F439440

General Info

Members Datasets Scaffolds Average Seq Length
419 392 838 305

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1000014|JGI25159J45721_100001475
Length 316
Sequence MTAQTLYPAERGNLRLSFEYFPPKTDEMEVQLFQTAGDLSIFGPAFVTVTYGAGGSTKARSLTTVRRMVEEKGFTNTAAHLTCVGAPKAEVDAVIDEYIDYGVRHFVALRGDPQGGIGSAYQPHPDGYASSTDLVRAIRARGDDIEISVSSYPEKHPESPDVAADIDMLKRKVDAGANRALTQFFFDNNDFERYLERVRRAGINIPIVPGILPINNLAQVQKFAGLCGASVPEAIVTRLVHLEDRPAERFKEATHIAAEQIVDLARRGVRDFHLYTMNRSPLVTAVLDLVGFEQVALEANNALDEAPRTRAAGAAA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
34 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
35 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
36 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
37 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
38 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
39 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
40 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
44 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
58 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
59 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
69 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
72 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
79 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
80 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
107 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
110 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
111 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
112 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
113 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
116 2509276019 Ensifer aridi TW10 Isolate Nodule
117 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
118 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
119 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
120 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
121 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
122 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
123 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
124 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
125 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
126 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
127 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
128 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
129 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
130 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
131 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
132 2516143018 Ensifer sp. BR816 Isolate Nodule
133 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
134 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
135 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
136 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
137 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
138 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
139 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
140 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
141 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
142 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
143 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
144 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
145 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
146 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
147 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
148 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
149 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
150 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
151 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
152 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
153 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
154 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
155 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
156 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
157 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
158 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
159 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
160 2643221557 Ensifer sp. Root558 Isolate Unclassified
161 2643221607 Rhizobium sp. Root73 Isolate Unclassified
162 2643221610 Ensifer sp. Root74 Isolate Unclassified
163 2643221618 Ensifer sp. Root231 Isolate Unclassified
164 2643221626 Ensifer sp. Root31 Isolate Unclassified
165 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
166 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
167 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
168 2643221655 Ensifer sp. Root1252 Isolate Unclassified
169 2643221659 Ensifer sp. Root127 Isolate Unclassified
170 2643221668 Ensifer sp. Root423 Isolate Unclassified
171 2643221675 Ensifer sp. Root1298 Isolate Unclassified
172 2643221680 Ensifer sp. Root1312 Isolate Unclassified
173 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
174 2643221688 Rhizobium sp. Root482 Isolate Unclassified
175 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
176 2643221698 Ensifer sp. Root142 Isolate Unclassified
177 2643221712 Ensifer sp. Root258 Isolate Unclassified
178 2643221718 Rhizobium sp. Root268 Isolate Unclassified
179 2643221723 Ensifer sp. Root278 Isolate Unclassified
180 2643221726 Ensifer sp. Root954 Isolate Unclassified
181 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
182 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
183 2718217882 Rhizobium sp. N741 Isolate Nodule
184 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
185 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
