F439368

General Info

Members Datasets Scaffolds Average Seq Length
418 253 836 195

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0090532|Ga0495608_0090532_791_1510
Length 239
Sequence VLSPCCHRFFVEFDDEVVAGRPVSRRHGAYRSDFQQHPTMRRSDMGKIVMSGPQNVSLDGVVQDPDGEEGFSLGGWFVQFGGKDLEQWNKVALDEALGADAWLLGRRSYEFFGVRWRPRSGELADRLNNMPKYVVSSTLEHPDWNNSTVLKGDVVTEVSKLKQELDGEIVIPASYQLGRTLMEHDLVDELRLVVFPVVLGAGERLFGETGDKKPMRLVNTQTIGDGLAFLTYEFLVRDA

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 10.05
Rhizosphere 83.97
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0090532 3300046511 Bacteria 1979
2 JGI25407J50210_10001005 3300003373 Bacteria 6140
3 Ga0070683_100001077 3300005329 Bacteria 20511
4 Ga0070683_100099263 3300005329 Bacteria 2740
5 Ga0070683_100104116 3300005329 Bacteria 2675
6 Ga0068869_100043042 3300005334 Bacteria 3241
7 Ga0070682_100057261 3300005337 Bacteria 2455
8 Ga0070682_100323634 3300005337 Bacteria 1140
9 Ga0068868_100013065 3300005338 Bacteria 6079
10 Ga0070687_100302062 3300005343 Bacteria 1016
11 Ga0070661_100408175 3300005344 Bacteria 1075
12 Ga0070671_100018034 3300005355 Bacteria 5727
13 Ga0070671_100321777 3300005355 Bacteria 1318
14 Ga0070659_100316672 3300005366 Bacteria 1304
15 Ga0070709_10539713 3300005434 Bacteria 891
16 Ga0070714_100778223 3300005435 Bacteria 926
17 Ga0070713_100059305 3300005436 Bacteria 3196
18 Ga0070713_100586845 3300005436 Bacteria 1058
19 Ga0070711_100041334 3300005439 Bacteria 3113
20 Ga0070711_100090592 3300005439 Bacteria 2203
21 Ga0070711_100099953 3300005439 Bacteria 2108
22 Ga0070700_100000915 3300005441 Bacteria 14574
23 Ga0070708_100767239 3300005445 Bacteria 907
24 Ga0070678_100366381 3300005456 Bacteria 1243
25 Ga0070678_100644072 3300005456 Bacteria 950
26 Ga0070662_100060943 3300005457 Bacteria 2753
27 Ga0068867_100636383 3300005459 Bacteria 934
28 Ga0070685_10097899 3300005466 Bacteria 1786
29 Ga0070685_10383473 3300005466 Bacteria 969
30 Ga0070706_100445907 3300005467 Bacteria 1204
31 Ga0070706_100662458 3300005467 Bacteria 969
32 Ga0070707_100265512 3300005468 Bacteria 1669
33 Ga0070698_100177682 3300005471 Bacteria 2067
34 Ga0070698_100385932 3300005471 Bacteria 1333
35 Ga0070699_100026304 3300005518 Bacteria 5019
36 Ga0070699_100769686 3300005518 Bacteria 881
37 Ga0070679_100095674 3300005530 Bacteria 2957
38 Ga0070684_100059358 3300005535 Bacteria 3344
39 Ga0070684_100061954 3300005535 Bacteria 3276
40 Ga0070672_100304843 3300005543 Bacteria 1351
41 Ga0070686_100321928 3300005544 Bacteria 1153
42 Ga0070695_100449497 3300005545 Bacteria 987
43 Ga0070695_100710509 3300005545 Bacteria 798
44 Ga0070665_100085476 3300005548 Bacteria 3160
45 Ga0070704_100060939 3300005549 Bacteria 2698
46 Ga0070704_100575505 3300005549 Bacteria 987
47 Ga0070664_100024368 3300005564 Bacteria 5004
48 Ga0070664_101064588 3300005564 Unclassified 761
49 Ga0068857_100208724 3300005577 Bacteria 1782
50 Ga0068857_100272556 3300005577 Bacteria 1555
51 Ga0068854_100020464 3300005578 Bacteria 4477
52 Ga0068856_100003467 3300005614 Bacteria 15940
53 Ga0070702_100001929 3300005615 Bacteria 8723
54 Ga0068852_100011419 3300005616 Bacteria 6686
55 Ga0068866_10287778 3300005718 Bacteria 1021
56 Ga0068866_10480562 3300005718 Bacteria 818
57 Ga0068861_100615625 3300005719 Bacteria 999
58 Ga0068858_100008305 3300005842 Bacteria 9984
59 Ga0068858_100096074 3300005842 Bacteria 2761
60 Ga0068858_100410764 3300005842 Bacteria 1301
61 Ga0081455_10012182 3300005937 Bacteria 8588
62 Ga0081455_10023738 3300005937 Bacteria 5698
63 Ga0081455_10033716 3300005937 Bacteria 4597
64 Ga0081455_10194705 3300005937 Bacteria 1523
65 Ga0081538_10000440 3300005981 Bacteria 46697
66 Ga0070717_10172863 3300006028 Bacteria 1880
67 Ga0070717_10257982 3300006028 Bacteria 1542
68 Ga0075365_10054064 3300006038 Bacteria 2661
69 Ga0075363_100038662 3300006048 Bacteria 2510
70 Ga0075364_10591086 3300006051 Bacteria 758
71 Ga0075432_10139093 3300006058 Unclassified 925
