F439487

General Info

Members Datasets Scaffolds Average Seq Length
419 281 838 172

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100432045|Ga0068855_1004320452
Length 205
Sequence VAGLHKPCPGLILPELKLILYPGQHNTCSRIFFRMEIQENIVNKVAQSGLVTLDPATFYPAGDRVVYDIKDNLFQGLILREKDFREFVKTHDWSQYQGKNVAVTCSADAIVPGWAYMLLANRLAPYAAEVVFGNEEMLETILFIKNIAKMDVEQYRDQRIVIKGCGDVHVPVSAYVELTKKLTPVAKSLMFGEPCSTVPIYKRKD

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
152 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
153 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
154 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
155 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
156 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
221 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
224 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
227 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
228 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
231 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
232 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
233 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
234 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
235 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
236 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
237 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
238 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
239 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
240 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
241 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
242 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
243 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
244 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
253 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
257 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
264 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
265 2738541284 Pedobacter sp. YR016 Isolate Unclassified
266 2739367651 Pedobacter sp. OK291 Isolate Unclassified
267 2739367656 Pedobacter sp. CF523 Isolate Unclassified
268 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
269 2818991437 Pedobacter terrae 518 Isolate Unclassified
270 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
271 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
272 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
273 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
274 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
275 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
276 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
277 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
278 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
279 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
280 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
281 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.75
Metatranscriptomes 0.72
Isolates 4.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.79
Nodule 0
Rhizoplane 0.24
Rhizosphere 84.01
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100432045 3300005563 Bacteria 1439
2 SwRhRL2b_contig_2712303 2162886007 Bacteria 5315
3 SwRhRL2b_contig_761439 2162886007 Bacteria 3629
4 SwRhRL2b_contig_857275 2162886007 Bacteria 2252
5 MRS1b_contig_6247021 2162886011 Bacteria 917
6 JGI24741J21665_1008996 3300001915 Bacteria 1855
7 JGI24737J22298_10000116 3300001990 Bacteria 24197
8 JGI24735J21928_10000015 3300002067 Bacteria 167231
9 JGI25157J39369_1004384 3300002741 Bacteria 2574
10 JGI25152J39213_1000300 3300002773 Bacteria 31900
11 JGI25150J39212_1000023 3300002774 Bacteria 130663
12 JGI25151J46595_10000082 3300003187 Bacteria 130832
13 JGI25153J46596_10000060 3300003215 Bacteria 131744
14 rootH1_10013584 3300003316 Bacteria 4023
15 rootH2_10073496 3300003320 Bacteria 4789
16 rootH2_10264962 3300003320 Bacteria 1391
17 Ga0055535_1003450 3300003761 Bacteria 4479
18 Ga0055542_1001495 3300003762 Bacteria 11422
19 Ga0055530_10001816 3300003791 Bacteria 14771
20 Ga0055531_10008470 3300003794 Bacteria 5411
21 Ga0065165_1000302 3300005262 Bacteria 82711
22 Ga0065714_10064439 3300005288 Bacteria 112310
23 Ga0065714_10078965 3300005288 Bacteria 2555