186 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
187 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
188 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
189 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
190 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
191 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
192 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
193 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
194 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
195 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
196 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
197 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
198 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
199 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
200 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
201 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
202 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
203 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
204 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
205 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
206 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
207 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
208 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
209 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
210 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
211 2844163670 Ensifer sp. 1H6 Isolate Unclassified
212 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
213 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
214 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
215 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
216 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
217 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
218 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
219 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
220 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
221 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
222 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
223 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
224 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
225 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
226 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
227 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
228 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
229 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
230 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
231 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
232 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
233 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
234 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
235 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
236 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
237 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
238 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
239 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
240 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
241 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
242 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
243 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
244 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
245 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
246 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
247 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
248 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
249 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
250 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
251 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
252 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
253 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
254 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
255 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
256 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
257 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
258 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
259 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
260 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
261 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
262 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
263 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
264 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
265 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
266 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
267 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
268 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
269 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
270 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
271 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
272 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
273 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
274 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
275 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
276 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
277 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
278 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
279 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
280 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
281 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
282 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
283 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
284 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
285 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
286 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
287 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
288 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
289 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
290 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
291 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
292 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
293 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
294 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
295 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
296 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
297 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
298 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
299 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
300 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
301 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
302 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
303 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
304 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
305 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
306 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
307 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
308 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
309 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
310 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
311 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
312 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
313 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
314 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
315 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
316 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
317 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
318 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
319 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
320 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
321 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
322 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
323 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
324 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
325 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
326 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
327 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
328 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
329 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
330 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
331 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
332 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
333 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
334 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
335 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
336 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
337 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
338 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
339 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
340 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
341 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
342 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
343 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
344 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
345 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
346 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
347 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
348 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
349 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
350 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
351 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
352 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
353 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
354 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
355 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
356 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
357 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
358 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
359 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
360 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
361 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
362 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
363 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
364 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
365 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
366 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
367 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
368 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
369 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
370 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
371 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
372 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
373 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
374 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
375 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
376 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
377 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
378 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
379 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
380 2996893221 Rhizobium sp. R635 Isolate Nodule
381 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