72 Ga0070712_100041908 3300006175 Bacteria 3146
73 Ga0070712_100045105 3300006175 Bacteria 3042
74 Ga0075362_10328133 3300006177 Unclassified 763
75 Ga0075367_10107651 3300006178 Bacteria 1709
76 Ga0075367_10124248 3300006178 Bacteria 1592
77 Ga0075428_100115328 3300006844 Bacteria 2926
78 Ga0075428_100293795 3300006844 Bacteria 1747
79 Ga0075428_100738274 3300006844 Bacteria 1048
80 Ga0075430_100027003 3300006846 Bacteria 4882
81 Ga0075430_100353901 3300006846 Bacteria 1213
82 Ga0075431_100010102 3300006847 Bacteria 9486
83 Ga0075431_100251585 3300006847 Bacteria 1795
84 Ga0075433_10010341 3300006852 Bacteria 7483
85 Ga0075433_10041811 3300006852 Bacteria 3973
86 Ga0075434_100095760 3300006871 Bacteria 2974
87 Ga0075434_100381254 3300006871 Bacteria 1431
88 Ga0075434_101094840 3300006871 Bacteria 810
89 Ga0075429_100018145 3300006880 Bacteria 6089
90 Ga0075429_100232642 3300006880 Bacteria 1614
91 Ga0075429_100380427 3300006880 Unclassified 1236
92 Ga0075429_100432793 3300006880 Bacteria 1153
93 Ga0068865_100424757 3300006881 Bacteria 1094
94 Ga0075436_100025261 3300006914 Bacteria 4088
95 Ga0075436_100693417 3300006914 Bacteria 754
96 Ga0075435_100013335 3300007076 Bacteria 6110
97 Ga0111539_10064577 3300009094 Bacteria 4329
98 Ga0111539_10626725 3300009094 Bacteria 1252
99 Ga0111539_11667616 3300009094 Bacteria 739
100 Ga0105245_10016761 3300009098 Bacteria 6398
101 Ga0105245_10024199 3300009098 Bacteria 5331
102 Ga0105245_10280030 3300009098 Bacteria 1629
103 Ga0105247_10410191 3300009101 Bacteria 967
104 Ga0114129_11127003 3300009147 Bacteria 981
105 Ga0105243_10058085 3300009148 Bacteria 3082
106 Ga0105243_10458664 3300009148 Bacteria 1198
107 Ga0105248_10120010 3300009177 Bacteria 2966
108 Ga0105248_10846640 3300009177 Bacteria 1032
109 Ga0105239_10017235 3300010375 Bacteria 7986
110 Ga0105239_10339786 3300010375 Bacteria 1694
111 Ga0105239_11138431 3300010375 Bacteria 899
112 Ga0105246_10008341 3300011119 Bacteria 6365
113 Ga0105246_10047627 3300011119 Bacteria 2928
114 Ga0105246_10152212 3300011119 Bacteria 1752
115 Ga0157369_11458823 3300013105 Bacteria 696
116 Ga0157374_10012972 3300013296 Bacteria 7264
117 Ga0157374_11360399 3300013296 Bacteria 732
118 Ga0157378_10481679 3300013297 Bacteria 1236
119 Ga0163162_10147114 3300013306 Bacteria 2472
120 Ga0163162_10367794 3300013306 Bacteria 1571
121 Ga0163162_10540299 3300013306 Bacteria 1294
122 Ga0157372_10002922 3300013307 Bacteria 18455
123 Ga0157375_10569553 3300013308 Bacteria 1293
124 Ga0157375_11332180 3300013308 Bacteria 845
125 Ga0163163_10046554 3300014325 Bacteria 4261
126 Ga0163163_10344979 3300014325 Bacteria 1545
127 Ga0163163_10467764 3300014325 Bacteria 1321
128 Ga0163163_10658547 3300014325 Bacteria 1110
129 Ga0157380_10447329 3300014326 Bacteria 1240
130 Ga0157380_11406943 3300014326 Bacteria 748
131 Ga0157377_10037852 3300014745 Bacteria 2660
132 Ga0157379_10252590 3300014968 Bacteria 1601
133 Ga0157376_10383993 3300014969 Bacteria 1354
134 Ga0157376_10601493 3300014969 Bacteria 1094
135 Ga0163161_10232548 3300017792 Bacteria 1431
136 Ga0206356_10154395 3300020070 Bacteria 760
137 Ga0206354_10634798 3300020081 Bacteria 2550
138 Ga0213874_10041558 3300021377 Bacteria 1377
139 Ga0213876_10053532 3300021384 Bacteria 2131
140 Ga0213876_10259598 3300021384 Bacteria 923
141 Ga0213875_10114965 3300021388 Bacteria 1257
142 Ga0213875_10183613 3300021388 Bacteria 983
143 Ga0224572_1000654 3300024225 Bacteria 4352
144 Ga0228598_1024767 3300024227 Bacteria 1180
145 Ga0207642_10278503 3300025899 Bacteria 961
146 Ga0207642_10332405 3300025899 Bacteria 891
147 Ga0207688_10001722 3300025901 Bacteria 11608
148 Ga0207699_10635547 3300025906 Bacteria 779
149 Ga0207699_10741179 3300025906 Bacteria 720
150 Ga0207645_10197018 3300025907 Bacteria 1324
151 Ga0207684_10914264 3300025910 Bacteria 737
152 Ga0207654_10514100 3300025911 Bacteria 847
153 Ga0207693_10044337 3300025915 Bacteria 3496
