cif.gz_A computationally designed two-component self-assembling tetrahedral cage t33-15 0.9642 15 194
8cuw-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9637 15 194
8cuu-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9616 15 194
8cuv-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9612 15 196
3k6a-assembly2.cif.gz_B crystal structure of molybdenum cofactor biosynthesis protein mog from shewanella oneidensis 0.9607 15 195
ID Description Score Start End Superfamily
1di6A00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9397 13 200 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9373 13 179 3.40.980.10
4xcwB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9372 10 196 3.40.980.10
1di6A00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9347 13 200 3.40.980.10
4xcwB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9272 10 196 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A0Q6T2B2-F1-model_v4 MoaB/Mog domain-containing protein 0.9781 12 202 GO:0006777
AF-A0A401JHH7-F1-model_v4 Molybdopterin biosynthesis molybdochelatase MogA 0.9753 13 201 GO:0006777
AF-A0A437LRV1-F1-model_v4 Molybdopterin adenylyltransferase (EC 2.7.7.75) 0.9736 13 204 GO:0006777
GO:0061598
AF-A0A2E5F3T9-F1-model_v4 Molybdopterin adenylyltransferase 0.9686 15 189 GO:0006777
GO:0016779
AF-A0A536V3Y1-F1-model_v4 Molybdopterin adenylyltransferase (EC 2.7.7.75) 0.9681 12 143 GO:0006777
GO:0061598

Map