F439467

General Info

Members Datasets Scaffolds Average Seq Length
419 248 838 302

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000021|Ga0070703_1000002154
Length 345
Sequence MTTATPTQLGMVGLGRMGANIVRRLMRDGHPCVVHDLSSEAVAALASEGATGADTIEAFVAALNPPRAVWVMVPAGEPTEHAVGSLVGVLAPGDVVIDGGNTYYRDDLRRAKELAGRGIAYVDCGTSGGVFGLDRGFCLMVGCDDDAVWDRLEPIFRSLAPGVAAAPRTPGAPAEVTPQEQGYLRVGPVGAGHFVKMVHNGIEYALMEAYAEGINVLHHANIGGEAQAHDAETAPLGDPAFYRYDIDIAAVAELWRRGSVVASWLLDLAAAALHDSPTLDGFAGRVADSGEGRWTAIAAIEEGVPADILTAALSARFSSRGQAEMANRLLSAMRWRFGGHVEPPG

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
231 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
232 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2597490337 Halobacterium salinarum DSM 3754 Isolate Nodule
238 2643221615 Nocardioides sp. Root224 Isolate Unclassified
239 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
240 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
241 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
242 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
243 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
244 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
245 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
246 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
247 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
248 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0.72
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 0.24
Rhizoplane 1.91
Rhizosphere 83.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10000021 3300005406 Bacteria 75160
2 Ga0055532_1003448 3300003758 Bacteria 2707
3 Ga0070658_10000976 3300005327 Bacteria 24552
4 Ga0070658_10001447 3300005327 Bacteria 20259
5 Ga0070658_10011720 3300005327 Bacteria 7034
6 Ga0070658_10031132 3300005327 Bacteria 4284
7 Ga0070658_10041206 3300005327 Bacteria 3725
8 Ga0070666_10039751 3300005335 Bacteria 3136
9 Ga0068868_100036222 3300005338 Bacteria 3818
10 Ga0070660_100043651 3300005339 Bacteria 3427
11 Ga0070659_100003355 3300005366 Bacteria 11392
12 Ga0070667_100001084 3300005367 Bacteria 24909
13 Ga0070667_100039929 3300005367 Bacteria 3934
14 Ga0070667_100224780 3300005367 Bacteria 1672
15 Ga0070714_100225695 3300005435 Bacteria 1724
16 Ga0070705_100008931 3300005440 Bacteria 4969
17 Ga0070694_100023703 3300005444 Bacteria 3951
18 Ga0070708_100008641 3300005445 Bacteria 8184
19 Ga0070708_100013582 3300005445 Bacteria 6675
20 Ga0070678_100282144 3300005456 Bacteria 1405
21 Ga0070681_10354722 3300005458 Bacteria 1377
22 Ga0068867_100165766 3300005459 Bacteria 1746
23 Ga0070706_100020157 3300005467 Bacteria 6144
24 Ga0070706_100046016 3300005467 Bacteria 4028
25 Ga0070707_100006084 3300005468 Bacteria 11258
26 Ga0070707_100011223 3300005468 Bacteria 8350
27 Ga0070698_100002193 3300005471 Bacteria 21678
28 Ga0070698_100002660 3300005471 Bacteria 19709
29 Ga0070679_100033314 3300005530 Bacteria 5101
30 Ga0070697_100006988 3300005536 Bacteria 8777
31 Ga0068853_100121364 3300005539 Bacteria 2332
32 Ga0070672_100019574 3300005543 Bacteria 4916
33 Ga0070696_100037742 3300005546 Bacteria 3332
34 Ga0070665_100121578 3300005548 Bacteria 2612
35 Ga0070704_100048804 3300005549 Bacteria 2965
36 Ga0070704_100056427 3300005549 Bacteria 2789
37 Ga0070704_100090598 3300005549 Bacteria 2278
38 Ga0068855_100001284 3300005563 Bacteria 31118
39 Ga0068855_100023203 3300005563 Bacteria 7433
40 Ga0068855_100034444 3300005563 Bacteria 6039
41 Ga0068855_100165527 3300005563 Bacteria 2507
42 Ga0068855_100185417 3300005563 Bacteria 2350
43 Ga0068857_100005100 3300005577 Bacteria 11165
44 Ga0068857_100280414 3300005577 Bacteria 1533
45 Ga0068856_100080053 3300005614 Bacteria 3240
46 Ga0068856_100116842 3300005614 Bacteria 2668
47 Ga0068856_100174122 3300005614 Bacteria 2165
48 Ga0068852_100008302 3300005616 Bacteria 7644
49 Ga0068852_100033118 3300005616 Bacteria 4287
50 Ga0068852_100061564 3300005616 Bacteria 3262
51 Ga0068852_100137570 3300005616 Bacteria 2256
52 Ga0068852_100183987 3300005616 Bacteria 1966
53 Ga0068859_100000011 3300005617 Bacteria 309687