154 Ga0207693_10748636 3300025915 Bacteria 755
155 Ga0207693_10961475 3300025915 Bacteria 653
156 Ga0207663_10109210 3300025916 Bacteria 1874
157 Ga0207662_10378625 3300025918 Bacteria 956
158 Ga0207657_10449105 3300025919 Bacteria 1012
159 Ga0207649_10866312 3300025920 Bacteria 707
160 Ga0207652_10077957 3300025921 Bacteria 2892
161 Ga0207646_10461846 3300025922 Bacteria 1145
162 Ga0207687_10720390 3300025927 Bacteria 848
163 Ga0207700_10706003 3300025928 Bacteria 900
164 Ga0207664_10050735 3300025929 Bacteria 3273
165 Ga0207664_10115709 3300025929 Bacteria 2236
166 Ga0207664_10695862 3300025929 Bacteria 914
167 Ga0207664_10743825 3300025929 Bacteria 882
168 Ga0207644_10033041 3300025931 Bacteria 3613
169 Ga0207690_10578028 3300025932 Bacteria 915
170 Ga0207690_10628380 3300025932 Bacteria 878
171 Ga0207706_10017641 3300025933 Bacteria 6431
172 Ga0207709_10085781 3300025935 Bacteria 2042
173 Ga0207709_10297807 3300025935 Bacteria 1198
174 Ga0207704_10541802 3300025938 Bacteria 944
175 Ga0207665_10707370 3300025939 Bacteria 792
176 Ga0207711_10109660 3300025941 Bacteria 2453
177 Ga0207711_10265565 3300025941 Bacteria 1578
178 Ga0207661_10524669 3300025944 Bacteria 1083
179 Ga0207661_10530758 3300025944 Bacteria 1077
180 Ga0207679_10153235 3300025945 Bacteria 1879
181 Ga0207679_10228661 3300025945 Bacteria 1569
182 Ga0207658_10269488 3300025986 Bacteria 1455
183 Ga0207677_10287016 3300026023 Bacteria 1353
184 Ga0207703_10013920 3300026035 Bacteria 6271
185 Ga0207703_10189123 3300026035 Bacteria 1822
186 Ga0207639_10426698 3300026041 Bacteria 1200
187 Ga0207678_10021907 3300026067 Bacteria 5601
188 Ga0207678_10035443 3300026067 Bacteria 4344
189 Ga0207678_10128147 3300026067 Bacteria 2164
190 Ga0207708_10001201 3300026075 Bacteria 19546
191 Ga0207708_10234879 3300026075 Bacteria 1473
192 Ga0207708_10403005 3300026075 Bacteria 1131
193 Ga0207702_10709773 3300026078 Bacteria 991
194 Ga0207702_10973249 3300026078 Bacteria 841
195 Ga0207641_10188960 3300026088 Bacteria 1892
196 Ga0207641_10834221 3300026088 Bacteria 913
197 Ga0207648_10943535 3300026089 Bacteria 807
198 Ga0207676_11036674 3300026095 Bacteria 809
199 Ga0207674_10157521 3300026116 Bacteria 2226
200 Ga0207674_10340208 3300026116 Bacteria 1451
201 Ga0207683_10222263 3300026121 Bacteria 1721
202 Ga0207428_10059802 3300027907 Bacteria 3020
203 Ga0207428_10209188 3300027907 Bacteria 1466
204 Ga0268264_10157211 3300028381 Bacteria 2044
205 Ga0307511_10171825 3300030521 Bacteria 1189
206 Ga0307509_10027935 3300031507 Bacteria 6275
207 Ga0307405_10194329 3300031731 Bacteria 1468
208 Ga0307406_10018495 3300031901 Bacteria 4073
209 Ga0307412_10229357 3300031911 Bacteria 1429
210 Ga0307409_100069459 3300031995 Bacteria 2791
211 Ga0307409_100446689 3300031995 Bacteria 1247
212 Ga0307416_100480352 3300032002 Bacteria 1302
213 Ga0307416_100713157 3300032002 Bacteria 1093
214 Ga0307411_10097353 3300032005 Bacteria 2071
215 Ga0307415_100002185 3300032126 Bacteria 9705
216 Ga0307415_100053328 3300032126 Bacteria 2754
217 Ga0373934_0130242 3300035086 Bacteria 1026
218 Ga0373934_0154856 3300035086 Bacteria 939
219 Ga0373923_0000048 3300035111 Bacteria 18516
220 Ga0373936_0000901 3300035113 Bacteria 10610
221 Ga0373945_0006027 3300035116 Bacteria 3897
222 Ga0373953_0013537 3300035117 Bacteria 2915
223 Ga0373954_0014571 3300035118 Bacteria 3506
224 Ga0373956_0030022 3300035119 Bacteria 2373
225 Ga0373957_0011360 3300035120 Bacteria 2971
226 Ga0373943_0007240 3300035170 Bacteria 4978
227 Ga0373946_0005126 3300035171 Bacteria 4721
228 Ga0373955_0063058 3300035172 Bacteria 2051
229 Ga0373924_0001068 3300035410 Bacteria 8742
230 Ga0373927_0008785 3300035695 Bacteria 6790
231 Ga0373933_0004211 3300035724 Bacteria 7934
232 Ga0373947_0006040 3300035725 Bacteria 7059
233 Ga0373937_0069686 3300036401 Bacteria 3242
234 Ga0373925_0013426 3300037068 Bacteria 5927
235 Ga0373925_0357471 3300037068 Bacteria 1187