382 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
383 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
384 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
385 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
386 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
387 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
388 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
389 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
390 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
391 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
392 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 32.7
Metatranscriptomes 0.48
Isolates 66.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.5
Nodule 55.85
Rhizoplane 0.48
Rhizosphere 14.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000014 3300002987 Bacteria 147809
2 RicEn_C10235 2010549000 Bacteria 1214
3 JGI24740J21852_10000504 3300001979 Bacteria 16777
4 JGI25155J39150_1000001 3300002704 Bacteria 354543
5 JGI25156J39149_1000001 3300002705 Bacteria 354557
6 JGI25162J39368_1000366 3300002737 Bacteria 38535
7 JGI25162J39368_1000368 3300002737 Bacteria 38495
8 JGI25154J39366_1000122 3300002738 Bacteria 61892
9 JGI25158J39367_1000325 3300002739 Bacteria 10567
10 JGI25157J39369_1000044 3300002741 Bacteria 122466
11 JGI25152J39213_1004106 3300002773 Bacteria 4708
12 JGI25150J39212_1009558 3300002774 Bacteria 1838
13 JGI25159J45721_1004042 3300002987 Bacteria 4989
14 JGI25151J46595_10003192 3300003187 Bacteria 9187
15 JGI25165J46597_1000516 3300003214 Bacteria 36635
16 JGI25165J46597_1002113 3300003214 Bacteria 7222
17 rootH2_10049022 3300003320 Bacteria 4811
18 rootL2_10010590 3300003322 Bacteria 17548
19 rootL2_10339331 3300003322 Bacteria 1961
20 rootH1_10166190 3300003323 Bacteria 3805
21 JGI25160J50197_1000001 3300003354 Bacteria 782301
22 JGI25160J50197_1000020 3300003354 Bacteria 232739
23 JGI25161J50226_1000843 3300003374 Bacteria 11421
24 Ga0055526_1003164 3300003771 Bacteria 10669
25 Ga0055526_1005167 3300003771 Bacteria 7592
26 Ga0055524_1002147 3300003775 Bacteria 10378
27 Ga0055536_1003419 3300003781 Bacteria 8534
28 Ga0055528_1030757 3300003790 Bacteria 1414
29 Ga0055543_1000047 3300004625 Bacteria 111073
30 Ga0065165_1000013 3300005262 Bacteria 301887
31 Ga0070665_100232788 3300005548 Bacteria 1842
32 Ga0075364_10000023 3300006051 Bacteria 52112
33 Ga0075370_10107030 3300006353 Bacteria 1622
34 Ga0075428_100385688 3300006844 Bacteria 1502
35 Ga0079104_1004188 3300006946 Bacteria 6279
36 Ga0123341_1000007 3300009765 Bacteria 147072
37 Ga0157373_10315034 3300013100 Bacteria 1112
38 Ga0157370_10039669 3300013104 Bacteria 4550
39 Ga0171463_1003 3300013249 Bacteria 695693
40 Ga0183363_1158 3300015690 Bacteria 16472
41 Ga0214544_1003096 3300021320 Bacteria 34775
42 Ga0214542_1000012 3300021321 Bacteria 235800
43 Ga0214542_1022571 3300021321 Bacteria 4002
44 Ga0214543_1000024 3300021327 Bacteria 235745
45 Ga0214543_1000038 3300021327 Bacteria 182106
46 Ga0228711_1000008 3300022739 Bacteria 169893
47 Ga0228710_1000009 3300022740 Bacteria 169770
48 Ga0209435_100012 3300025206 Bacteria 401621
49 Ga0209436_106541 3300025208 Bacteria 2541
50 Ga0209437_100098 3300025233 Bacteria 229766
51 Ga0209646_1000026 3300025246 Bacteria 401621
52 Ga0209026_1000014 3300025250 Bacteria 401621
53 Ga0209148_1003967 3300025254 Bacteria 3802
54 Ga0209759_1000012 3300025256 Bacteria 401621
55 Ga0209233_1000095 3300025261 Bacteria 303783
56 Ga0209565_1019078 3300025263 Bacteria 1471
57 Ga0209455_1003089 3300025272 Bacteria 6076
58 Ga0209130_1000034 3300025284 Bacteria 302439
59 Ga0209676_1016115 3300025292 Bacteria 2717
60 Ga0209025_1000140 3300025294 Bacteria 184765
61 Ga0209564_1000013 3300025295 Bacteria 775755
62 Ga0209256_1000396 3300025299 Bacteria 69216
63 Ga0209256_1001575 3300025299 Bacteria 22398
64 Ga0207426_1000006 3300025302 Bacteria 1025969
65 Ga0209051_1009570 3300025303 Bacteria 4981
66 Ga0209281_1000106 3300027111 Bacteria 219666
67 Ga0209281_1000318 3300027111 Bacteria 85039
68 Ga0209282_1000024 3300027666 Bacteria 170348
69 Ga0209971_1008553 3300027682 Bacteria 2429
70 Ga0209974_10007691 3300027876 Bacteria 3707
71 Ga0307515_10003171 3300028794 Bacteria 34790
72 Ga0307515_10024662 3300028794 Bacteria 10461
73 Ga0307513_10070798 3300031456 Bacteria 3643
74 Ga0307408_100162566 3300031548 Bacteria 1775
75 Ga0307412_10130624 3300031911 Bacteria 1824
76 Ga0315914_1000012 3300031967 Bacteria 169896
77 Ga0307416_100189608 3300032002 Bacteria 1937
78 Ga0307414_10110176 3300032004 Bacteria 2093
79 Ga0315913_1000006 3300033430 Bacteria 169893
80 Ga0315915_1000010 3300033464 Bacteria 240214
81 Ga0395905_0009335 3300037471 Bacteria 9593
82 Ga0395905_0027015 3300037471 Bacteria 5412
83 Ga0400484_23959 3300038725 Bacteria 1210
84 Ga0400483_020048 3300039062 Bacteria 2604
85 Ga0400483_077901 3300039062 Bacteria 2412
86 Ga0400483_169415 3300039062 Bacteria 1643
87 Ga0400483_201631 3300039062 Bacteria 7005
88 Ga0439436_0005264 3300041404 Bacteria 3961
89 Ga0439439_0016413 3300041406 Bacteria 1813
90 Ga0439439_0059105 3300041406 Bacteria 1015
91 Ga0439465_0000968 3300041413 Bacteria 9139
92 Ga0439465_0022316 3300041413 Bacteria 1988
93 Ga0451849_0068144 3300041505 Bacteria 2237
94 Ga0439449_0024568 3300042007 Bacteria 2252
95 Ga0450906_003444 3300042145 Bacteria 3403
96 Ga0450907_009518 3300042146 Bacteria 1610
97 Ga0450918_002667 3300042531 Bacteria 3360
98 Ga0466963_0055077 3300044694 Bacteria 2644
99 Ga0466970_0001585 3300044765 Bacteria 10982
100 Ga0466958_0031738 3300045836 Bacteria 3140
101 Ga0495638_0079800 3300046460 Bacteria 1989
102 Ga0495583_0018024 3300046506 Bacteria 3731