54 Ga0068859_100123444 3300005617 Bacteria 2657
55 Ga0068864_100024877 3300005618 Bacteria 5037
56 Ga0068866_10003701 3300005718 Bacteria 6265
57 Ga0068851_10000053 3300005834 Bacteria 71192
58 Ga0068858_100000176 3300005842 Bacteria 68056
59 Ga0068860_100322654 3300005843 Bacteria 1516
60 Ga0081540_1004978 3300005983 Bacteria 9989
61 Ga0081539_10075124 3300005985 Bacteria 1797
62 Ga0075365_10011262 3300006038 Bacteria 5254
63 Ga0075364_10071618 3300006051 Bacteria 2283
64 Ga0070712_100121745 3300006175 Bacteria 1964
65 Ga0075369_10043320 3300006186 Bacteria 1931
66 Ga0075428_100016232 3300006844 Bacteria 8231
67 Ga0075428_100073953 3300006844 Bacteria 3722
68 Ga0075428_100242583 3300006844 Bacteria 1944
69 Ga0075430_100007980 3300006846 Bacteria 8945
70 Ga0075431_100001322 3300006847 Bacteria 22654
71 Ga0075429_100016093 3300006880 Bacteria 6478
72 Ga0075429_100019489 3300006880 Bacteria 5877
73 Ga0097620_100000011 3300006931 Bacteria 309687
74 Ga0097620_100123446 3300006931 Bacteria 2657
75 Ga0105240_10005148 3300009093 Bacteria 19564
76 Ga0105240_10065741 3300009093 Bacteria 4500
77 Ga0105240_10119336 3300009093 Bacteria 3177
78 Ga0111539_10000398 3300009094 Bacteria 54069
79 Ga0105245_10007692 3300009098 Bacteria 9438
80 Ga0105245_10025509 3300009098 Bacteria 5199
81 Ga0105245_10053498 3300009098 Bacteria 3624
82 Ga0105245_10063265 3300009098 Bacteria 3341
83 Ga0105247_10040923 3300009101 Bacteria 2834
84 Ga0105247_10116831 3300009101 Bacteria 1724
85 Ga0105247_10200242 3300009101 Bacteria 1341
86 Ga0114129_10075386 3300009147 Bacteria 4697
87 Ga0105243_10024345 3300009148 Bacteria 4617
88 Ga0105242_10004443 3300009176 Bacteria 10901
89 Ga0105242_10590166 3300009176 Bacteria 1071
90 Ga0105248_10000897 3300009177 Bacteria 33319
91 Ga0105248_10029387 3300009177 Bacteria 6131
92 Ga0105237_10004763 3300009545 Bacteria 15599
93 Ga0105237_10014141 3300009545 Bacteria 8353
94 Ga0105238_10000476 3300009551 Bacteria 42016
95 Ga0105246_10181612 3300011119 Bacteria 1620
96 Ga0157370_10137822 3300013104 Bacteria 2274
97 Ga0157370_10334575 3300013104 Bacteria 1396
98 Ga0157369_10137481 3300013105 Bacteria 2586
99 Ga0157369_10353660 3300013105 Bacteria 1526
100 Ga0157374_10030410 3300013296 Bacteria 4903
101 Ga0157374_10034123 3300013296 Bacteria 4646
102 Ga0157378_10006652 3300013297 Bacteria 10101
103 Ga0163162_10055545 3300013306 Bacteria 3987
104 Ga0157372_10487668 3300013307 Bacteria 1437
105 Ga0157375_10057903 3300013308 Bacteria 3832
106 Ga0163163_10031929 3300014325 Bacteria 5085
107 Ga0157379_10068421 3300014968 Bacteria 3175
108 Ga0157379_10311444 3300014968 Bacteria 1436
109 Ga0157376_10406334 3300014969 Bacteria 1318
110 Ga0206350_10494122 3300020080 Bacteria 1991
111 Ga0206353_11519911 3300020082 Bacteria 2496
112 Ga0213876_10007682 3300021384 Bacteria 5853
113 Ga0213875_10002389 3300021388 Bacteria 11298
114 Ga0224712_10042794 3300022467 Bacteria 1718
115 Ga0209677_100271 3300025253 Bacteria 34642
116 Ga0209148_1001014 3300025254 Bacteria 17716
117 Ga0209233_1003736 3300025261 Bacteria 5319
118 Ga0209455_1004265 3300025272 Bacteria 4750
119 Ga0207656_10000001 3300025321 Bacteria 1323684
120 Ga0207653_10000004 3300025885 Bacteria 263142
121 Ga0207642_10001660 3300025899 Bacteria 6867
122 Ga0207680_10206464 3300025903 Bacteria 1341
123 Ga0207705_10001738 3300025909 Bacteria 17257
124 Ga0207705_10009264 3300025909 Bacteria 7161
125 Ga0207684_10019133 3300025910 Bacteria 5857
126 Ga0207684_10163511 3300025910 Bacteria 1917
127 Ga0207654_10000001 3300025911 Bacteria 1816198
128 Ga0207695_10001399 3300025913 Bacteria 40720
129 Ga0207695_10002309 3300025913 Bacteria 28441
130 Ga0207695_10002481 3300025913 Bacteria 27163
131 Ga0207671_10000001 3300025914 Bacteria 1318881
132 Ga0207671_10003504 3300025914 Bacteria 15592
133 Ga0207693_10132058 3300025915 Bacteria 1963
134 Ga0207657_10007809 3300025919 Bacteria 10918
135 Ga0207657_10179181 3300025919 Bacteria 1714
136 Ga0207652_10009995 3300025921 Bacteria 7640
137 Ga0207646_10004377 3300025922 Bacteria 15372
138 Ga0207646_10046370 3300025922 Bacteria 3899