236 Ga0395898_0002021 3300037466 Bacteria 25439
237 Ga0395898_0015135 3300037466 Bacteria 7917
238 Ga0395898_0042871 3300037466 Bacteria 4462
239 Ga0395898_0188682 3300037466 Bacteria 1970
240 Ga0395898_0300294 3300037466 Bacteria 1532
241 Ga0395905_0034179 3300037471 Bacteria 4773
242 Ga0395905_0499747 3300037471 Bacteria 1116
243 Ga0395905_0738323 3300037471 Bacteria 887
244 Ga0436364_0293828 3300037853 Bacteria 2742
245 Ga0436364_1110803 3300037853 Bacteria 4820
246 Ga0436364_1286272 3300037853 Bacteria 3794
247 Ga0395901_0047919 3300038443 Bacteria 4437
248 Ga0395901_0494999 3300038443 Bacteria 1245
249 Ga0395901_0556297 3300038443 Bacteria 1162
250 Ga0395901_0637820 3300038443 Bacteria 1070
251 Ga0436365_0535257 3300039437 Bacteria 1785
252 Ga0436363_0724458 3300039450 Bacteria 2169
253 Ga0436363_1159818 3300039450 Bacteria 1410
254 Ga0436363_1321140 3300039450 Bacteria 3194
255 Ga0451855_1726367 3300041511 Bacteria 875
256 Ga0439448_0072382 3300042005 Bacteria 1149
257 Ga0439455_0074639 3300042012 Bacteria 915
258 Ga0439463_070734 3300042016 Bacteria 894
259 Ga0439459_0011665 3300042438 Bacteria 1552
260 Ga0439460_0012620 3300042461 Bacteria 2197
261 Ga0439440_0021562 3300042993 Bacteria 1453
262 Ga0439440_0043373 3300042993 Bacteria 1103
263 Ga0466966_0142807 3300044684 Bacteria 1462
264 Ga0466963_0046483 3300044694 Bacteria 2862
265 Ga0466963_0141200 3300044694 Bacteria 1668
266 Ga0466964_0298134 3300044706 Bacteria 812
267 Ga0466971_0007836 3300044719 Bacteria 4653
268 Ga0466968_0032506 3300044735 Bacteria 2171
269 Ga0466970_0039548 3300044765 Bacteria 2503
270 Ga0466959_0008216 3300045049 Bacteria 7363
271 Ga0466959_0025679 3300045049 Bacteria 4368
272 Ga0466958_0008069 3300045836 Bacteria 5825
273 Ga0466967_0033916 3300045976 Bacteria 4326
274 Ga0466967_0041655 3300045976 Bacteria 3962
275 Ga0466967_1237092 3300045976 Bacteria 744
276 Ga0495592_0151189 3300046454 Bacteria 1605
277 Ga0495603_0008415 3300046455 Bacteria 6231
278 Ga0495603_0019587 3300046455 Bacteria 4096
279 Ga0495590_0069944 3300046457 Bacteria 1231
280 Ga0495629_0002642 3300046459 Bacteria 13731
281 Ga0495641_0001766 3300046461 Bacteria 17925
282 Ga0495651_0011146 3300046462 Bacteria 6911
283 Ga0495653_0017626 3300046463 Bacteria 5806
284 Ga0495580_0004133 3300046472 Bacteria 12234
285 Ga0495582_0002563 3300046473 Bacteria 10115
286 Ga0495639_0004158 3300046475 Bacteria 6206
287 Ga0495662_0000501 3300046476 Bacteria 17824
288 Ga0495662_0009474 3300046476 Bacteria 4777
289 Ga0495664_0001981 3300046477 Bacteria 10918
290 Ga0495584_0088862 3300046491 Bacteria 1558
291 Ga0495594_0009977 3300046499 Bacteria 4918
292 Ga0495608_0008813 3300046511 Bacteria 7058
293 Ga0495618_0035695 3300046514 Bacteria 3121
294 Ga0495628_0024460 3300046516 Bacteria 4943
295 Ga0495628_0814270 3300046516 Bacteria 653
296 Ga0495630_0017210 3300046517 Bacteria 5292
297 Ga0495630_0129622 3300046517 Bacteria 1915
298 Ga0495666_0015877 3300046526 Bacteria 3750
299 Ga0495652_0001944 3300046529 Bacteria 21961
300 Ga0495665_0001488 3300046531 Bacteria 12548
301 Ga0495665_0154599 3300046531 Bacteria 1197
302 Ga0495640_0005366 3300046533 Bacteria 10194
303 Ga0495586_0002084 3300046535 Bacteria 10863
304 Ga0495587_0007365 3300046536 Bacteria 7133
305 Ga0495587_0039893 3300046536 Bacteria 2808
306 Ga0495609_0054704 3300046538 Bacteria 1772
307 Ga0495645_0004343 3300046543 Bacteria 9684
308 Ga0495667_0028215 3300046559 Bacteria 3778
309 Ga0495667_0045783 3300046559 Bacteria 2895
310 Ga0495634_0005634 3300046642 Bacteria 9590
311 Ga0495634_0109108 3300046642 Bacteria 1781
312 Ga0495634_0177570 3300046642 Bacteria 1335
313 Ga0495634_0181847 3300046642 Bacteria 1316
314 Ga0495635_0550470 3300046663 Bacteria 756
315 Ga0495588_0018763 3300046674 Bacteria 3378
316 Ga0495657_0004605 3300046675 Bacteria 11009
317 Ga0495657_0014565 3300046675 Bacteria 5769
318 Ga0495657_0019436 3300046675 Bacteria 4900