103 Ga0495632_0029814 3300046519 Bacteria 2837
104 Ga0495625_0114175 3300046660 Bacteria 1844
105 Ga0495661_0091572 3300046665 Bacteria 1729
106 Ga0496117_0032165 3300048920 Bacteria 3990
107 Ga0496119_0010204 3300048922 Bacteria 7927
108 Ga0496120_0024044 3300048923 Bacteria 3806
109 Ga0496120_0088061 3300048923 Bacteria 1665
110 Ga0496121_0001116 3300048924 Bacteria 47237
111 Ga0496122_0000840 3300048925 Bacteria 58107
112 Ga0496122_0059272 3300048925 Bacteria 2826
113 Ga0496123_0000336 3300048926 Bacteria 89161
114 Ga0496123_0066534 3300048926 Bacteria 2282
115 Ga0496124_0003209 3300048927 Bacteria 20191
116 Ga0496124_0040780 3300048927 Bacteria 4013
117 Ga0496124_0077115 3300048927 Bacteria 2749
118 Ga0496124_0144773 3300048927 Bacteria 1871
119 Ga0496125_0000248 3300048928 Bacteria 110840
120 Ga0496125_0065892 3300048928 Bacteria 2866
121 Ga0496126_0000866 3300048929 Bacteria 53241
122 Ga0501032_0054453 3300049569 Bacteria 2692
123 Ga0501033_0000483 3300049570 Bacteria 37535
124 Ga0501033_0139981 3300049570 Bacteria 1749
125 Ga0501034_0104725 3300049571 Bacteria 2822
126 Ga0501036_0482583 3300049572 Bacteria 1032
127 Ga0501038_0099208 3300049574 Bacteria 2428
128 Ga0501039_0101795 3300049575 Bacteria 2242
129 Ga0501043_0076052 3300049579 Bacteria 2637
130 Ga0501035_0154476 3300049822 Bacteria 1989
131 Ga0500644_0066070 3300053088 Bacteria 1289
132 Ga0500651_0044368 3300053093 Bacteria 2800
133 Ga0500556_0032567 3300053104 Bacteria 1782
134 Ga0500608_031878 3300053122 Bacteria 2503
135 Ga0500618_006853 3300053125 Bacteria 3303
136 Ga0500622_0000627 3300053156 Bacteria 31781
137 Ga0500627_0211901 3300053158 Bacteria 866
138 Ga0587106_004282 3300059605 Bacteria 1560
139 Ga0587079_026932 3300059647 Bacteria 1078
140 2509108378 2508501122 Bacteria 6292184
141 2509376489 2509276019 Bacteria 6802256
142 2509445630 2509276033 Bacteria 7180565
143 2509447069 2509276033 Bacteria 7180565
144 2510306472 2510065057 Bacteria 6649661
145 2511135418 2510917022 Bacteria 6504556
146 2511502262 2511231052 Bacteria 6974333
147 2512533635 2512047086 Bacteria 6850303
148 2512970665 2512875026 Bacteria 6861065
149 2513584366 2513237086 Bacteria 7265287
150 2513604292 2513237089 Bacteria 6553624
151 2513618822 2513237091 Bacteria 6900273
152 2513884387 2513237140 Bacteria 7076289
153 2513905027 2513237143 Bacteria 6664116
154 2513988371 2513237156 Bacteria 6402557
155 2514001485 2513237159 Bacteria 6810126
156 2514006360 2513237160 Bacteria 6650282
157 2515609038 2515154107 Bacteria 6795637
158 2516204163 2516143018 Bacteria 6951533
159 2516893641 2516653046 Bacteria 6989037
160 2517570364 2517487022 Bacteria 7227575
161 2524448538 2524023207 Bacteria 6813453
162 2524459605 2524023209 Bacteria 6679728
163 2551674525 2551306084 Bacteria 8942552
164 2551677906 2551306084 Bacteria 8942552
165 2551687719 2551306085 Bacteria 7347181
166 2551691406 2551306086 Bacteria 6843938
167 2551698038 2551306087 Bacteria 7351905
168 2551715597 2551306089 Bacteria 7162724
169 2551715860 2551306090 Bacteria 7953713
170 2551744450 2551306093 Bacteria 7064773
171 2558864443 2558860100 Bacteria 8458965
172 2585166368 2582581283 Bacteria 6030556
173 2585231760 2582581299 Bacteria 6518058
174 2585267404 2582581306 Bacteria 6450535
175 2585271155 2582581307 Bacteria 6597605
176 2585331459 2582581316 Bacteria 7774528
177 2585386472 2582581865 Bacteria 6644329
178 2585393274 2582581866 Bacteria 6859583
179 2585558879 2585427531 Bacteria 6992870
180 2585898260 2585427608 Bacteria 6544331
181 2585904151 2585427609 Bacteria 6667127
182 2587980732 2585428125 Bacteria 6662905
183 2599331769 2599185156 Bacteria 5403036
184 2600195501 2599185352 Bacteria 7228948
185 2616554245 2615840698 Bacteria 7319877
186 2617383586 2617270742 Bacteria 6808054
187 2643803070 2643221557 Bacteria 7184309
188 2644050499 2643221607 Bacteria 6314006
189 2644063432 2643221610 Bacteria 7480339
190 2644107260 2643221618 Bacteria 7717186
191 2644150826 2643221626 Bacteria 8069654
192 2644193526 2643221634 Bacteria 6705461
193 2644205727 2643221636 Bacteria 6583769
194 2644209010 2643221637 Bacteria 5345260
195 2644308655 2643221655 Bacteria 7722067
196 2644335473 2643221659 Bacteria 7890716
197 2644374715 2643221668 Bacteria 7306521
198 2644414195 2643221675 Bacteria 7473456
199 2644447723 2643221680 Bacteria 7473610
200 2644483417 2643221686 Bacteria 6310811
201 2644492048 2643221688 Bacteria 5260751
202 2644499629 2643221689 Bacteria 6042950
203 2644539878 2643221698 Bacteria 7756764
204 2644614596 2643221712 Bacteria 7729434
205 2644652540 2643221718 Bacteria 5345506
206 2644676061 2643221723 Bacteria 7095460
207 2644690196 2643221726 Bacteria 7455827
208 2657681579 2657244999 Bacteria 5946535
209 2692315523 2690316117 Bacteria 6800650
210 2719181823 2718217882 Bacteria 6556348
211 2753462045 2751185821 Bacteria 6189929
212 2778175433 2775507266 Bacteria 7392367
213 2792585110 2791355082 Bacteria 5973319
214 2792620753 2791355091 Bacteria 6135441
215 2792626112 2791355092 Bacteria 6248105
216 2792639049 2791355094 Bacteria 7011481
217 2793280288 2791355253 Bacteria 5171699
218 2793314527 2791355259 Bacteria 7254731
219 2802720060 2802428858 Bacteria 6636079
220 2802727007 2802428859 Bacteria 6667919
221 2802731990 2802428860 Bacteria 6525526
222 2802739321 2802428861 Bacteria 6534206
223 2802745698 2802428862 Bacteria 6633353
224 2802752299 2802428863 Bacteria 6410669
225 2804752770 2802429268 Bacteria 6094027
226 2819609165 2818991448 Bacteria 6772224
227 2838029788 2838029111 Bacteria 6603031
228 2838076841 2838074704 Bacteria 6785777
229 2838661572 2838661181 Bacteria 7385261
230 2842301387 2842298080 Bacteria 6123127