139 Ga0207646_10287780 3300025922 Bacteria 1485
140 Ga0207681_10251452 3300025923 Bacteria 1380
141 Ga0207694_10000019 3300025924 Bacteria 312382
142 Ga0207694_10061954 3300025924 Bacteria 2912
143 Ga0207687_10030424 3300025927 Bacteria 3640
144 Ga0207687_10052616 3300025927 Bacteria 2842
145 Ga0207687_10200003 3300025927 Bacteria 1561
146 Ga0207690_10002616 3300025932 Bacteria 10843
147 Ga0207686_10024326 3300025934 Bacteria 3508
148 Ga0207691_10023123 3300025940 Bacteria 5853
149 Ga0207711_10000405 3300025941 Bacteria 45662
150 Ga0207711_10016898 3300025941 Bacteria 6061
151 Ga0207711_10111833 3300025941 Bacteria 2430
152 Ga0207689_10156920 3300025942 Bacteria 1876
153 Ga0207679_10310278 3300025945 Bacteria 1363
154 Ga0207667_10000498 3300025949 Bacteria 51911
155 Ga0207667_10011472 3300025949 Bacteria 10295
156 Ga0207667_10034594 3300025949 Bacteria 5424
157 Ga0207667_10080812 3300025949 Bacteria 3368
158 Ga0207658_10000468 3300025986 Bacteria 37711
159 Ga0207677_10020549 3300026023 Bacteria 4011
160 Ga0207677_10080037 3300026023 Bacteria 2339
161 Ga0207703_10000121 3300026035 Bacteria 94523
162 Ga0207703_10171526 3300026035 Bacteria 1908
163 Ga0207639_10025918 3300026041 Bacteria 4255
164 Ga0207678_10176304 3300026067 Bacteria 1825
165 Ga0207702_10044197 3300026078 Bacteria 3744
166 Ga0207702_10140588 3300026078 Bacteria 2184
167 Ga0207702_10385596 3300026078 Bacteria 1348
168 Ga0207641_10022978 3300026088 Bacteria 5137
169 Ga0207641_10075488 3300026088 Bacteria 2911
170 Ga0207648_10171946 3300026089 Bacteria 1915
171 Ga0207676_10027237 3300026095 Bacteria 4256
172 Ga0207674_10016735 3300026116 Bacteria 8014
173 Ga0207674_10222053 3300026116 Bacteria 1838
174 Ga0207674_10390059 3300026116 Bacteria 1346
175 Ga0207674_10415914 3300026116 Bacteria 1299
176 Ga0207698_10008089 3300026142 Bacteria 6631
177 Ga0207698_10021347 3300026142 Bacteria 4476
178 Ga0207698_10023507 3300026142 Bacteria 4307
179 Ga0207698_10134921 3300026142 Bacteria 2116
180 Ga0209371_1020129 3300027312 Bacteria 1649
181 Ga0268266_10152056 3300028379 Bacteria 2087
182 Ga0268256_1010322 3300030500 Bacteria 3036
183 Ga0316182_1003868 3300030745 Bacteria 6985
184 Ga0265325_10003210 3300031241 Bacteria 10755
185 Ga0307408_100020202 3300031548 Bacteria 4492
186 Ga0307408_100076904 3300031548 Bacteria 2484
187 Ga0307514_10020516 3300031649 Bacteria 5391
188 Ga0265342_10000678 3300031712 Bacteria 35577
189 Ga0307405_10031487 3300031731 Bacteria 3123
190 Ga0307410_10014570 3300031852 Bacteria 4631
191 Ga0307406_10047366 3300031901 Bacteria 2709
192 Ga0307407_10006317 3300031903 Bacteria 5247
193 Ga0307407_10038539 3300031903 Bacteria 2650
194 Ga0307412_10018878 3300031911 Bacteria 4161
195 Ga0307409_100001515 3300031995 Bacteria 11498
196 Ga0307409_100016321 3300031995 Bacteria 4909
197 Ga0307416_100111768 3300032002 Bacteria 2410
198 Ga0307416_100143590 3300032002 Bacteria 2174
199 Ga0307416_100158505 3300032002 Bacteria 2088
200 Ga0307411_10213538 3300032005 Bacteria 1491
201 Ga0307415_100169315 3300032126 Bacteria 1702
202 Ga0307415_100257911 3300032126 Bacteria 1420
203 Ga0373930_0000293 3300034816 Bacteria 6420
204 Ga0373932_0000159 3300035112 Bacteria 19732
205 Ga0373931_0000003 3300035691 Bacteria 560286
206 Ga0373937_0003539 3300036401 Bacteria 13152
207 Ga0395899_0004601 3300037312 Bacteria 10752
208 Ga0395899_0007189 3300037312 Bacteria 8617
209 Ga0395899_0209230 3300037312 Bacteria 1356
210 Ga0395900_0005392 3300037418 Bacteria 13400
211 Ga0395900_0010729 3300037418 Bacteria 9371
212 Ga0395898_0038877 3300037466 Bacteria 4712
213 Ga0395898_0149489 3300037466 Bacteria 2235
214 Ga0395898_0214060 3300037466 Bacteria 1838
215 Ga0436364_1454558 3300037853 Bacteria 9705
216 Ga0395901_0019142 3300038443 Bacteria 6999
217 Ga0395901_0044677 3300038443 Bacteria 4595
218 Ga0395901_0321484 3300038443 Bacteria 1601
219 Ga0436365_0379914 3300039437 Bacteria 12297
220 Ga0436363_1107981 3300039450 Bacteria 1126
221 Ga0439465_0031616 3300041413 Bacteria 1687
222 Ga0451789_0054370 3300041443 Bacteria 2491