319 Ga0495599_0097348 3300046678 Bacteria 1834
320 Ga0495623_0044674 3300046679 Bacteria 2815
321 Ga0495623_0148534 3300046679 Bacteria 1387
322 Ga0495646_0023349 3300046680 Bacteria 3894
323 Ga0495646_0048180 3300046680 Bacteria 2590
324 Ga0495646_0126364 3300046680 Bacteria 1443
325 Ga0495658_0002007 3300046683 Bacteria 10368
326 Ga0495613_0000972 3300046689 Bacteria 21864
327 Ga0495613_0077647 3300046689 Bacteria 2416
328 Ga0495613_0094382 3300046689 Bacteria 2165
329 Ga0495613_0308386 3300046689 Bacteria 1094
330 Ga0495624_0006379 3300046690 Bacteria 8370
331 Ga0495589_0333578 3300046794 Bacteria 700
332 Ga0495600_0007218 3300046809 Bacteria 6783
333 Ga0495600_0035952 3300046809 Bacteria 3219
334 Ga0495581_0003136 3300047315 Bacteria 9456
335 Ga0495604_0004830 3300047317 Bacteria 10683
336 Ga0495674_0576940 3300047319 Bacteria 893
337 Ga0495676_0027391 3300047321 Bacteria 4887
338 Ga0495676_0209433 3300047321 Bacteria 1349
339 Ga0495676_0400229 3300047321 Bacteria 911
340 Ga0495680_0035387 3300047322 Bacteria 4022
341 Ga0495680_0313586 3300047322 Bacteria 1099
342 Ga0495675_0007557 3300047444 Bacteria 6699
343 Ga0495675_0159776 3300047444 Bacteria 1388
344 Ga0495684_0005310 3300047471 Bacteria 10032
345 Ga0495684_0181758 3300047471 Bacteria 1558
346 Ga0495684_0352832 3300047471 Bacteria 1044
347 Ga0495593_0000200 3300047673 Bacteria 31534
348 Ga0495602_0057413 3300048088 Bacteria 3414
349 Ga0495614_0029764 3300048089 Bacteria 2349
350 Ga0496100_0043132 3300048903 Bacteria 2884
351 Ga0496100_0138259 3300048903 Bacteria 1723
352 Ga0496100_0221686 3300048903 Bacteria 1388
353 Ga0496101_0010305 3300048904 Bacteria 6172
354 Ga0496101_0024365 3300048904 Bacteria 4188
355 Ga0496101_0037398 3300048904 Bacteria 3443
356 Ga0496102_0019654 3300048905 Bacteria 5952
357 Ga0496102_0293046 3300048905 Bacteria 1534
358 Ga0496103_0044056 3300048906 Bacteria 2749
359 Ga0496104_0109800 3300048907 Bacteria 2643
360 Ga0496104_0350509 3300048907 Bacteria 1389
361 Ga0496104_0876986 3300048907 Bacteria 802
362 Ga0496105_0028249 3300048908 Bacteria 4588
363 Ga0496105_0057505 3300048908 Bacteria 3211
364 Ga0496105_0364996 3300048908 Bacteria 1151
365 Ga0496105_0417256 3300048908 Bacteria 1063
366 Ga0496106_0086758 3300048909 Bacteria 2411
367 Ga0496106_0213609 3300048909 Bacteria 1537
368 Ga0496107_0052108 3300048910 Bacteria 2952
369 Ga0496107_0085796 3300048910 Bacteria 2297
370 Ga0496108_0022988 3300048911 Bacteria 5129
371 Ga0496108_0032491 3300048911 Bacteria 4335
372 Ga0496108_0065216 3300048911 Bacteria 3069
373 Ga0496108_0826304 3300048911 Bacteria 798
374 Ga0496109_0042792 3300048912 Bacteria 4105
375 Ga0496109_0079481 3300048912 Bacteria 3021
376 Ga0496109_0134734 3300048912 Bacteria 2307
377 Ga0496110_0005203 3300048913 Bacteria 10180
378 Ga0496110_0005824 3300048913 Bacteria 9684
379 Ga0496110_0012868 3300048913 Bacteria 6895
380 Ga0496110_0628529 3300048913 Bacteria 973
381 Ga0496110_0711362 3300048913 Bacteria 906
382 Ga0496111_0003919 3300048914 Bacteria 9326
383 Ga0496111_0076142 3300048914 Bacteria 2445
384 Ga0496111_0210492 3300048914 Bacteria 1444
385 Ga0496112_0501357 3300048915 Bacteria 1149
386 Ga0496113_0096793 3300048916 Bacteria 2282
387 Ga0496113_0249940 3300048916 Bacteria 1415
388 Ga0496114_0068582 3300048917 Bacteria 2977
389 Ga0496114_0434597 3300048917 Bacteria 1163
390 Ga0496115_0030409 3300048918 Bacteria 4248
391 Ga0496115_0441669 3300048918 Bacteria 1052
392 Ga0496126_0095698 3300048929 Bacteria 2604
393 nmdc:mga00v17_123909_c1 3300050491 Bacteria 1648
394 nmdc:mga0yw44_4757_c1 3300050492 Bacteria 6291
395 nmdc:mga05p37_278581_c1 3300050507 Bacteria 1995
396 nmdc:mga05p37_330665_c1 3300050507 Bacteria 1800
397 nmdc:mga05p37_402266_c1 3300050507 Bacteria 1599
398 nmdc:mga09592_10526_c1 3300050508 Bacteria 7526
399 nmdc:mga0qj67_262387_c1 3300050509 Bacteria 1401
400 nmdc:mga0qj67_498734_c1 3300050509 Bacteria 979