231 2842357924 2842357229 Bacteria 6485165
232 2842476927 2842475841 Bacteria 6603183
233 2842484543 2842482326 Bacteria 7212537
234 2842503316 2842502639 Bacteria 6604161
235 2842511112 2842509118 Bacteria 6850950
236 2842521833 2842521101 Bacteria 6569494
237 2842924175 2842922631 Bacteria 5824079
238 2844164594 2844163670 Bacteria 7266046
239 2847419415 2847417321 Bacteria 6913799
240 2848994443 2848992105 Bacteria 6810864
241 2850081486 2850079185 Bacteria 6848280
242 2855826363 2855825444 Bacteria 6785811
243 2855841752 2855839649 Bacteria 7135830
244 2855872503 2855872281 Bacteria 6964271
245 2858802537 2858800743 Bacteria 6603254
246 2891051821 2891048133 Bacteria 4447501
247 2891373367 2891373044 Bacteria 5202277
248 2896389008 2896384573 Bacteria 7700774
249 2913299293 2913295892 Bacteria 6333755
250 2915981471 2915980308 Bacteria 6624279
251 2915991465 2915986958 Bacteria 6739310
252 2915998722 2915993759 Bacteria 7016183
253 2916003464 2916000859 Bacteria 6865702
254 2916009823 2916007675 Bacteria 6898660
255 2916019562 2916014648 Bacteria 6946486
256 2916024936 2916021584 Bacteria 6854472
257 2916037888 2916035215 Bacteria 6755766
258 2916045312 2916041962 Bacteria 6820487
259 2916049064 2916048683 Bacteria 6543552
260 2916055698 2916055098 Bacteria 6758838
261 2916064872 2916061851 Bacteria 6737736
262 2919409997 2919408235 Bacteria 6149349
263 2920761502 2920760137 Bacteria 7427611
264 2920825234 2920822456 Bacteria 6897201
265 2921209532 2921208531 Bacteria 6745326
266 2921240908 2921237296 Bacteria 6876710
267 2921246752 2921244191 Bacteria 6568419
268 2921252118 2921250672 Bacteria 6677771
269 2921263788 2921257292 Bacteria 6808382
270 2921266231 2921263974 Bacteria 6864552
271 2921287997 2921282425 Bacteria 6826397
272 2921290934 2921289301 Bacteria 7316391
273 2921299059 2921296804 Bacteria 7176999
274 2924146732 2924144063 Bacteria 6883928
275 2924157970 2924150972 Bacteria 7169444
276 2924159296 2924158325 Bacteria 7188855
277 2924169138 2924165586 Bacteria 7260590
278 2924174547 2924172951 Bacteria 6749356
279 2924182978 2924179722 Bacteria 6843264
280 2924192689 2924186466 Bacteria 6876637
281 2924195406 2924193448 Bacteria 6955718
282 2924203303 2924200457 Bacteria 6757188
283 2924210722 2924207177 Bacteria 6917007
284 2924216803 2924214083 Bacteria 7080103
285 2924223272 2924221636 Bacteria 7113495
286 2924230542 2924228884 Bacteria 6633132
287 2937000726 2936996657 Bacteria 6298727
288 2937004537 2937002841 Bacteria 6934057
289 2937011219 2937009748 Bacteria 6746052
290 2937019802 2937016420 Bacteria 6782579
291 2937024606 2937023124 Bacteria 6815156
292 2937030318 2937029754 Bacteria 6424026
293 2937042700 2937036028 Bacteria 6846469
294 2937047964 2937042894 Bacteria 6741576
295 2937056175 2937049772 Bacteria 6757901
296 2937063549 2937056579 Bacteria 7107896
297 2937067795 2937063883 Bacteria 7199456
298 2937074412 2937071275 Bacteria 6984483
299 2937080244 2937078374 Bacteria 6610289
300 2937086362 2937084907 Bacteria 6618516
301 2937097242 2937091812 Bacteria 6979387
302 2937111278 2937106411 Bacteria 6947143
303 2937116122 2937113482 Bacteria 6505872
304 2937122006 2937119839 Bacteria 6597547
305 2937128847 2937126314 Bacteria 6771275
306 2941502117 2941499720 Bacteria 7599444
307 2957376353 2957375807 Bacteria 6425588
308 2957384256 2957382221 Bacteria 6737050
309 2957390719 2957388812 Bacteria 6778072
310 2957395874 2957395598 Bacteria 6822399
311 2957404481 2957402308 Bacteria 6741770
312 2957421230 2957415311 Bacteria 6991633
313 2957429633 2957422303 Bacteria 7172205
314 2957431737 2957430029 Bacteria 7022557
315 2957439387 2957437181 Bacteria 6568994
316 2957446887 2957443900 Bacteria 6869977
317 2957453729 2957450854 Bacteria 6765715
318 2957461925 2957457609 Bacteria 6967680
319 2957467023 2957464669 Bacteria 6568877
320 2957479583 2957478035 Bacteria 6756658
321 2957490441 2957484790 Bacteria 6703082
322 2957494128 2957491536 Bacteria 6695180
323 2957503331 2957498199 Bacteria 7126688
324 2957510635 2957505466 Bacteria 7253085
325 2960584498 2960584000 Bacteria 6864594
326 2960592118 2960591022 Bacteria 6622873
327 2960599972 2960597568 Bacteria 6550735
328 2960610610 2960603979 Bacteria 6898737
329 2960612295 2960610863 Bacteria 6691244
330 2960620485 2960617483 Bacteria 6727748
331 2960624460 2960624210 Bacteria 6875384
332 2960632078 2960631154 Bacteria 6732508
333 2960656505 2960652885 Bacteria 7083688
334 2960665546 2960660292 Bacteria 7041660
335 2960669679 2960667422 Bacteria 6763020
336 2960675139 2960674078 Bacteria 6609048
337 2960681653 2960680706 Bacteria 6624464
338 2960692514 2960687367 Bacteria 6535474
339 2960694771 2960693952 Bacteria 6749742
340 2964614146 2964607997 Bacteria 7101408
341 2964617726 2964615318 Bacteria 6809089
342 2964623612 2964621998 Bacteria 6834995
343 2964632607 2964628898 Bacteria 7083044
344 2964640798 2964636051 Bacteria 7091832
345 2964645665 2964643177 Bacteria 6820887
346 2964651576 2964649959 Bacteria 6675118
347 2964660546 2964656573 Bacteria 7100150
348 2964666902 2964663802 Bacteria 7019362
349 2964671982 2964670856 Bacteria 6851364
350 2964682895 2964678106 Bacteria 6792020
351 2964688503 2964685014 Bacteria 6839111
352 2964692500 2964691889 Bacteria 6802758
353 2964701622 2964698721 Bacteria 6765331
354 2964711072 2964705432 Bacteria 7114648
355 2964720699 2964719344 Bacteria 7286602
356 2967678393 2967671571 Bacteria 7021409
357 2967684405 2967678726 Bacteria 7264382
358 2967692101 2967686174 Bacteria 6678622
359 2967694664 2967693043 Bacteria 6804451
360 2967708642 2967706974 Bacteria 7186053
361 2967714895 2967714385 Bacteria 7000047