223 Ga0451791_0969053 3300041451 Bacteria 1292
224 Ga0451793_0123572 3300041452 Bacteria 3753
225 Ga0439445_0018285 3300042004 Bacteria 1739
226 Ga0466965_0000004 3300044683 Bacteria 229348
227 Ga0466965_0003538 3300044683 Bacteria 6868
228 Ga0466965_0044457 3300044683 Bacteria 2195
229 Ga0466965_0155677 3300044683 Bacteria 1196
230 Ga0466965_0172433 3300044683 Bacteria 1138
231 Ga0466966_0027871 3300044684 Bacteria 3682
232 Ga0466961_0235733 3300044693 Bacteria 1125
233 Ga0466963_0030350 3300044694 Bacteria 3487
234 Ga0466964_0005434 3300044706 Bacteria 4730
235 Ga0453684_0523635 3300044712 Bacteria 1309
236 Ga0466971_0070752 3300044719 Bacteria 1584
237 Ga0466970_0009784 3300044765 Bacteria 4854
238 Ga0466957_0017888 3300044842 Bacteria 4158
239 Ga0466960_0001267 3300044901 Bacteria 9146
240 Ga0466960_0012047 3300044901 Bacteria 3639
241 Ga0466960_0027184 3300044901 Bacteria 2607
242 Ga0466960_0217826 3300044901 Bacteria 1049
243 Ga0495603_0011205 3300046455 Bacteria 5434
244 Ga0495629_0111648 3300046459 Bacteria 1906
245 Ga0495651_0087987 3300046462 Bacteria 2335
246 Ga0495650_0000211 3300046471 Bacteria 125248
247 Ga0495580_0428621 3300046472 Bacteria 889
248 Ga0495628_0117188 3300046516 Bacteria 2045
249 Ga0495656_0073425 3300046615 Bacteria 1525
250 Ga0495635_0155661 3300046663 Bacteria 1556
251 Ga0495647_0033588 3300046681 Bacteria 1918
252 Ga0495658_0166612 3300046683 Bacteria 1362
253 Ga0495658_0252158 3300046683 Bacteria 1110
254 Ga0495672_0045936 3300047320 Bacteria 2609
255 Ga0495672_0058945 3300047320 Bacteria 2223
256 Ga0495686_0000003 3300047472 Bacteria 899502
257 Ga0496101_0005788 3300048904 Bacteria 7901
258 Ga0496107_0012077 3300048910 Bacteria 6023
259 Ga0496109_0143807 3300048912 Bacteria 2231
260 Ga0496110_0172379 3300048913 Bacteria 1963
261 Ga0496114_0143116 3300048917 Bacteria 2071
262 Ga0496117_0006843 3300048920 Bacteria 11334
263 Ga0496118_0029100 3300048921 Bacteria 4639
264 Ga0496119_0007823 3300048922 Bacteria 9529
265 Ga0496119_0043948 3300048922 Bacteria 2819
266 Ga0496120_0004926 3300048923 Bacteria 10863
267 Ga0496120_0008003 3300048923 Bacteria 7779
268 Ga0496120_0052715 3300048923 Bacteria 2315
269 Ga0496122_0002555 3300048925 Bacteria 25570
270 Ga0496123_0013320 3300048926 Bacteria 6918
271 Ga0496125_0127401 3300048928 Bacteria 1801
272 Ga0496126_0029791 3300048929 Bacteria 5181
273 Ga0496126_0033914 3300048929 Bacteria 4801
274 Ga0496126_0349439 3300048929 Bacteria 1210
275 Ga0501031_0008686 3300049568 Bacteria 6605
276 Ga0501031_0164248 3300049568 Bacteria 1451
277 Ga0501032_0004227 3300049569 Bacteria 10857
278 Ga0501032_0042504 3300049569 Bacteria 3082
279 Ga0501032_0093883 3300049569 Bacteria 1989
280 Ga0501032_0110803 3300049569 Bacteria 1816
281 Ga0501033_0008284 3300049570 Bacteria 8051
282 Ga0501033_0009083 3300049570 Bacteria 7669
283 Ga0501033_0011339 3300049570 Bacteria 6821
284 Ga0501033_0021907 3300049570 Bacteria 4822
285 Ga0501033_0036965 3300049570 Bacteria 3657
286 Ga0501033_0300225 3300049570 Bacteria 1131
287 Ga0501034_0001236 3300049571 Bacteria 34720
288 Ga0501034_0005919 3300049571 Bacteria 13268
289 Ga0501034_0024669 3300049571 Bacteria 6115
290 Ga0501034_0046529 3300049571 Bacteria 4383
291 Ga0501034_0051405 3300049571 Bacteria 4155
292 Ga0501034_0424341 3300049571 Bacteria 1250
293 Ga0501036_0013296 3300049572 Bacteria 6834
294 Ga0501036_0023300 3300049572 Bacteria 5214
295 Ga0501036_0053639 3300049572 Bacteria 3414
296 Ga0501036_0205133 3300049572 Bacteria 1657
297 Ga0501036_0317355 3300049572 Bacteria 1302
298 Ga0501037_0003406 3300049573 Bacteria 11561
299 Ga0501037_0028084 3300049573 Bacteria 4155
300 Ga0501038_0001027 3300049574 Bacteria 25180
301 Ga0501038_0023477 3300049574 Bacteria 5512
302 Ga0501039_0008445 3300049575 Bacteria 7849
303 Ga0501039_0055818 3300049575 Bacteria 3060
304 Ga0501039_0282251 3300049575 Bacteria 1305
305 Ga0501040_0000207 3300049576 Archaea 34069
306 Ga0501041_0012927 3300049577 Bacteria 4946
307 Ga0501042_0070007 3300049578 Bacteria 2509
308 Ga0501043_0042654 3300049579 Bacteria 3565