401 nmdc:mga06r32_45331_c1 3300050510 Bacteria 4191
402 nmdc:mga06r32_70124_c1 3300050510 Bacteria 3389
403 nmdc:mga06r32_771643_c1 3300050510 Bacteria 923
404 nmdc:mga06r32_94247_c1 3300050510 Bacteria 2930
405 nmdc:mga08y16_1225470_c1 3300050511 Bacteria 720
406 nmdc:mga08y16_245138_c1 3300050511 Bacteria 1852
407 nmdc:mga0n895_34478_c1 3300050512 Bacteria 4873
408 nmdc:mga0n895_833704_c1 3300050512 Unclassified 911
409 nmdc:mga0rr50_129074_c1 3300050513 Bacteria 2022
410 nmdc:mga08x19_50010_c1 3300050514 Bacteria 2681
411 nmdc:mga0a205_44231_c1 3300050515 Bacteria 4292
412 Ga0495601_0000906 3300053077 Bacteria 16153
413 Ga0495601_0101397 3300053077 Bacteria 1859
414 Ga0495601_0135977 3300053077 Bacteria 1602
415 Ga0495619_0002066 3300053085 Bacteria 13337
416 Ga0495619_0080523 3300053085 Bacteria 2192
417 Ga0500559_0010040 3300053136 Bacteria 4078
418 Ga0466962_0030784 3300061719 Bacteria 2569
419 Ga0495608_0090532
420 JGI25407J50210_10001005
421 Ga0070683_100001077
422 Ga0070683_100099263
423 Ga0070683_100104116
424 Ga0068869_100043042
425 Ga0070682_100057261
426 Ga0070682_100323634
427 Ga0068868_100013065
428 Ga0070687_100302062
429 Ga0070661_100408175
430 Ga0070671_100018034
431 Ga0070671_100321777
432 Ga0070659_100316672
433 Ga0070709_10539713
434 Ga0070714_100778223
435 Ga0070713_100059305
436 Ga0070713_100586845
437 Ga0070711_100041334
438 Ga0070711_100090592
439 Ga0070711_100099953
440 Ga0070700_100000915
441 Ga0070708_100767239
442 Ga0070678_100366381
443 Ga0070678_100644072
444 Ga0070662_100060943
445 Ga0068867_100636383
446 Ga0070685_10097899
447 Ga0070685_10383473
448 Ga0070706_100445907
449 Ga0070706_100662458
450 Ga0070707_100265512
451 Ga0070698_100177682
452 Ga0070698_100385932
453 Ga0070699_100026304
454 Ga0070699_100769686
455 Ga0070679_100095674
456 Ga0070684_100059358
457 Ga0070684_100061954
458 Ga0070672_100304843
459 Ga0070686_100321928
460 Ga0070695_100449497
461 Ga0070695_100710509
462 Ga0070665_100085476
463 Ga0070704_100060939
464 Ga0070704_100575505
465 Ga0070664_100024368
466 Ga0070664_101064588
467 Ga0068857_100208724
468 Ga0068857_100272556
469 Ga0068854_100020464
470 Ga0068856_100003467
471 Ga0070702_100001929
472 Ga0068852_100011419
473 Ga0068866_10287778
474 Ga0068866_10480562
475 Ga0068861_100615625
476 Ga0068858_100008305
477 Ga0068858_100096074
478 Ga0068858_100410764
479 Ga0081455_10012182
480 Ga0081455_10023738
481 Ga0081455_10033716
482 Ga0081455_10194705
483 Ga0081538_10000440
484 Ga0070717_10172863
485 Ga0070717_10257982
486 Ga0075365_10054064
487 Ga0075363_100038662
488 Ga0075364_10591086
489 Ga0075432_10139093
490 Ga0070712_100041908
491 Ga0070712_100045105
492 Ga0075362_10328133
493 Ga0075367_10107651
494 Ga0075367_10124248
495 Ga0075428_100115328
496 Ga0075428_100293795
497 Ga0075428_100738274
498 Ga0075430_100027003
499 Ga0075430_100353901
500 Ga0075431_100010102
501 Ga0075431_100251585
502 Ga0075433_10010341
503 Ga0075433_10041811
504 Ga0075434_100095760
505 Ga0075434_100381254
506 Ga0075434_101094840
507 Ga0075429_100018145
508 Ga0075429_100232642
509 Ga0075429_100380427
510 Ga0075429_100432793
511 Ga0068865_100424757
512 Ga0075436_100025261
513 Ga0075436_100693417
514 Ga0075435_100013335
515 Ga0111539_10064577
516 Ga0111539_10626725
517 Ga0111539_11667616
518 Ga0105245_10016761
519 Ga0105245_10024199
520 Ga0105245_10280030
521 Ga0105247_10410191
522 Ga0114129_11127003
523 Ga0105243_10058085
524 Ga0105243_10458664
525 Ga0105248_10120010
526 Ga0105248_10846640
527 Ga0105239_10017235
528 Ga0105239_10339786
529 Ga0105239_11138431
530 Ga0105246_10008341
531 Ga0105246_10047627
532 Ga0105246_10152212
533 Ga0157369_11458823
534 Ga0157374_10012972
535 Ga0157374_11360399
536 Ga0157378_10481679
537 Ga0163162_10147114
538 Ga0163162_10367794
539 Ga0163162_10540299
540 Ga0157372_10002922
541 Ga0157375_10569553
542 Ga0157375_11332180
543 Ga0163163_10046554
544 Ga0163163_10344979
545 Ga0163163_10467764
546 Ga0163163_10658547