362 2967728963 2967728569 Bacteria 6641507
363 2967737168 2967735183 Bacteria 6827012
364 2967742777 2967742019 Bacteria 6794534
365 2967751582 2967748971 Bacteria 6733771
366 2967757891 2967755722 Bacteria 6814706
367 2967767689 2967762386 Bacteria 6923502
368 2967772100 2967769361 Bacteria 6587838
369 2967779001 2967775926 Bacteria 6738189
370 2970021041 2970019648 Bacteria 7072033
371 2970028313 2970026789 Bacteria 6785236
372 2970040310 2970033650 Bacteria 7118744
373 2970042660 2970040964 Bacteria 6731123
374 2970050991 2970047711 Bacteria 7088379
375 2970056721 2970054988 Bacteria 6611507
376 2970067163 2970061556 Bacteria 7099761
377 2970071607 2970068827 Bacteria 7123112
378 2970078283 2970076120 Bacteria 6697332
379 2970085265 2970082768 Bacteria 6183754
380 2970092567 2970088815 Bacteria 6933825
381 2970097230 2970095765 Bacteria 6936963
382 2970107977 2970102677 Bacteria 6812532
383 2970110729 2970109326 Bacteria 6863976
384 2970117375 2970116247 Bacteria 6501857
385 2970125792 2970122695 Bacteria 6625855
386 2970131145 2970129317 Bacteria 6806560
387 2970136313 2970136068 Bacteria 7207982
388 2970146698 2970143518 Bacteria 6446480
389 2970151595 2970149975 Bacteria 6779706
390 2970159588 2970156795 Bacteria 7168044
391 2970166957 2970164137 Bacteria 6861252
392 2970174263 2970170962 Bacteria 6876229
393 2970180845 2970177841 Bacteria 6768001
394 2970189190 2970184632 Bacteria 7054431
395 2970193620 2970191845 Bacteria 7032787
396 2977528849 2977523885 Bacteria 6960446
397 2977534025 2977530762 Bacteria 6951399
398 2977539646 2977537788 Bacteria 6929320
399 2977546390 2977544691 Bacteria 6875412
400 2977558452 2977551784 Bacteria 7125765
401 2977563193 2977558990 Bacteria 6863948
402 2977567686 2977565890 Bacteria 6901543
403 2977575726 2977572785 Bacteria 6763888
404 2977581977 2977579622 Bacteria 6772100
405 2989349691 2989349275 Bacteria 6349068
406 2995393262 2995392953 Bacteria 4539380
407 2996894313 2996893221 Bacteria 5823108
408 3003934086 3003930520 Bacteria 5667563
409 643826329 643692032 Bacteria 6891900
410 648739230 648276728 Bacteria 6968865
411 8003994186 8003992118 Bacteria 7266902
412 8004001828 8003999396 Bacteria 7063185
413 8005303140 8005301065 Bacteria 6614431
414 8005682872 8005682033 Bacteria 6726518
415 8005692092 8005688590 Bacteria 6610080
416 8046771951 8046767195 Bacteria 7547379
417 8049295340 8049293176 Bacteria 6128433
418 8054558626 8054558443 Bacteria 5204801
419 8057575720 8057575449 Bacteria 7367519
420 JGI25159J45721_1000014
421 RicEn_C10235
422 JGI24740J21852_10000504
423 JGI25155J39150_1000001
424 JGI25156J39149_1000001
425 JGI25162J39368_1000366
426 JGI25162J39368_1000368
427 JGI25154J39366_1000122
428 JGI25158J39367_1000325
429 JGI25157J39369_1000044
430 JGI25152J39213_1004106
431 JGI25150J39212_1009558
432 JGI25159J45721_1004042
433 JGI25151J46595_10003192
434 JGI25165J46597_1000516
435 JGI25165J46597_1002113
436 rootH2_10049022
437 rootL2_10010590
438 rootL2_10339331
439 rootH1_10166190
440 JGI25160J50197_1000001
441 JGI25160J50197_1000020
442 JGI25161J50226_1000843
443 Ga0055526_1003164
444 Ga0055526_1005167
445 Ga0055524_1002147
446 Ga0055536_1003419
447 Ga0055528_1030757
448 Ga0055543_1000047
449 Ga0065165_1000013
450 Ga0070665_100232788
451 Ga0075364_10000023
452 Ga0075370_10107030
453 Ga0075428_100385688
454 Ga0079104_1004188
455 Ga0123341_1000007
456 Ga0157373_10315034
457 Ga0157370_10039669
458 Ga0171463_1003
459 Ga0183363_1158
460 Ga0214544_1003096
461 Ga0214542_1000012
462 Ga0214542_1022571
463 Ga0214543_1000024
464 Ga0214543_1000038
465 Ga0228711_1000008
466 Ga0228710_1000009
467 Ga0209435_100012
468 Ga0209436_106541
469 Ga0209437_100098
470 Ga0209646_1000026
471 Ga0209026_1000014
472 Ga0209148_1003967
473 Ga0209759_1000012
474 Ga0209233_1000095
475 Ga0209565_1019078
476 Ga0209455_1003089
477 Ga0209130_1000034
478 Ga0209676_1016115
479 Ga0209025_1000140
480 Ga0209564_1000013
481 Ga0209256_1000396
482 Ga0209256_1001575
483 Ga0207426_1000006
484 Ga0209051_1009570
485 Ga0209281_1000106
486 Ga0209281_1000318
487 Ga0209282_1000024
488 Ga0209971_1008553
489 Ga0209974_10007691
490 Ga0307515_10003171
491 Ga0307515_10024662
492 Ga0307513_10070798
493 Ga0307408_100162566
494 Ga0307412_10130624
495 Ga0315914_1000012
496 Ga0307416_100189608
497 Ga0307414_10110176
498 Ga0315913_1000006
499 Ga0315915_1000010
500 Ga0395905_0009335
501 Ga0395905_0027015
502 Ga0400484_23959
503 Ga0400483_020048
504 Ga0400483_077901
505 Ga0400483_169415
506 Ga0400483_201631
507 Ga0439436_0005264
508 Ga0439439_0016413
509 Ga0439439_0059105
510 Ga0439465_0000968
511 Ga0439465_0022316
512 Ga0451849_0068144
513 Ga0439449_0024568
514 Ga0450906_003444
515 Ga0450907_009518
516 Ga0450918_002667
517 Ga0466963_0055077
518 Ga0466970_0001585
519 Ga0466958_0031738
520 Ga0495638_0079800
521 Ga0495583_0018024
522 Ga0495632_0029814
523 Ga0495625_0114175
524 Ga0495661_0091572
525 Ga0496117_0032165
526 Ga0496119_0010204
527 Ga0496120_0024044
528 Ga0496120_0088061
529 Ga0496121_0001116
530 Ga0496122_0000840
531 Ga0496122_0059272
532 Ga0496123_0000336
533 Ga0496123_0066534
534 Ga0496124_0003209
535 Ga0496124_0040780
536 Ga0496124_0077115
537 Ga0496124_0144773
538 Ga0496125_0000248
539 Ga0496125_0065892
540 Ga0496126_0000866
541 Ga0501032_0054453
542 Ga0501033_0000483
543 Ga0501033_0139981
544 Ga0501034_0104725
545 Ga0501036_0482583
546 Ga0501038_0099208
547 Ga0501039_0101795
548 Ga0501043_0076052
549 Ga0501035_0154476
550 Ga0500644_0066070
551 Ga0500651_0044368
552 Ga0500556_0032567
553 Ga0500608_031878
554 Ga0500618_006853
555 Ga0500622_0000627
556 Ga0500627_0211901
557 Ga0587106_004282
558 Ga0587079_026932
559 2509108378
560 2509376489
561 2509445630
562 2509447069