309 Ga0501046_0001009 3300049580 Bacteria 27472
310 Ga0501046_0110251 3300049580 Bacteria 2103
311 Ga0501046_0199499 3300049580 Bacteria 1489
312 Ga0501047_0013642 3300049581 Bacteria 7711
313 Ga0501047_0049259 3300049581 Bacteria 4068
314 Ga0501047_0086845 3300049581 Bacteria 3005
315 Ga0501047_0331662 3300049581 Bacteria 1360
316 Ga0501048_0046018 3300049582 Bacteria 3115
317 Ga0501067_0257447 3300049583 Bacteria 972
318 Ga0501068_0056076 3300049584 Bacteria 2388
319 Ga0501069_0283102 3300049585 Bacteria 970
320 Ga0501070_0001674 3300049586 Bacteria 19652
321 Ga0501070_0056263 3300049586 Bacteria 3261
322 Ga0501070_0075009 3300049586 Bacteria 2800
323 Ga0501070_0100991 3300049586 Bacteria 2386
324 Ga0501070_0169362 3300049586 Bacteria 1799
325 Ga0501070_0188439 3300049586 Bacteria 1696
326 Ga0501071_0188290 3300049587 Bacteria 1547
327 Ga0501072_0004925 3300049588 Bacteria 10154
328 Ga0501072_0037758 3300049588 Bacteria 3788
329 Ga0501072_0371762 3300049588 Bacteria 1135
330 Ga0501072_0452485 3300049588 Bacteria 1017
331 Ga0501073_0000063 3300049589 Bacteria 66508
332 Ga0501073_0001460 3300049589 Bacteria 17499
333 Ga0501073_0045048 3300049589 Bacteria 3108
334 Ga0501073_0045169 3300049589 Bacteria 3103
335 Ga0501073_0054551 3300049589 Bacteria 2798
336 Ga0501074_0123510 3300049590 Bacteria 1851
337 Ga0501075_0031691 3300049591 Bacteria 3926
338 Ga0501075_0032010 3300049591 Bacteria 3906
339 Ga0501076_0004403 3300049592 Bacteria 10009
340 Ga0501077_0025155 3300049593 Bacteria 3781
341 Ga0501079_0009983 3300049741 Bacteria 7207
342 Ga0501080_0023914 3300049742 Bacteria 5663
343 Ga0501080_0025887 3300049742 Bacteria 5451
344 Ga0501080_0048265 3300049742 Bacteria 3963
345 Ga0501080_0059272 3300049742 Bacteria 3563
346 Ga0501080_0060878 3300049742 Bacteria 3515
347 Ga0501080_0261114 3300049742 Bacteria 1578
348 Ga0501081_0002418 3300049743 Bacteria 11778
349 Ga0501083_0011631 3300049744 Bacteria 6176
350 Ga0501083_0092538 3300049744 Bacteria 1996
351 Ga0501083_0234368 3300049744 Bacteria 1195
352 Ga0501035_0038687 3300049822 Bacteria 4318
353 Ga0501044_0015462 3300049823 Bacteria 8219
354 Ga0501044_0178084 3300049823 Bacteria 2094
355 Ga0501044_0232502 3300049823 Bacteria 1790
356 Ga0501044_0232741 3300049823 Bacteria 1789
357 Ga0501044_0389440 3300049823 Bacteria 1308
358 Ga0501045_0005650 3300049824 Bacteria 8653
359 Ga0501045_0021444 3300049824 Bacteria 4621
360 Ga0501045_0022307 3300049824 Bacteria 4532
361 nmdc:mga00v17_8366_c1 3300050491 Bacteria 5566
362 nmdc:mga0yw44_10531_c1 3300050492 Bacteria 4729
363 nmdc:mga0yw44_2872_c1 3300050492 Bacteria 7484
364 nmdc:mga0yw44_327443_c1 3300050492 Bacteria 1029
365 nmdc:mga05p37_164093_c1 3300050507 Bacteria 2712
366 nmdc:mga05p37_21444_c2 3300050507 Bacteria 5462
367 nmdc:mga05p37_290231_c1 3300050507 Bacteria 1947
368 nmdc:mga05p37_68180_c1 3300050507 Bacteria 4375
369 nmdc:mga09592_162530_c1 3300050508 Bacteria 1929
370 nmdc:mga09592_35212_c1 3300050508 Bacteria 4190
371 nmdc:mga09592_386644_c1 3300050508 Bacteria 1210
372 nmdc:mga0qj67_498866_c1 3300050509 Bacteria 979
373 nmdc:mga0qj67_7263_c1 3300050509 Bacteria 8184
374 nmdc:mga06r32_17638_c1 3300050510 Bacteria 6521
375 nmdc:mga06r32_20092_c1 3300050510 Bacteria 6143
376 nmdc:mga06r32_55944_c1 3300050510 Bacteria 3785
377 nmdc:mga0n895_185959_c1 3300050512 Bacteria 2108
378 Ga0500635_0008410 3300053080 Bacteria 2827
379 Ga0500643_000124 3300053087 Bacteria 79663
380 Ga0500644_0000001 3300053088 Bacteria 529637
381 Ga0500651_0254232 3300053093 Bacteria 1021
382 Ga0500641_0000925 3300053096 Bacteria 10473
383 Ga0500650_0000021 3300053098 Bacteria 63762
384 Ga0500556_0000008 3300053104 Bacteria 304943
385 Ga0500556_0000527 3300053104 Bacteria 26115
386 Ga0500562_000180 3300053108 Bacteria 17367
387 Ga0500593_000024 3300053117 Bacteria 52015
388 Ga0500593_000674 3300053117 Bacteria 12998
389 Ga0500559_0000420 3300053136 Bacteria 30370
390 Ga0500559_0018868 3300053136 Bacteria 2914
391 Ga0500568_0000003 3300053139 Bacteria 863587
392 Ga0500568_0000099 3300053139 Bacteria 80197
393 Ga0500568_0004704 3300053139 Bacteria 7244