24 Ga0065714_10213226 3300005288 Bacteria 859
25 Ga0065714_10243602 3300005288 Bacteria 790
26 Ga0065704_10204048 3300005289 Bacteria 1119
27 Ga0065704_10372805 3300005289 Bacteria 783
28 Ga0065712_10002545 3300005290 Bacteria 7222
29 Ga0065707_10153631 3300005295 Bacteria 1631
30 Ga0070658_10000008 3300005327 Bacteria 319912
31 Ga0070658_10020421 3300005327 Bacteria 5309
32 Ga0070658_10241133 3300005327 Bacteria 1532
33 Ga0070683_100006005 3300005329 Bacteria 10175
34 Ga0070670_100019935 3300005331 Bacteria 5757
35 Ga0068869_100141188 3300005334 Bacteria 1860
36 Ga0070680_100013348 3300005336 Bacteria 6397
37 Ga0070682_100480600 3300005337 Bacteria 958
38 Ga0070660_100224828 3300005339 Bacteria 1526
39 Ga0070660_100265553 3300005339 Bacteria 1402
40 Ga0070689_100008949 3300005340 Bacteria 7084
41 Ga0070691_10292338 3300005341 Bacteria 887
42 Ga0070687_100354182 3300005343 Bacteria 948
43 Ga0070668_100035905 3300005347 Bacteria 3782
44 Ga0070669_100004198 3300005353 Bacteria 10428
45 Ga0070675_100000416 3300005354 Bacteria 29034
46 Ga0070675_100068186 3300005354 Bacteria 2945
47 Ga0070671_100009462 3300005355 Bacteria 7823
48 Ga0070671_100152944 3300005355 Bacteria 1948
49 Ga0070673_100070432 3300005364 Bacteria 2806
50 Ga0070673_100197310 3300005364 Bacteria 1732
51 Ga0070688_100024817 3300005365 Bacteria 3542
52 Ga0070688_100383060 3300005365 Bacteria 1037
53 Ga0070659_100049679 3300005366 Bacteria 3299
54 Ga0070659_100060784 3300005366 Bacteria 2985
55 Ga0070701_10122627 3300005438 Bacteria 1466
56 Ga0070694_100091628 3300005444 Bacteria 2134
57 Ga0070663_100002467 3300005455 Bacteria 10435
58 Ga0070662_100000863 3300005457 Bacteria 18571
59 Ga0070662_100026241 3300005457 Bacteria 4033
60 Ga0070681_10002959 3300005458 Bacteria 15767
61 Ga0068867_100060029 3300005459 Bacteria 2820
62 Ga0070679_100004682 3300005530 Bacteria 12624
63 Ga0070684_100016169 3300005535 Bacteria 6095
64 Ga0070684_100083190 3300005535 Bacteria 2835
65 Ga0070684_101318657 3300005535 Bacteria 679
66 Ga0068853_100029060 3300005539 Bacteria 4656
67 Ga0070672_100010449 3300005543 Bacteria 6442
68 Ga0070695_100422285 3300005545 Bacteria 1015
69 Ga0068855_100000130 3300005563 Bacteria 95659
70 Ga0068855_100051857 3300005563 Bacteria 4832
71 Ga0068855_100218901 3300005563 Bacteria 2136
72 Ga0068855_100221709 3300005563 Bacteria 2120
73 Ga0068857_100011349 3300005577 Bacteria 7751
74 Ga0068857_100192101 3300005577 Bacteria 1860
75 Ga0068854_100390361 3300005578 Bacteria 1149
76 Ga0068856_100000112 3300005614 Bacteria 80466
77 Ga0068856_100015216 3300005614 Bacteria 7434
78 Ga0068856_100049148 3300005614 Bacteria 4157
79 Ga0068856_100435181 3300005614 Bacteria 1332
80 Ga0068856_100624615 3300005614 Bacteria 1098
81 Ga0068852_100055623 3300005616 Unclassified 3416
82 Ga0068859_100034519 3300005617 Bacteria 5077
83 Ga0068864_100447598 3300005618 Bacteria 1235
84 Ga0068861_100009649 3300005719 Bacteria 6668
85 Ga0068851_10016633 3300005834 Bacteria 3523
86 Ga0068870_10033797 3300005840 Bacteria 2613
87 Ga0068860_100143782 3300005843 Bacteria 2294
88 Ga0068862_100072112 3300005844 Bacteria 2983
89 Ga0070712_100314707 3300006175 Bacteria 1271
90 Ga0075366_10000929 3300006195 Bacteria 14226
91 Ga0075428_101683960 3300006844 Bacteria 662
92 Ga0068865_101002155 3300006881 Bacteria 731
93 Ga0097620_100034523 3300006931 Bacteria 5077
94 Ga0105244_10219430 3300009036 Bacteria 892
95 Ga0105240_10893566 3300009093 Bacteria 956
96 Ga0111539_10003763 3300009094 Bacteria 19972
97 Ga0105243_10000043 3300009148 Bacteria 158809
98 Ga0105241_10000116 3300009174 Bacteria 57591
99 Ga0105242_10012362 3300009176 Bacteria 6571
100 Ga0105242_10122230 3300009176 Unclassified 2236
101 Ga0105237_10024919 3300009545 Bacteria 6120
102 Ga0105249_10003256 3300009553 Bacteria 14068
103 Ga0105239_10000049 3300010375 Bacteria 177578
104 Ga0105239_10038256 3300010375 Bacteria 5257
105 Ga0105239_11489971 3300010375 Bacteria 782
106 Ga0157373_10000089 3300013100 Bacteria 78449
107 Ga0157373_10004564 3300013100 Bacteria 10416
108 Ga0157373_10005698 3300013100 Bacteria 9338
109 Ga0157373_10030332 3300013100 Bacteria 3890
110 Ga0157373_10098003 3300013100 Bacteria 2063
111 Ga0157373_10125062 3300013100 Bacteria 1808
112 Ga0157373_10620867 3300013100 Bacteria 788