563 2510306472
564 2511135418
565 2511502262
566 2512533635
567 2512970665
568 2513584366
569 2513604292
570 2513618822
571 2513884387
572 2513905027
573 2513988371
574 2514001485
575 2514006360
576 2515609038
577 2516204163
578 2516893641
579 2517570364
580 2524448538
581 2524459605
582 2551674525
583 2551677906
584 2551687719
585 2551691406
586 2551698038
587 2551715597
588 2551715860
589 2551744450
590 2558864443
591 2585166368
592 2585231760
593 2585267404
594 2585271155
595 2585331459
596 2585386472
597 2585393274
598 2585558879
599 2585898260
600 2585904151
601 2587980732
602 2599331769
603 2600195501
604 2616554245
605 2617383586
606 2643803070
607 2644050499
608 2644063432
609 2644107260
610 2644150826
611 2644193526
612 2644205727
613 2644209010
614 2644308655
615 2644335473
616 2644374715
617 2644414195
618 2644447723
619 2644483417
620 2644492048
621 2644499629
622 2644539878
623 2644614596
624 2644652540
625 2644676061
626 2644690196
627 2657681579
628 2692315523
629 2719181823
630 2753462045
631 2778175433
632 2792585110
633 2792620753
634 2792626112
635 2792639049
636 2793280288
637 2793314527
638 2802720060
639 2802727007
640 2802731990
641 2802739321
642 2802745698
643 2802752299
644 2804752770
645 2819609165
646 2838029788
647 2838076841
648 2838661572
649 2842301387
650 2842357924
651 2842476927
652 2842484543
653 2842503316
654 2842511112
655 2842521833
656 2842924175
657 2844164594
658 2847419415
659 2848994443
660 2850081486
661 2855826363
662 2855841752
663 2855872503
664 2858802537
665 2891051821
666 2891373367
667 2896389008
668 2913299293
669 2915981471
670 2915991465
671 2915998722
672 2916003464
673 2916009823
674 2916019562
675 2916024936
676 2916037888
677 2916045312
678 2916049064
679 2916055698
680 2916064872
681 2919409997
682 2920761502
683 2920825234
684 2921209532
685 2921240908
686 2921246752
687 2921252118
688 2921263788
689 2921266231
690 2921287997
691 2921290934
692 2921299059
693 2924146732
694 2924157970
695 2924159296
696 2924169138
697 2924174547
698 2924182978
699 2924192689
700 2924195406
701 2924203303
702 2924210722
703 2924216803
704 2924223272
705 2924230542
706 2937000726
707 2937004537
708 2937011219
709 2937019802
710 2937024606
711 2937030318
712 2937042700
713 2937047964
714 2937056175
715 2937063549
716 2937067795
717 2937074412
718 2937080244
719 2937086362
720 2937097242
721 2937111278
722 2937116122
723 2937122006
724 2937128847
725 2941502117
726 2957376353
727 2957384256
728 2957390719
729 2957395874
730 2957404481
731 2957421230
732 2957429633
733 2957431737
734 2957439387
735 2957446887
736 2957453729
737 2957461925
738 2957467023
739 2957479583
740 2957490441
741 2957494128
742 2957503331
743 2957510635
744 2960584498
745 2960592118
746 2960599972
747 2960610610
748 2960612295
749 2960620485
750 2960624460
751 2960632078
752 2960656505
753 2960665546
754 2960669679
755 2960675139
756 2960681653
757 2960692514
758 2960694771
759 2964614146
760 2964617726
761 2964623612
762 2964632607
763 2964640798
764 2964645665
765 2964651576
766 2964660546
767 2964666902
768 2964671982
769 2964682895
770 2964688503
771 2964692500
772 2964701622
773 2964711072
774 2964720699
775 2967678393
776 2967684405
777 2967692101
778 2967694664
779 2967708642
780 2967714895
781 2967728963
782 2967737168
783 2967742777
784 2967751582
785 2967757891
786 2967767689
787 2967772100
788 2967779001
789 2970021041
790 2970028313
791 2970040310
792 2970042660
793 2970050991
794 2970056721
795 2970067163
796 2970071607
797 2970078283
798 2970085265
799 2970092567
800 2970097230
801 2970107977
802 2970110729
803 2970117375
804 2970125792
805 2970131145
806 2970136313
807 2970146698
808 2970151595
809 2970159588
810 2970166957
811 2970174263
812 2970180845
813 2970189190
814 2970193620
815 2977528849
816 2977534025
817 2977539646
818 2977546390
819 2977558452
820 2977563193
821 2977567686
822 2977575726
823 2977581977
824 2989349691
825 2995393262
826 2996894313
827 3003934086
828 643826329
829 648739230
830 8003994186
831 8004001828
832 8005303140
833 8005682872
834 8005692092
835 8046771951
836 8049295340
837 8054558626
838 8057575720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

5

291

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zpt-assembly1.cif.gz_A escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9644 12 291
2fmo-assembly1.cif.gz_B-1 ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.9629 14 291
1zp3-assembly2.cif.gz_A e. coli methylenetetrahydrofolate reductase (oxidized) 0.962 12 291
6pey-assembly2.cif.gz_B mthfr with mutation asp120ala 0.9614 14 291
1zpt-assembly1.cif.gz_B escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9598 12 291
ID Description Score Start End Superfamily
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9587 12 291 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9382 13 290 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9368 10 293 3.20.20.220
af_Q9WU20_42_335_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9289 14 288 3.20.20.220
af_A0A1D6GER4_1_215_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9222 85 288 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A7X6EMB3-F1-model_v4 deleted 0.9943 163 258
AF-A0A3R8NNS2-F1-model_v4 Methylenetetrahydrofolate reductase 0.9892 16 108 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A359BGI4-F1-model_v4 Methylenetetrahydrofolate reductase 0.9843 15 150 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A521T562-F1-model_v4 deleted 0.9821 11 138
AF-Q0BVP8-F1-model_v4 Methylenetetrahydrofolate reductase (EC 1.5.1.54) 0.9772 14 296 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312

Map