394 Ga0500568_0004874 3300053139 Bacteria 7077
395 Ga0500573_0000005 3300053140 Bacteria 315762
396 Ga0500573_0009020 3300053140 Bacteria 5517
397 Ga0500573_0153024 3300053140 Bacteria 1261
398 Ga0500577_0000002 3300053142 Bacteria 239615
399 Ga0500577_0003422 3300053142 Bacteria 4121
400 Ga0500588_0012248 3300053146 Bacteria 2122
401 Ga0500590_141738 3300053148 Bacteria 1097
402 Ga0501084_0003543 3300054114 Bacteria 12674
403 Ga0501082_0009504 3300060353 Bacteria 8369
404 Ga0501082_0570380 3300060353 Bacteria 990
405 Ga0530510_0010140 3300061734 Bacteria 6602
406 Ga0530510_0048675 3300061734 Bacteria 3064
407 Ga0530510_0073965 3300061734 Bacteria 2474
408 2599020439 2597490337 Archaea 2364912
409 2644092303 2643221615 Bacteria 5487866
410 2644322106 2643221657 Bacteria 5490246
411 2812330217 2811994874 Bacteria 5367947
412 2852643995 2852643534 Bacteria 3013378
413 2857735068 2857733635 Bacteria 3532004
414 2857738791 2857737099 Bacteria 3104305
415 2862994088 2862993130 Bacteria 3860849
416 2904545616 2904541872 Bacteria 8915136
417 2929168259 2929160207 Bacteria 9075316
418 2939660466 2939657138 Bacteria 3740283
419 8046354590 8046352972 Bacteria 3613806
420 Ga0070703_10000021
421 Ga0055532_1003448
422 Ga0070658_10000976
423 Ga0070658_10001447
424 Ga0070658_10011720
425 Ga0070658_10031132
426 Ga0070658_10041206
427 Ga0070666_10039751
428 Ga0068868_100036222
429 Ga0070660_100043651
430 Ga0070659_100003355
431 Ga0070667_100001084
432 Ga0070667_100039929
433 Ga0070667_100224780
434 Ga0070714_100225695
435 Ga0070705_100008931
436 Ga0070694_100023703
437 Ga0070708_100008641
438 Ga0070708_100013582
439 Ga0070678_100282144
440 Ga0070681_10354722
441 Ga0068867_100165766
442 Ga0070706_100020157
443 Ga0070706_100046016
444 Ga0070707_100006084
445 Ga0070707_100011223
446 Ga0070698_100002193
447 Ga0070698_100002660
448 Ga0070679_100033314
449 Ga0070697_100006988
450 Ga0068853_100121364
451 Ga0070672_100019574
452 Ga0070696_100037742
453 Ga0070665_100121578
454 Ga0070704_100048804
455 Ga0070704_100056427
456 Ga0070704_100090598
457 Ga0068855_100001284
458 Ga0068855_100023203
459 Ga0068855_100034444
460 Ga0068855_100165527
461 Ga0068855_100185417
462 Ga0068857_100005100
463 Ga0068857_100280414
464 Ga0068856_100080053
465 Ga0068856_100116842
466 Ga0068856_100174122
467 Ga0068852_100008302
468 Ga0068852_100033118
469 Ga0068852_100061564
470 Ga0068852_100137570
471 Ga0068852_100183987
472 Ga0068859_100000011
473 Ga0068859_100123444
474 Ga0068864_100024877
475 Ga0068866_10003701
476 Ga0068851_10000053
477 Ga0068858_100000176
478 Ga0068860_100322654
479 Ga0081540_1004978
480 Ga0081539_10075124
481 Ga0075365_10011262
482 Ga0075364_10071618
483 Ga0070712_100121745
484 Ga0075369_10043320
485 Ga0075428_100016232
486 Ga0075428_100073953
487 Ga0075428_100242583
488 Ga0075430_100007980
489 Ga0075431_100001322
490 Ga0075429_100016093
491 Ga0075429_100019489
492 Ga0097620_100000011
493 Ga0097620_100123446
494 Ga0105240_10005148
495 Ga0105240_10065741
496 Ga0105240_10119336
497 Ga0111539_10000398
498 Ga0105245_10007692
499 Ga0105245_10025509
500 Ga0105245_10053498
501 Ga0105245_10063265
502 Ga0105247_10040923
503 Ga0105247_10116831
504 Ga0105247_10200242
505 Ga0114129_10075386
506 Ga0105243_10024345
507 Ga0105242_10004443
508 Ga0105242_10590166
509 Ga0105248_10000897
510 Ga0105248_10029387
511 Ga0105237_10004763
512 Ga0105237_10014141
513 Ga0105238_10000476
514 Ga0105246_10181612
515 Ga0157370_10137822
516 Ga0157370_10334575
517 Ga0157369_10137481
518 Ga0157369_10353660
519 Ga0157374_10030410
520 Ga0157374_10034123
521 Ga0157378_10006652
522 Ga0163162_10055545
523 Ga0157372_10487668
524 Ga0157375_10057903
525 Ga0163163_10031929
526 Ga0157379_10068421
527 Ga0157379_10311444
528 Ga0157376_10406334
529 Ga0206350_10494122
530 Ga0206353_11519911
531 Ga0213876_10007682
532 Ga0213875_10002389
533 Ga0224712_10042794
534 Ga0209677_100271
535 Ga0209148_1001014
536 Ga0209233_1003736
537 Ga0209455_1004265
538 Ga0207656_10000001
539 Ga0207653_10000004
540 Ga0207642_10001660
541 Ga0207680_10206464
542 Ga0207705_10001738