113 Ga0157371_10000511 3300013102 Bacteria 46681
114 Ga0157371_10002079 3300013102 Bacteria 19608
115 Ga0157371_10006312 3300013102 Bacteria 9817
116 Ga0157371_10024916 3300013102 Bacteria 4365
117 Ga0157371_10033505 3300013102 Bacteria 3690
118 Ga0157370_10000637 3300013104 Bacteria 43772
119 Ga0157370_10019842 3300013104 Bacteria 6727
120 Ga0157370_10037726 3300013104 Bacteria 4681
121 Ga0157370_10084790 3300013104 Bacteria 2977
122 Ga0157370_10100876 3300013104 Unclassified 2704
123 Ga0157370_10109225 3300013104 Bacteria 2586
124 Ga0157370_10219387 3300013104 Bacteria 1762
125 Ga0157370_10676081 3300013104 Bacteria 943
126 Ga0157370_10758411 3300013104 Bacteria 884
127 Ga0157370_10827137 3300013104 Bacteria 842
128 Ga0157369_10000594 3300013105 Bacteria 47098
129 Ga0157369_10022085 3300013105 Bacteria 7109
130 Ga0157369_10055728 3300013105 Bacteria 4267
131 Ga0157369_10210057 3300013105 Unclassified 2040
132 Ga0157369_10247309 3300013105 Unclassified 1862
133 Ga0157369_10290295 3300013105 Bacteria 1703
134 Ga0157369_10355570 3300013105 Bacteria 1521
135 Ga0157369_10945236 3300013105 Bacteria 883
136 Ga0157374_10000427 3300013296 Bacteria 38121
137 Ga0157374_10206156 3300013296 Bacteria 1927
138 Ga0157374_10664592 3300013296 Unclassified 1054
139 Ga0157378_10096044 3300013297 Bacteria 2700
140 Ga0163162_10000123 3300013306 Bacteria 68905
141 Ga0163162_10075378 3300013306 Bacteria 3434
142 Ga0163162_11513701 3300013306 Bacteria 764
143 Ga0157372_10000039 3300013307 Bacteria 165839
144 Ga0157372_10000241 3300013307 Bacteria 60488
145 Ga0157372_10003208 3300013307 Bacteria 17660
146 Ga0157372_10007944 3300013307 Bacteria 11276
147 Ga0157372_10059391 3300013307 Bacteria 4277
148 Ga0157372_11653994 3300013307 Bacteria 737
149 Ga0157375_10017849 3300013308 Bacteria 6418
150 Ga0157375_10019499 3300013308 Bacteria 6171
151 Ga0157375_10058487 3300013308 Bacteria 3814
152 Ga0157375_10118634 3300013308 Bacteria 2752
153 Ga0157375_10192537 3300013308 Bacteria 2194
154 Ga0157380_10000545 3300014326 Bacteria 23181
155 Ga0182008_10000020 3300014497 Bacteria 228333
156 Ga0182008_10000461 3300014497 Bacteria 31061
157 Ga0157377_10002364 3300014745 Bacteria 8318
158 Ga0157377_10007790 3300014745 Bacteria 5190
159 Ga0182006_1000108 3300015261 Bacteria 89633
160 Ga0182006_1000360 3300015261 Bacteria 38015
161 Ga0182006_1004894 3300015261 Bacteria 6490
162 Ga0182007_10000024 3300015262 Bacteria 181761
163 Ga0183373_1002 3300015682 Bacteria 990153
164 Ga0163161_10000093 3300017792 Bacteria 90618
165 Ga0163161_10000094 3300017792 Bacteria 90423
166 Ga0163161_10001375 3300017792 Bacteria 18039
167 Ga0163161_10118688 3300017792 Bacteria 1985
168 Ga0163161_10323010 3300017792 Bacteria 1221
169 Ga0163161_10672817 3300017792 Bacteria 860
170 Ga0206353_11169242 3300020082 Bacteria 749
171 Ga0154015_1481443 3300020610 Bacteria 822
172 Ga0213872_10008236 3300021361 Bacteria 5049
173 Ga0224712_10514122 3300022467 Bacteria 580
174 Ga0209258_100116 3300025242 Bacteria 190317
175 Ga0207425_1000051 3300025245 Bacteria 166795
176 Ga0209026_1000304 3300025250 Bacteria 53704
177 Ga0209026_1001474 3300025250 Bacteria 10370
178 Ga0209026_1004480 3300025250 Bacteria 4125
179 Ga0209148_1000251 3300025254 Bacteria 85638
180 Ga0209129_1000121 3300025258 Bacteria 135404
181 Ga0209233_1020336 3300025261 Unclassified 1744
182 Ga0207666_1059416 3300025271 Bacteria 611
183 Ga0209676_1000022 3300025292 Bacteria 605659
184 Ga0209676_1000363 3300025292 Bacteria 85613
185 Ga0209025_1000160 3300025294 Bacteria 166795
186 Ga0209758_1000147 3300025297 Bacteria 166795
187 Ga0209050_1000020 3300025298 Bacteria 605671
188 Ga0209257_1000007 3300025304 Bacteria 1564415
189 Ga0207697_10029818 3300025315 Bacteria 2233
190 Ga0207656_10073655 3300025321 Bacteria 1522
191 Ga0207647_10000018 3300025904 Bacteria 124816
192 Ga0207647_10000256 3300025904 Bacteria 43702
193 Ga0207647_10082917 3300025904 Bacteria 1920
194 Ga0207647_10108607 3300025904 Bacteria 1641
195 Ga0207647_10217096 3300025904 Bacteria 1103
196 Ga0207685_10152896 3300025905 Bacteria 1046
197 Ga0207643_10036345 3300025908 Bacteria 2762
198 Ga0207705_10000035 3300025909 Bacteria 201649
199 Ga0207705_10020066 3300025909 Bacteria 4779
200 Ga0207705_10606765 3300025909 Unclassified 851