547 Ga0157380_10447329
548 Ga0157380_11406943
549 Ga0157377_10037852
550 Ga0157379_10252590
551 Ga0157376_10383993
552 Ga0157376_10601493
553 Ga0163161_10232548
554 Ga0206356_10154395
555 Ga0206354_10634798
556 Ga0213874_10041558
557 Ga0213876_10053532
558 Ga0213876_10259598
559 Ga0213875_10114965
560 Ga0213875_10183613
561 Ga0224572_1000654
562 Ga0228598_1024767
563 Ga0207642_10278503
564 Ga0207642_10332405
565 Ga0207688_10001722
566 Ga0207699_10635547
567 Ga0207699_10741179
568 Ga0207645_10197018
569 Ga0207684_10914264
570 Ga0207654_10514100
571 Ga0207693_10044337
572 Ga0207693_10748636
573 Ga0207693_10961475
574 Ga0207663_10109210
575 Ga0207662_10378625
576 Ga0207657_10449105
577 Ga0207649_10866312
578 Ga0207652_10077957
579 Ga0207646_10461846
580 Ga0207687_10720390
581 Ga0207700_10706003
582 Ga0207664_10050735
583 Ga0207664_10115709
584 Ga0207664_10695862
585 Ga0207664_10743825
586 Ga0207644_10033041
587 Ga0207690_10578028
588 Ga0207690_10628380
589 Ga0207706_10017641
590 Ga0207709_10085781
591 Ga0207709_10297807
592 Ga0207704_10541802
593 Ga0207665_10707370
594 Ga0207711_10109660
595 Ga0207711_10265565
596 Ga0207661_10524669
597 Ga0207661_10530758
598 Ga0207679_10153235
599 Ga0207679_10228661
600 Ga0207658_10269488
601 Ga0207677_10287016
602 Ga0207703_10013920
603 Ga0207703_10189123
604 Ga0207639_10426698
605 Ga0207678_10021907
606 Ga0207678_10035443
607 Ga0207678_10128147
608 Ga0207708_10001201
609 Ga0207708_10234879
610 Ga0207708_10403005
611 Ga0207702_10709773
612 Ga0207702_10973249
613 Ga0207641_10188960
614 Ga0207641_10834221
615 Ga0207648_10943535
616 Ga0207676_11036674
617 Ga0207674_10157521
618 Ga0207674_10340208
619 Ga0207683_10222263
620 Ga0207428_10059802
621 Ga0207428_10209188
622 Ga0268264_10157211
623 Ga0307511_10171825
624 Ga0307509_10027935
625 Ga0307405_10194329
626 Ga0307406_10018495
627 Ga0307412_10229357
628 Ga0307409_100069459
629 Ga0307409_100446689
630 Ga0307416_100480352
631 Ga0307416_100713157
632 Ga0307411_10097353
633 Ga0307415_100002185
634 Ga0307415_100053328
635 Ga0373934_0130242
636 Ga0373934_0154856
637 Ga0373923_0000048
638 Ga0373936_0000901
639 Ga0373945_0006027
640 Ga0373953_0013537
641 Ga0373954_0014571
642 Ga0373956_0030022
643 Ga0373957_0011360
644 Ga0373943_0007240
645 Ga0373946_0005126
646 Ga0373955_0063058
647 Ga0373924_0001068
648 Ga0373927_0008785
649 Ga0373933_0004211
650 Ga0373947_0006040
651 Ga0373937_0069686
652 Ga0373925_0013426
653 Ga0373925_0357471
654 Ga0395898_0002021
655 Ga0395898_0015135
656 Ga0395898_0042871
657 Ga0395898_0188682
658 Ga0395898_0300294
659 Ga0395905_0034179
660 Ga0395905_0499747
661 Ga0395905_0738323
662 Ga0436364_0293828
663 Ga0436364_1110803
664 Ga0436364_1286272
665 Ga0395901_0047919
666 Ga0395901_0494999
667 Ga0395901_0556297
668 Ga0395901_0637820
669 Ga0436365_0535257
670 Ga0436363_0724458
671 Ga0436363_1159818
672 Ga0436363_1321140
673 Ga0451855_1726367
674 Ga0439448_0072382
675 Ga0439455_0074639
676 Ga0439463_070734
677 Ga0439459_0011665
678 Ga0439460_0012620
679 Ga0439440_0021562
680 Ga0439440_0043373
681 Ga0466966_0142807
682 Ga0466963_0046483
683 Ga0466963_0141200
684 Ga0466964_0298134
685 Ga0466971_0007836
686 Ga0466968_0032506
687 Ga0466970_0039548
688 Ga0466959_0008216
689 Ga0466959_0025679
690 Ga0466958_0008069
691 Ga0466967_0033916
692 Ga0466967_0041655
693 Ga0466967_1237092
694 Ga0495592_0151189
695 Ga0495603_0008415
696 Ga0495603_0019587
697 Ga0495590_0069944
698 Ga0495629_0002642
699 Ga0495641_0001766
700 Ga0495651_0011146
701 Ga0495653_0017626
702 Ga0495580_0004133
703 Ga0495582_0002563
704 Ga0495639_0004158
705 Ga0495662_0000501
706 Ga0495662_0009474
707 Ga0495664_0001981
708 Ga0495584_0088862
709 Ga0495594_0009977
710 Ga0495608_0008813
711 Ga0495618_0035695
712 Ga0495628_0024460
713 Ga0495628_0814270
714 Ga0495630_0017210
715 Ga0495630_0129622
716 Ga0495666_0015877
717 Ga0495652_0001944
718 Ga0495665_0001488
719 Ga0495665_0154599
720 Ga0495640_0005366