543 Ga0207705_10009264
544 Ga0207684_10019133
545 Ga0207684_10163511
546 Ga0207654_10000001
547 Ga0207695_10001399
548 Ga0207695_10002309
549 Ga0207695_10002481
550 Ga0207671_10000001
551 Ga0207671_10003504
552 Ga0207693_10132058
553 Ga0207657_10007809
554 Ga0207657_10179181
555 Ga0207652_10009995
556 Ga0207646_10004377
557 Ga0207646_10046370
558 Ga0207646_10287780
559 Ga0207681_10251452
560 Ga0207694_10000019
561 Ga0207694_10061954
562 Ga0207687_10030424
563 Ga0207687_10052616
564 Ga0207687_10200003
565 Ga0207690_10002616
566 Ga0207686_10024326
567 Ga0207691_10023123
568 Ga0207711_10000405
569 Ga0207711_10016898
570 Ga0207711_10111833
571 Ga0207689_10156920
572 Ga0207679_10310278
573 Ga0207667_10000498
574 Ga0207667_10011472
575 Ga0207667_10034594
576 Ga0207667_10080812
577 Ga0207658_10000468
578 Ga0207677_10020549
579 Ga0207677_10080037
580 Ga0207703_10000121
581 Ga0207703_10171526
582 Ga0207639_10025918
583 Ga0207678_10176304
584 Ga0207702_10044197
585 Ga0207702_10140588
586 Ga0207702_10385596
587 Ga0207641_10022978
588 Ga0207641_10075488
589 Ga0207648_10171946
590 Ga0207676_10027237
591 Ga0207674_10016735
592 Ga0207674_10222053
593 Ga0207674_10390059
594 Ga0207674_10415914
595 Ga0207698_10008089
596 Ga0207698_10021347
597 Ga0207698_10023507
598 Ga0207698_10134921
599 Ga0209371_1020129
600 Ga0268266_10152056
601 Ga0268256_1010322
602 Ga0316182_1003868
603 Ga0265325_10003210
604 Ga0307408_100020202
605 Ga0307408_100076904
606 Ga0307514_10020516
607 Ga0265342_10000678
608 Ga0307405_10031487
609 Ga0307410_10014570
610 Ga0307406_10047366
611 Ga0307407_10006317
612 Ga0307407_10038539
613 Ga0307412_10018878
614 Ga0307409_100001515
615 Ga0307409_100016321
616 Ga0307416_100111768
617 Ga0307416_100143590
618 Ga0307416_100158505
619 Ga0307411_10213538
620 Ga0307415_100169315
621 Ga0307415_100257911
622 Ga0373930_0000293
623 Ga0373932_0000159
624 Ga0373931_0000003
625 Ga0373937_0003539
626 Ga0395899_0004601
627 Ga0395899_0007189
628 Ga0395899_0209230
629 Ga0395900_0005392
630 Ga0395900_0010729
631 Ga0395898_0038877
632 Ga0395898_0149489
633 Ga0395898_0214060
634 Ga0436364_1454558
635 Ga0395901_0019142
636 Ga0395901_0044677
637 Ga0395901_0321484
638 Ga0436365_0379914
639 Ga0436363_1107981
640 Ga0439465_0031616
641 Ga0451789_0054370
642 Ga0451791_0969053
643 Ga0451793_0123572
644 Ga0439445_0018285
645 Ga0466965_0000004
646 Ga0466965_0003538
647 Ga0466965_0044457
648 Ga0466965_0155677
649 Ga0466965_0172433
650 Ga0466966_0027871
651 Ga0466961_0235733
652 Ga0466963_0030350
653 Ga0466964_0005434
654 Ga0453684_0523635
655 Ga0466971_0070752
656 Ga0466970_0009784
657 Ga0466957_0017888
658 Ga0466960_0001267
659 Ga0466960_0012047
660 Ga0466960_0027184
661 Ga0466960_0217826
662 Ga0495603_0011205
663 Ga0495629_0111648
664 Ga0495651_0087987
665 Ga0495650_0000211
666 Ga0495580_0428621
667 Ga0495628_0117188
668 Ga0495656_0073425
669 Ga0495635_0155661
670 Ga0495647_0033588
671 Ga0495658_0166612
672 Ga0495658_0252158
673 Ga0495672_0045936
674 Ga0495672_0058945
675 Ga0495686_0000003
676 Ga0496101_0005788
677 Ga0496107_0012077
678 Ga0496109_0143807
679 Ga0496110_0172379
680 Ga0496114_0143116
681 Ga0496117_0006843
682 Ga0496118_0029100
683 Ga0496119_0007823
684 Ga0496119_0043948
685 Ga0496120_0004926
686 Ga0496120_0008003
687 Ga0496120_0052715
688 Ga0496122_0002555
689 Ga0496123_0013320
690 Ga0496125_0127401
691 Ga0496126_0029791
692 Ga0496126_0033914
693 Ga0496126_0349439
694 Ga0501031_0008686
695 Ga0501031_0164248
696 Ga0501032_0004227
697 Ga0501032_0042504
698 Ga0501032_0093883
699 Ga0501032_0110803
700 Ga0501033_0008284
701 Ga0501033_0009083
702 Ga0501033_0011339
703 Ga0501033_0021907
704 Ga0501033_0036965
705 Ga0501033_0300225
706 Ga0501034_0001236
707 Ga0501034_0005919
708 Ga0501034_0024669
709 Ga0501034_0046529
710 Ga0501034_0051405
711 Ga0501034_0424341
712 Ga0501036_0013296
713 Ga0501036_0023300
714 Ga0501036_0053639
715 Ga0501036_0205133
716 Ga0501036_0317355
717 Ga0501037_0003406
718 Ga0501037_0028084
719 Ga0501038_0001027
720 Ga0501038_0023477
721 Ga0501039_0008445
722 Ga0501039_0055818