201 Ga0207654_10006275 3300025911 Bacteria 5975
202 Ga0207707_10004330 3300025912 Bacteria 12569
203 Ga0207695_10011959 3300025913 Bacteria 10447
204 Ga0207671_10028615 3300025914 Bacteria 4162
205 Ga0207693_10290651 3300025915 Bacteria 1281
206 Ga0207660_10054438 3300025917 Bacteria 2855
207 Ga0207662_10106356 3300025918 Bacteria 1745
208 Ga0207657_10295608 3300025919 Bacteria 1283
209 Ga0207649_11009941 3300025920 Unclassified 655
210 Ga0207681_10005541 3300025923 Bacteria 7756
211 Ga0207650_10033959 3300025925 Bacteria 3698
212 Ga0207659_10051799 3300025926 Bacteria 2921
213 Ga0207659_10910310 3300025926 Bacteria 756
214 Ga0207664_10676440 3300025929 Bacteria 928
215 Ga0207644_10004990 3300025931 Bacteria 8662
216 Ga0207690_10001492 3300025932 Bacteria 14624
217 Ga0207690_10034122 3300025932 Bacteria 3277
218 Ga0207690_10038527 3300025932 Bacteria 3112
219 Ga0207706_10000013 3300025933 Bacteria 188236
220 Ga0207706_10015321 3300025933 Bacteria 6930
221 Ga0207686_10140025 3300025934 Bacteria 1671
222 Ga0207686_10144171 3300025934 Unclassified 1650
223 Ga0207709_10000021 3300025935 Bacteria 386722
224 Ga0207670_10004226 3300025936 Bacteria 7705
225 Ga0207704_10794458 3300025938 Bacteria 790
226 Ga0207691_10049996 3300025940 Bacteria 3828
227 Ga0207689_10148795 3300025942 Bacteria 1930
228 Ga0207661_10006414 3300025944 Bacteria 8321
229 Ga0207661_10031434 3300025944 Unclassified 4101
230 Ga0207667_10000274 3300025949 Bacteria 71328
231 Ga0207667_10602580 3300025949 Bacteria 1108
232 Ga0207667_10765021 3300025949 Bacteria 964
233 Ga0207651_10064422 3300025960 Bacteria 2565
234 Ga0207712_10042710 3300025961 Bacteria 3124
235 Ga0207677_10218176 3300026023 Bacteria 1528
236 Ga0207639_10035061 3300026041 Bacteria 3712
237 Ga0207639_11161115 3300026041 Bacteria 725
238 Ga0207678_10006451 3300026067 Bacteria 10409
239 Ga0207702_10000278 3300026078 Bacteria 58953
240 Ga0207702_10020477 3300026078 Bacteria 5476
241 Ga0207702_10046253 3300026078 Bacteria 3663
242 Ga0207702_10104436 3300026078 Bacteria 2507
243 Ga0207702_10635114 3300026078 Bacteria 1049
244 Ga0207648_10060664 3300026089 Bacteria 3298
245 Ga0207676_11054962 3300026095 Bacteria 802
246 Ga0207674_10017021 3300026116 Bacteria 7937
247 Ga0207674_10077096 3300026116 Bacteria 3339
248 Ga0207675_100000332 3300026118 Bacteria 45114
249 Ga0268265_10019100 3300028380 Bacteria 4757
250 Ga0268264_10073113 3300028381 Bacteria 2909
251 Ga0265338_10047663 3300028800 Bacteria 3911
252 Ga0316177_1003264 3300030731 Bacteria 926
253 Ga0316176_1102297 3300030732 Bacteria 14584
254 Ga0314311_1129672 3300030733 Bacteria 1238
255 Ga0316183_1003890 3300030742 Bacteria 25813
256 Ga0316181_1131993 3300030744 Bacteria 4241
257 Ga0316181_1132288 3300030744 Unclassified 3701
258 Ga0316181_1289094 3300030744 Bacteria 1329
259 Ga0316182_1277066 3300030745 Bacteria 1233
260 Ga0265327_10001093 3300031251 Bacteria 37634
261 Ga0265327_10094768 3300031251 Bacteria 1450
262 Ga0265327_10263153 3300031251 Bacteria 765
263 Ga0307509_10083601 3300031507 Unclassified 3290
264 Ga0307408_100000517 3300031548 Bacteria 33313
265 Ga0307408_100001538 3300031548 Bacteria 17127
266 Ga0307408_100055924 3300031548 Unclassified 2859
267 Ga0307408_101655932 3300031548 Bacteria 609
268 Ga0265314_10287936 3300031711 Bacteria 926
269 Ga0307405_10000011 3300031731 Bacteria 241071
270 Ga0307405_10131614 3300031731 Bacteria 1729
271 Ga0307410_10226897 3300031852 Bacteria 1440
272 Ga0307407_10000163 3300031903 Bacteria 20529
273 Ga0307412_10000001 3300031911 Bacteria 822691
274 Ga0307412_10001430 3300031911 Bacteria 13285
275 Ga0307412_10009032 3300031911 Bacteria 5710
276 Ga0307412_10033374 3300031911 Bacteria 3271
277 Ga0307412_10340290 3300031911 Bacteria 1201
278 Ga0307412_10590568 3300031911 Bacteria 939
279 Ga0307409_101110223 3300031995 Unclassified 812
280 Ga0307416_100000050 3300032002 Bacteria 116313
281 Ga0307416_100488223 3300032002 Bacteria 1293
282 Ga0307414_10005075 3300032004 Bacteria 7216
283 Ga0307414_10016198 3300032004 Bacteria 4525
284 Ga0307414_10048868 3300032004 Bacteria 2921
285 Ga0307414_10118515 3300032004 Bacteria 2030
286 Ga0307414_10199171 3300032004 Bacteria 1627
287 Ga0307414_10477061 3300032004 Bacteria 1099
288 Ga0307414_10785853 3300032004 Bacteria 867