721 Ga0495586_0002084
722 Ga0495587_0007365
723 Ga0495587_0039893
724 Ga0495609_0054704
725 Ga0495645_0004343
726 Ga0495667_0028215
727 Ga0495667_0045783
728 Ga0495634_0005634
729 Ga0495634_0109108
730 Ga0495634_0177570
731 Ga0495634_0181847
732 Ga0495635_0550470
733 Ga0495588_0018763
734 Ga0495657_0004605
735 Ga0495657_0014565
736 Ga0495657_0019436
737 Ga0495599_0097348
738 Ga0495623_0044674
739 Ga0495623_0148534
740 Ga0495646_0023349
741 Ga0495646_0048180
742 Ga0495646_0126364
743 Ga0495658_0002007
744 Ga0495613_0000972
745 Ga0495613_0077647
746 Ga0495613_0094382
747 Ga0495613_0308386
748 Ga0495624_0006379
749 Ga0495589_0333578
750 Ga0495600_0007218
751 Ga0495600_0035952
752 Ga0495581_0003136
753 Ga0495604_0004830
754 Ga0495674_0576940
755 Ga0495676_0027391
756 Ga0495676_0209433
757 Ga0495676_0400229
758 Ga0495680_0035387
759 Ga0495680_0313586
760 Ga0495675_0007557
761 Ga0495675_0159776
762 Ga0495684_0005310
763 Ga0495684_0181758
764 Ga0495684_0352832
765 Ga0495593_0000200
766 Ga0495602_0057413
767 Ga0495614_0029764
768 Ga0496100_0043132
769 Ga0496100_0138259
770 Ga0496100_0221686
771 Ga0496101_0010305
772 Ga0496101_0024365
773 Ga0496101_0037398
774 Ga0496102_0019654
775 Ga0496102_0293046
776 Ga0496103_0044056
777 Ga0496104_0109800
778 Ga0496104_0350509
779 Ga0496104_0876986
780 Ga0496105_0028249
781 Ga0496105_0057505
782 Ga0496105_0364996
783 Ga0496105_0417256
784 Ga0496106_0086758
785 Ga0496106_0213609
786 Ga0496107_0052108
787 Ga0496107_0085796
788 Ga0496108_0022988
789 Ga0496108_0032491
790 Ga0496108_0065216
791 Ga0496108_0826304
792 Ga0496109_0042792
793 Ga0496109_0079481
794 Ga0496109_0134734
795 Ga0496110_0005203
796 Ga0496110_0005824
797 Ga0496110_0012868
798 Ga0496110_0628529
799 Ga0496110_0711362
800 Ga0496111_0003919
801 Ga0496111_0076142
802 Ga0496111_0210492
803 Ga0496112_0501357
804 Ga0496113_0096793
805 Ga0496113_0249940
806 Ga0496114_0068582
807 Ga0496114_0434597
808 Ga0496115_0030409
809 Ga0496115_0441669
810 Ga0496126_0095698
811 nmdc:mga00v17_123909_c1
812 nmdc:mga0yw44_4757_c1
813 nmdc:mga05p37_278581_c1
814 nmdc:mga05p37_330665_c1
815 nmdc:mga05p37_402266_c1
816 nmdc:mga09592_10526_c1
817 nmdc:mga0qj67_262387_c1
818 nmdc:mga0qj67_498734_c1
819 nmdc:mga06r32_45331_c1
820 nmdc:mga06r32_70124_c1
821 nmdc:mga06r32_771643_c1
822 nmdc:mga06r32_94247_c1
823 nmdc:mga08y16_1225470_c1
824 nmdc:mga08y16_245138_c1
825 nmdc:mga0n895_34478_c1
826 nmdc:mga0n895_833704_c1
827 nmdc:mga0rr50_129074_c1
828 nmdc:mga08x19_50010_c1
829 nmdc:mga0a205_44231_c1
830 Ga0495601_0000906
831 Ga0495601_0101397
832 Ga0495601_0135977
833 Ga0495619_0002066
834 Ga0495619_0080523
835 Ga0500559_0010040
836 Ga0466962_0030784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

54

229

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8036 1 189
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7985 2 192
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7918 1 189
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7909 1 189
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7878 2 191
ID Description Score Start End Superfamily
af_Q23122_583_750_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8222 171 192 3.30.980.10
af_Q4DZ91_511_627_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8109 168 190 3.30.70.240
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7962 1 189 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7933 1 189 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7866 2 194 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9569 55 191 GO:0008703
GO:0009231
AF-H8IKP3-F1-model_v4 Deaminase-reductase domain protein 0.9559 1 194 GO:0008703
GO:0009231
AF-E3JD59-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9548 1 192 GO:0008703
GO:0009231
AF-H8IKP3-F1-model_v4 Deaminase-reductase domain protein 0.9511 1 194 GO:0008703
GO:0009231
AF-A0A179V6W6-F1-model_v4 Deaminase 0.95 1 189 GO:0008703
GO:0009231

Map