723 Ga0501039_0282251
724 Ga0501040_0000207
725 Ga0501041_0012927
726 Ga0501042_0070007
727 Ga0501043_0042654
728 Ga0501046_0001009
729 Ga0501046_0110251
730 Ga0501046_0199499
731 Ga0501047_0013642
732 Ga0501047_0049259
733 Ga0501047_0086845
734 Ga0501047_0331662
735 Ga0501048_0046018
736 Ga0501067_0257447
737 Ga0501068_0056076
738 Ga0501069_0283102
739 Ga0501070_0001674
740 Ga0501070_0056263
741 Ga0501070_0075009
742 Ga0501070_0100991
743 Ga0501070_0169362
744 Ga0501070_0188439
745 Ga0501071_0188290
746 Ga0501072_0004925
747 Ga0501072_0037758
748 Ga0501072_0371762
749 Ga0501072_0452485
750 Ga0501073_0000063
751 Ga0501073_0001460
752 Ga0501073_0045048
753 Ga0501073_0045169
754 Ga0501073_0054551
755 Ga0501074_0123510
756 Ga0501075_0031691
757 Ga0501075_0032010
758 Ga0501076_0004403
759 Ga0501077_0025155
760 Ga0501079_0009983
761 Ga0501080_0023914
762 Ga0501080_0025887
763 Ga0501080_0048265
764 Ga0501080_0059272
765 Ga0501080_0060878
766 Ga0501080_0261114
767 Ga0501081_0002418
768 Ga0501083_0011631
769 Ga0501083_0092538
770 Ga0501083_0234368
771 Ga0501035_0038687
772 Ga0501044_0015462
773 Ga0501044_0178084
774 Ga0501044_0232502
775 Ga0501044_0232741
776 Ga0501044_0389440
777 Ga0501045_0005650
778 Ga0501045_0021444
779 Ga0501045_0022307
780 nmdc:mga00v17_8366_c1
781 nmdc:mga0yw44_10531_c1
782 nmdc:mga0yw44_2872_c1
783 nmdc:mga0yw44_327443_c1
784 nmdc:mga05p37_164093_c1
785 nmdc:mga05p37_21444_c2
786 nmdc:mga05p37_290231_c1
787 nmdc:mga05p37_68180_c1
788 nmdc:mga09592_162530_c1
789 nmdc:mga09592_35212_c1
790 nmdc:mga09592_386644_c1
791 nmdc:mga0qj67_498866_c1
792 nmdc:mga0qj67_7263_c1
793 nmdc:mga06r32_17638_c1
794 nmdc:mga06r32_20092_c1
795 nmdc:mga06r32_55944_c1
796 nmdc:mga0n895_185959_c1
797 Ga0500635_0008410
798 Ga0500643_000124
799 Ga0500644_0000001
800 Ga0500651_0254232
801 Ga0500641_0000925
802 Ga0500650_0000021
803 Ga0500556_0000008
804 Ga0500556_0000527
805 Ga0500562_000180
806 Ga0500593_000024
807 Ga0500593_000674
808 Ga0500559_0000420
809 Ga0500559_0018868
810 Ga0500568_0000003
811 Ga0500568_0000099
812 Ga0500568_0004704
813 Ga0500568_0004874
814 Ga0500573_0000005
815 Ga0500573_0009020
816 Ga0500573_0153024
817 Ga0500577_0000002
818 Ga0500577_0003422
819 Ga0500588_0012248
820 Ga0500590_141738
821 Ga0501084_0003543
822 Ga0501082_0009504
823 Ga0501082_0570380
824 Ga0530510_0010140
825 Ga0530510_0048675
826 Ga0530510_0073965
827 2599020439
828 2644092303
829 2644322106
830 2812330217
831 2852643995
832 2857735068
833 2857738791
834 2862994088
835 2904545616
836 2929168259
837 2939660466
838 8046354590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

8

166

0.96

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

192

231

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v3o-assembly1.cif.gz_A crystal structure of tetx2 t280a: an adaptive mutant in complex with tigecycline 0.9402 2 30
3v3n-assembly3.cif.gz_C crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.936 2 30
3v3n-assembly4.cif.gz_D crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.9356 2 30
3v3n-assembly1.cif.gz_A crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.9352 2 30
3rp7-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae hpxo complexed with fad and uric acid 0.935 1 30
ID Description Score Start End Superfamily
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 2 162 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 1 128 3.40.50.720
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9296 2 30 3.50.50.60
2y6qB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9288 2 29 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9282 3 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7K2P8W7-F1-model_v4 6-phosphogluconate dehydrogenase 0.9977 1 113 GO:0004616
GO:0050661
AF-A0A7K0RNE6-F1-model_v4 deleted 0.997 1 97
AF-A0A6B3FZF1-F1-model_v4 6-phosphogluconate dehydrogenase 0.997 23 112 GO:0004616
GO:0050661
AF-A0A4Q5YXB7-F1-model_v4 deleted 0.9962 1 125
AF-A0A0D5CEP4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9945 1 295 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661

Map