289 Ga0307414_10880059 3300032004 Bacteria 820
290 Ga0307411_10073655 3300032005 Bacteria 2324
291 Ga0373934_0255602 3300035086 Bacteria 725
292 Ga0316574_0299551 3300035398 Bacteria 1023
293 Ga0373927_0055241 3300035695 Unclassified 2568
294 Ga0373937_0255463 3300036401 Bacteria 1652
295 Ga0316584_0130840 3300036712 Unclassified 1874
296 Ga0395899_0000282 3300037312 Bacteria 66053
297 Ga0395899_0052363 3300037312 Bacteria 3026
298 Ga0395899_0525764 3300037312 Bacteria 764
299 Ga0395900_0000195 3300037418 Bacteria 97204
300 Ga0395900_0009107 3300037418 Bacteria 10169
301 Ga0395900_0961876 3300037418 Bacteria 775
302 Ga0395898_0200160 3300037466 Bacteria 1907
303 Ga0395905_0000993 3300037471 Bacteria 36305
304 Ga0395901_0005293 3300038443 Bacteria 13041
305 Ga0395901_0526280 3300038443 Unclassified 1200
306 Ga0436361_1126675 3300039447 Bacteria 11002
307 Ga0451833_0138410 3300041491 Bacteria 646
308 Ga0439457_010490 3300042014 Unclassified 2128
309 Ga0450893_0066459 3300042532 Unclassified 695
310 Ga0466966_0008901 3300044684 Bacteria 6649
311 Ga0466961_0049757 3300044693 Bacteria 2678
312 Ga0453684_0073337 3300044712 Bacteria 4316
313 Ga0453684_0201862 3300044712 Bacteria 2317
314 Ga0466968_0239455 3300044735 Bacteria 859
315 Ga0466957_0354344 3300044842 Bacteria 996
316 Ga0451576_0047928 3300045051 Bacteria 4491
317 Ga0466958_0065994 3300045836 Bacteria 2209
318 Ga0495627_028556 3300046453 Bacteria 1782
319 Ga0495650_0000144 3300046471 Bacteria 165957
320 Ga0495580_0011568 3300046472 Bacteria 6826
321 Ga0495585_0000091 3300046492 Bacteria 95620
322 Ga0495606_0009276 3300046507 Bacteria 8350
323 Ga0495610_0000219 3300046512 Bacteria 61501
324 Ga0495610_0002599 3300046512 Bacteria 14973
325 Ga0495610_0007529 3300046512 Bacteria 7215
326 Ga0495616_0017439 3300046513 Bacteria 3961
327 Ga0495637_0040482 3300046520 Bacteria 2006
328 Ga0495644_0007582 3300046523 Bacteria 4183
329 Ga0495652_0582173 3300046529 Bacteria 766
330 Ga0495609_0015348 3300046538 Bacteria 3585
331 Ga0495609_0056150 3300046538 Bacteria 1745
332 Ga0495622_0184275 3300046557 Bacteria 935
333 Ga0495633_0005839 3300046558 Bacteria 7411
334 Ga0495633_0034796 3300046558 Bacteria 2421
335 Ga0495625_0000059 3300046660 Bacteria 180330
336 Ga0495635_0049654 3300046663 Bacteria 2892
337 Ga0495661_0018331 3300046665 Bacteria 4606
338 Ga0495649_0000031 3300046694 Bacteria 151547
339 Ga0495680_1095559 3300047322 Bacteria 503
340 Ga0495687_001100 3300047443 Bacteria 26388
341 Ga0495675_0595563 3300047444 Bacteria 627
342 Ga0495685_088254 3300047447 Bacteria 1029
343 Ga0495686_0091153 3300047472 Bacteria 1850
344 Ga0496116_0072647 3300048919 Bacteria 2173
345 Ga0496117_0008262 3300048920 Bacteria 9913
346 Ga0496118_0033378 3300048921 Bacteria 4224
347 Ga0496122_0026512 3300048925 Bacteria 4992
348 Ga0496123_0007418 3300048926 Bacteria 10339
349 Ga0496124_0080857 3300048927 Bacteria 2673
350 Ga0496126_0550132 3300048929 Bacteria 916
351 Ga0495678_137199 3300049459 Bacteria 804
352 Ga0501290_003892 3300049513 Bacteria 1869
353 Ga0501297_000533 3300049520 Unclassified 3434
354 Ga0501034_0790621 3300049571 Unclassified 842
355 Ga0501198_000167 3300049649 Bacteria 8710
356 Ga0501198_019543 3300049649 Bacteria 1068
357 Ga0501201_000104 3300049651 Bacteria 6685
358 Ga0501202_001568 3300049652 Bacteria 3688
359 Ga0501206_002921 3300049653 Bacteria 2159
360 Ga0501217_066156 3300049661 Bacteria 975
361 Ga0501223_001032 3300049663 Bacteria 6583
362 Ga0501235_007479 3300049669 Bacteria 2379
363 Ga0501240_001493 3300049673 Unclassified 2295
364 Ga0501242_004914 3300049674 Bacteria 1493
365 Ga0501246_003389 3300049676 Bacteria 1281
366 Ga0501249_027433 3300049679 Bacteria 1260
367 Ga0501250_008573 3300049680 Bacteria 1131
368 Ga0501252_002574 3300049682 Bacteria 1811
369 Ga0501256_002218 3300049685 Bacteria 1525
370 Ga0501259_000375 3300049688 Bacteria 7028
371 Ga0501221_000120 3300049704 Bacteria 9800
372 Ga0501225_0003232 3300049705 Bacteria 4976
373 Ga0501245_000053 3300049708 Bacteria 10632
374 Ga0501232_018290 3300049757 Bacteria 880
375 Ga0501241_007212 3300049758 Bacteria 2038
376 Ga0501241_014018 3300049758 Bacteria 1456
377 Ga0501212_003491 3300049851 Bacteria 1977
378 Ga0501284_08177 3300050005 Bacteria 621
379 nmdc:mga0k408_783_c1 3300050493 Bacteria 17509
380 nmdc:mga08y16_1594_c1 3300050511 Bacteria 22911
381 Ga0495619_0090368 3300053085 Bacteria 2073
382 Ga0500644_0000458 3300053088 Bacteria 18625
383 Ga0500646_0007092 3300053090 Bacteria 2859
384 Ga0500583_0021222 3300053092 Bacteria 2697
385 Ga0500651_0001126 3300053093 Bacteria 13227
386 Ga0500651_0355727 3300053093 Bacteria 830
387 Ga0500562_040253 3300053108 Unclassified 1242
388 Ga0500562_073294 3300053108 Bacteria 924
389 Ga0500569_000835 3300053109 Bacteria 5462
390 Ga0500658_0007044 3300053134 Bacteria 4160
391 Ga0500559_0019625 3300053136 Bacteria 2856
392 Ga0500561_0128625 3300053137 Bacteria 778
393 Ga0500577_0001396 3300053142 Bacteria 6180
394 Ga0500604_0019958 3300053151 Unclassified 1881
395 Ga0500616_0004658 3300053153 Bacteria 9670
396 Ga0500622_0000017 3300053156 Bacteria 332114
397 Ga0500622_0000387 3300053156 Bacteria 42589
398 Ga0500633_0001021 3300053160 Bacteria 4973
399 Ga0500633_0146302 3300053160 Bacteria 885
400 Ga0500645_036250 3300053730 Bacteria 1468
401 2599482003 2599185184 Bacteria 6430550
402 2722726324 2721755487 Bacteria 6357185
403 2738763285 2738541284 Bacteria 5199923
404 2739591461 2739367651 Bacteria 6359826
405 2739615273 2739367656 Bacteria 5152243
406 2776616109 2775506987 Bacteria 5373360
407 2819549553 2818991437 Bacteria 5805520
408 2842904974 2842903701 Bacteria 6986368
409 2857632432 2857627736 Bacteria 5625397
410 2884637931 2884634485 Bacteria 3928637
411 2896346115 2896344016 Bacteria 3811746
412 2898716242 2898713307 Bacteria 4110805
413 2904447307 2904445276 Bacteria 5310396
414 2904783789 2904780799 Bacteria 5840761
415 2919181961 2919177583 Bacteria 5641607
416 2928082112 2928078545 Bacteria 6534839
417 2932087954 2932082852 Bacteria 6563563
418 2945998366 2945997725 Bacteria 6404843
419 8055589932 8055588893 Bacteria 3619545
420 Ga0068855_100432045
421 SwRhRL2b_contig_2712303
422 SwRhRL2b_contig_761439
423 SwRhRL2b_contig_857275
424 MRS1b_contig_6247021
425 JGI24741J21665_1008996
426 JGI24737J22298_10000116
427 JGI24735J21928_10000015
428 JGI25157J39369_1004384
429 JGI25152J39213_1000300
430 JGI25150J39212_1000023
431 JGI25151J46595_10000082
432 JGI25153J46596_10000060
433 rootH1_10013584
434 rootH2_10073496
435 rootH2_10264962
436 Ga0055535_1003450
437 Ga0055542_1001495
438 Ga0055530_10001816
439 Ga0055531_10008470
440 Ga0065165_1000302
441 Ga0065714_10064439
442 Ga0065714_10078965
443 Ga0065714_10213226
444 Ga0065714_10243602
445 Ga0065704_10204048
446 Ga0065704_10372805
447 Ga0065712_10002545
448 Ga0065707_10153631
449 Ga0070658_10000008
450 Ga0070658_10020421
451 Ga0070658_10241133
452 Ga0070683_100006005
453 Ga0070670_100019935
454 Ga0068869_100141188
455 Ga0070680_100013348
456 Ga0070682_100480600
457 Ga0070660_100224828
458 Ga0070660_100265553
459 Ga0070689_100008949
460 Ga0070691_10292338
461 Ga0070687_100354182
462 Ga0070668_100035905
463 Ga0070669_100004198
464 Ga0070675_100000416
465 Ga0070675_100068186
466 Ga0070671_100009462
467 Ga0070671_100152944
468 Ga0070673_100070432
469 Ga0070673_100197310
470 Ga0070688_100024817
471 Ga0070688_100383060
472 Ga0070659_100049679
473 Ga0070659_100060784
474 Ga0070701_10122627
475 Ga0070694_100091628
476 Ga0070663_100002467
477 Ga0070662_100000863
478 Ga0070662_100026241
479 Ga0070681_10002959
480 Ga0068867_100060029
481 Ga0070679_100004682
482 Ga0070684_100016169
483 Ga0070684_100083190
484 Ga0070684_101318657
485 Ga0068853_100029060
486 Ga0070672_100010449
487 Ga0070695_100422285
488 Ga0068855_100000130
489 Ga0068855_100051857
490 Ga0068855_100218901
491 Ga0068855_100221709
492 Ga0068857_100011349
493 Ga0068857_100192101
494 Ga0068854_100390361
495 Ga0068856_100000112
496 Ga0068856_100015216
497 Ga0068856_100049148
498 Ga0068856_100435181
499 Ga0068856_100624615
500 Ga0068852_100055623
501 Ga0068859_100034519
502 Ga0068864_100447598
503 Ga0068861_100009649
504 Ga0068851_10016633
505 Ga0068870_10033797
506 Ga0068860_100143782
507 Ga0068862_100072112
508 Ga0070712_100314707
509 Ga0075366_10000929
510 Ga0075428_101683960
511 Ga0068865_101002155
512 Ga0097620_100034523
513 Ga0105244_10219430
514 Ga0105240_10893566
515 Ga0111539_10003763
516 Ga0105243_10000043
517 Ga0105241_10000116
518 Ga0105242_10012362
519 Ga0105242_10122230
520 Ga0105237_10024919
521 Ga0105249_10003256
522 Ga0105239_10000049
523 Ga0105239_10038256
524 Ga0105239_11489971
525 Ga0157373_10000089
526 Ga0157373_10004564
527 Ga0157373_10005698
528 Ga0157373_10030332
529 Ga0157373_10098003
530 Ga0157373_10125062
531 Ga0157373_10620867
532 Ga0157371_10000511
533 Ga0157371_10002079
534 Ga0157371_10006312
535 Ga0157371_10024916
536 Ga0157371_10033505
537 Ga0157370_10000637
538 Ga0157370_10019842
539 Ga0157370_10037726
540 Ga0157370_10084790
541 Ga0157370_10100876
542 Ga0157370_10109225
543 Ga0157370_10219387
544 Ga0157370_10676081
545 Ga0157370_10758411
546 Ga0157370_10827137
547 Ga0157369_10000594
548 Ga0157369_10022085
549 Ga0157369_10055728
550 Ga0157369_10210057
551 Ga0157369_10247309
552 Ga0157369_10290295
553 Ga0157369_10355570
554 Ga0157369_10945236
555 Ga0157374_10000427
556 Ga0157374_10206156
557 Ga0157374_10664592
558 Ga0157378_10096044
559 Ga0163162_10000123
560 Ga0163162_10075378
561 Ga0163162_11513701
562 Ga0157372_10000039
563 Ga0157372_10000241
564 Ga0157372_10003208
565 Ga0157372_10007944
566 Ga0157372_10059391
567 Ga0157372_11653994
568 Ga0157375_10017849
569 Ga0157375_10019499
570 Ga0157375_10058487
571 Ga0157375_10118634
572 Ga0157375_10192537
573 Ga0157380_10000545
574 Ga0182008_10000020
575 Ga0182008_10000461
576 Ga0157377_10002364
577 Ga0157377_10007790
578 Ga0182006_1000108
579 Ga0182006_1000360
580 Ga0182006_1004894
581 Ga0182007_10000024
582 Ga0183373_1002
583 Ga0163161_10000093
584 Ga0163161_10000094
585 Ga0163161_10001375
586 Ga0163161_10118688
587 Ga0163161_10323010
588 Ga0163161_10672817
589 Ga0206353_11169242
590 Ga0154015_1481443
591 Ga0213872_10008236
592 Ga0224712_10514122
593 Ga0209258_100116
594 Ga0207425_1000051
595 Ga0209026_1000304
596 Ga0209026_1001474
597 Ga0209026_1004480
598 Ga0209148_1000251
599 Ga0209129_1000121
600 Ga0209233_1020336
601 Ga0207666_1059416
602 Ga0209676_1000022
603 Ga0209676_1000363
604 Ga0209025_1000160
605 Ga0209758_1000147
606 Ga0209050_1000020
607 Ga0209257_1000007
608 Ga0207697_10029818
609 Ga0207656_10073655
610 Ga0207647_10000018
611 Ga0207647_10000256
612 Ga0207647_10082917
613 Ga0207647_10108607
614 Ga0207647_10217096
615 Ga0207685_10152896
616 Ga0207643_10036345
617 Ga0207705_10000035
618 Ga0207705_10020066
619 Ga0207705_10606765
620 Ga0207654_10006275
621 Ga0207707_10004330
622 Ga0207695_10011959
623 Ga0207671_10028615
624 Ga0207693_10290651
625 Ga0207660_10054438
626 Ga0207662_10106356
627 Ga0207657_10295608
628 Ga0207649_11009941
629 Ga0207681_10005541
630 Ga0207650_10033959
631 Ga0207659_10051799
632 Ga0207659_10910310
633 Ga0207664_10676440
634 Ga0207644_10004990
635 Ga0207690_10001492
636 Ga0207690_10034122
637 Ga0207690_10038527
638 Ga0207706_10000013
639 Ga0207706_10015321
640 Ga0207686_10140025
641 Ga0207686_10144171
642 Ga0207709_10000021
643 Ga0207670_10004226
644 Ga0207704_10794458
645 Ga0207691_10049996
646 Ga0207689_10148795
647 Ga0207661_10006414
648 Ga0207661_10031434
649 Ga0207667_10000274
650 Ga0207667_10602580
651 Ga0207667_10765021
652 Ga0207651_10064422
653 Ga0207712_10042710
654 Ga0207677_10218176
655 Ga0207639_10035061
656 Ga0207639_11161115
657 Ga0207678_10006451
658 Ga0207702_10000278
659 Ga0207702_10020477
660 Ga0207702_10046253
661 Ga0207702_10104436
662 Ga0207702_10635114
663 Ga0207648_10060664
664 Ga0207676_11054962
665 Ga0207674_10017021
666 Ga0207674_10077096
667 Ga0207675_100000332
668 Ga0268265_10019100
669 Ga0268264_10073113
670 Ga0265338_10047663
671 Ga0316177_1003264
672 Ga0316176_1102297
673 Ga0314311_1129672
674 Ga0316183_1003890
675 Ga0316181_1131993
676 Ga0316181_1132288
677 Ga0316181_1289094
678 Ga0316182_1277066
679 Ga0265327_10001093
680 Ga0265327_10094768
681 Ga0265327_10263153
682 Ga0307509_10083601
683 Ga0307408_100000517
684 Ga0307408_100001538
685 Ga0307408_100055924
686 Ga0307408_101655932
687 Ga0265314_10287936
688 Ga0307405_10000011
689 Ga0307405_10131614
690 Ga0307410_10226897
691 Ga0307407_10000163
692 Ga0307412_10000001
693 Ga0307412_10001430
694 Ga0307412_10009032
695 Ga0307412_10033374
696 Ga0307412_10340290
697 Ga0307412_10590568
698 Ga0307409_101110223
699 Ga0307416_100000050
700 Ga0307416_100488223
701 Ga0307414_10005075
702 Ga0307414_10016198
703 Ga0307414_10048868
704 Ga0307414_10118515
705 Ga0307414_10199171
706 Ga0307414_10477061
707 Ga0307414_10785853
708 Ga0307414_10880059
709 Ga0307411_10073655
710 Ga0373934_0255602
711 Ga0316574_0299551
712 Ga0373927_0055241
713 Ga0373937_0255463
714 Ga0316584_0130840
715 Ga0395899_0000282
716 Ga0395899_0052363
717 Ga0395899_0525764
718 Ga0395900_0000195
719 Ga0395900_0009107
720 Ga0395900_0961876
721 Ga0395898_0200160
722 Ga0395905_0000993
723 Ga0395901_0005293
724 Ga0395901_0526280
725 Ga0436361_1126675
726 Ga0451833_0138410
727 Ga0439457_010490
728 Ga0450893_0066459
729 Ga0466966_0008901
730 Ga0466961_0049757
731 Ga0453684_0073337
732 Ga0453684_0201862
733 Ga0466968_0239455
734 Ga0466957_0354344
735 Ga0451576_0047928
736 Ga0466958_0065994
737 Ga0495627_028556
738 Ga0495650_0000144
739 Ga0495580_0011568
740 Ga0495585_0000091
741 Ga0495606_0009276
742 Ga0495610_0000219
743 Ga0495610_0002599
744 Ga0495610_0007529
745 Ga0495616_0017439
746 Ga0495637_0040482
747 Ga0495644_0007582
748 Ga0495652_0582173
749 Ga0495609_0015348
750 Ga0495609_0056150
751 Ga0495622_0184275
752 Ga0495633_0005839
753 Ga0495633_0034796
754 Ga0495625_0000059
755 Ga0495635_0049654
756 Ga0495661_0018331
757 Ga0495649_0000031
758 Ga0495680_1095559
759 Ga0495687_001100
760 Ga0495675_0595563
761 Ga0495685_088254
762 Ga0495686_0091153
763 Ga0496116_0072647
764 Ga0496117_0008262
765 Ga0496118_0033378
766 Ga0496122_0026512
767 Ga0496123_0007418
768 Ga0496124_0080857
769 Ga0496126_0550132
770 Ga0495678_137199
771 Ga0501290_003892
772 Ga0501297_000533
773 Ga0501034_0790621
774 Ga0501198_000167
775 Ga0501198_019543
776 Ga0501201_000104
777 Ga0501202_001568
778 Ga0501206_002921
779 Ga0501217_066156
780 Ga0501223_001032
781 Ga0501235_007479
782 Ga0501240_001493
783 Ga0501242_004914
784 Ga0501246_003389
785 Ga0501249_027433
786 Ga0501250_008573
787 Ga0501252_002574
788 Ga0501256_002218
789 Ga0501259_000375
790 Ga0501221_000120
791 Ga0501225_0003232
792 Ga0501245_000053
793 Ga0501232_018290
794 Ga0501241_007212
795 Ga0501241_014018
796 Ga0501212_003491
797 Ga0501284_08177
798 nmdc:mga0k408_783_c1
799 nmdc:mga08y16_1594_c1
800 Ga0495619_0090368
801 Ga0500644_0000458
802 Ga0500646_0007092
803 Ga0500583_0021222
804 Ga0500651_0001126
805 Ga0500651_0355727
806 Ga0500562_040253
807 Ga0500562_073294
808 Ga0500569_000835
809 Ga0500658_0007044
810 Ga0500559_0019625
811 Ga0500561_0128625
812 Ga0500577_0001396
813 Ga0500604_0019958
814 Ga0500616_0004658
815 Ga0500622_0000017
816 Ga0500622_0000387
817 Ga0500633_0001021
818 Ga0500633_0146302
819 Ga0500645_036250
820 2599482003
821 2722726324
822 2738763285
823 2739591461
824 2739615273
825 2776616109
826 2819549553
827 2842904974
828 2857632432
829 2884637931
830 2896346115
831 2898716242
832 2904447307
833 2904783789
834 2919181961
835 2928082112
836 2932087954
837 2945998366
838 8055589932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10652

DUF2480

Protein of unknown function (DUF2480)

39

203

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nte-assembly1.cif.gz_A crystal structure of deph 0.4711 27 99
6hts-assembly1.cif.gz_H cryo-em structure of the human ino80 complex bound to nucleosome 0.4458 38 110
4weo-assembly1.cif.gz_A crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.4377 27 134
4weo-assembly1.cif.gz_B crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.4374 27 134
4weo-assembly1.cif.gz_C crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.4259 27 134
ID Description Score Start End Superfamily
af_Q2R4H4_170_321_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5782 62 98 3.40.50.300
3lklB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.5486 29 98 3.30.750.24
af_A0A7I2V3D3_1_121_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5313 38 100 3.30.420.40
2q0xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5278 50 114 3.40.50.1820
af_P80428_1_151_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5176 38 99 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A496P0Q0-F1-model_v4 DUF2480 family protein 0.9713 105 169
AF-A0A7C5MZ91-F1-model_v4 DUF2480 family protein 0.9693 45 171
AF-A0A2I2DWX7-F1-model_v4 DUF2480 domain containing protein 0.9688 17 170
AF-A0A7Y1VN74-F1-model_v4 DUF2480 family protein 0.9683 39 170
AF-A0A2T2VLA3-F1-model_v4 DUF2480 domain-containing protein 0.9636 24 170

Map