F439489

General Info

Members Datasets Scaffolds Average Seq Length
419 223 418 143

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_102031596|Ga0068857_1020315961
Length 162
Sequence MAETKTKPTSKSVEGFLNKISDEERRADCFQVAQIMEELTGEKPKMWGPSIVGFGSYHYKYDSGREGDWCMTGFSPRKKDLTLYLMMGFEKRGELMEKLGKHSHAKSCLYIKRLSDIHIPTLKKLIKASLKDHKAYLASKTKVRQDFRIFRINRDSVILLIL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
199 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
200 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
201 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
202 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
205 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
212 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0.24
Rhizoplane 1.67
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_9093553 2162886011 Unclassified 2514
2 JGI24751J29686_10000012 3300002459 Bacteria 115709
3 JGI25154J39366_1000080 3300002738 Bacteria 89374
4 JGI25157J39369_1012474 3300002741 Unclassified 1080
5 JGI25406J46586_10114835 3300003203 Unclassified 795
6 JGI25153J46596_10010315 3300003215 Bacteria 4238
7 rootH2_10121869 3300003320 Bacteria 1436
8 JGI25160J50197_1021418 3300003354 Bacteria 1922
9 Ga0065714_10064422 3300005288 Bacteria 270668
10 Ga0065712_10008444 3300005290 Unclassified 2232
11 Ga0065712_10012125 3300005290 Bacteria 2959
12 Ga0065712_10016741 3300005290 Bacteria 2229
13 Ga0065712_10023794 3300005290 Bacteria 1572
14 Ga0065712_10025668 3300005290 Bacteria 1284
15 Ga0065712_10067728 3300005290 Bacteria 178215
16 Ga0065715_10011089 3300005293 Bacteria 2125
17 Ga0065715_10020401 3300005293 Bacteria 2434
18 Ga0065715_10091058 3300005293 Bacteria 6143
19 Ga0065715_10094314 3300005293 Unclassified 4377
20 Ga0065715_10330812 3300005293 Bacteria 984
21 Ga0065707_10119647 3300005295 Bacteria 2154
22 Ga0070690_100819437 3300005330 Unclassified 723
23 Ga0070670_100000174 3300005331 Bacteria 58017
24 Ga0070670_100161324 3300005331 Bacteria 1943
25 Ga0068869_100085533 3300005334 Unclassified 2362
26 Ga0068869_100822622 3300005334 Unclassified 800
27 Ga0070680_100005011 3300005336 Bacteria 9987
28 Ga0070680_100530475 3300005336 Bacteria 1008
29 Ga0070682_100081773 3300005337 Bacteria 2092
30 Ga0070682_100093552 3300005337 Bacteria 1971
31 Ga0070682_101377255 3300005337 Unclassified 602
32 Ga0070689_100182512 3300005340 Bacteria 1705
33 Ga0070689_102090052 3300005340 Unclassified 518
34 Ga0070687_100192167 3300005343 Unclassified 1231
35 Ga0070687_100248019 3300005343 Unclassified 1105
36 Ga0070692_10128004 3300005345 Unclassified 1424
37 Ga0070669_100104068 3300005353 Bacteria 2146
38 Ga0070669_101018575 3300005353 Bacteria 711
39 Ga0070669_101448081 3300005353 Unclassified 596
40 Ga0070675_101024534 3300005354 Unclassified 758
41 Ga0070674_101661510 3300005356 Bacteria 577
42 Ga0070673_100187931 3300005364 Unclassified 1772
43 Ga0070673_100445563 3300005364 Unclassified 1164
44 Ga0070673_100527636 3300005364 Bacteria 1070
45 Ga0070688_101485209 3300005365 Bacteria 551
46 Ga0070659_100337648 3300005366 Bacteria 1262
47 Ga0070659_101848166 3300005366 Unclassified 541
48 Ga0070667_101779482 3300005367 Unclassified 580
49 Ga0070703_10084650 3300005406 Bacteria 1087
50 Ga0070709_10612133 3300005434 Bacteria 840
51 Ga0070713_100539236 3300005436 Bacteria 1104
52 Ga0070701_10008248 3300005438 Bacteria 4495
53 Ga0070701_10068911 3300005438 Bacteria 1886
54 Ga0070701_10978008 3300005438 Bacteria 589
55 Ga0070705_100013974 3300005440 Unclassified 4119
56 Ga0070705_100040560 3300005440 Unclassified 2648
57 Ga0070705_100370854 3300005440 Bacteria 1050
58 Ga0070705_100512452 3300005440 Bacteria 913
59 Ga0070700_100021789 3300005441 Bacteria 3729
60 Ga0070700_100031330 3300005441 Bacteria 3186
61 Ga0070700_100700036 3300005441 Bacteria 805
62 Ga0070700_100923292 3300005441 Unclassified 712
63 Ga0070694_100078426 3300005444 Bacteria 2291
64 Ga0070694_100505900 3300005444 Bacteria 962
65 Ga0070694_100643962 3300005444 Unclassified 857
66 Ga0070678_100275679 3300005456 Unclassified 1420
67 Ga0070662_101146133 3300005457 Bacteria 668
68 Ga0070681_10130341 3300005458 Unclassified 2447
69 Ga0068867_100655254 3300005459 Bacteria 922
70 Ga0070685_10513295 3300005466 Bacteria 850
71 Ga0070706_100002023 3300005467 Bacteria 20813
72 Ga0070698_100612748 3300005471 Bacteria 1029
73 Ga0070699_100105058 3300005518 Bacteria 2477
74 Ga0068853_100573958 3300005539 Bacteria 1070
75 Ga0068853_100584350 3300005539 Bacteria 1060
76 Ga0070672_100228183 3300005543 Unclassified 1564
77 Ga0070672_100527239 3300005543 Unclassified 1024
78 Ga0070686_100798080 3300005544 Unclassified 761
79 Ga0070695_100029218 3300005545 Bacteria 3424
80 Ga0070695_100058181 3300005545 Bacteria 2499
81 Ga0070695_100096579 3300005545 Bacteria 1983
82 Ga0070696_100022817 3300005546 Bacteria 4254
83 Ga0070696_100577882 3300005546 Bacteria 903
84 Ga0070696_101489262 3300005546 Bacteria 579
85 Ga0070693_100265047 3300005547 Bacteria 1144
86 Ga0070693_100390267 3300005547 Bacteria 962
87 Ga0070693_100631113 3300005547 Bacteria 777
88 Ga0070693_100909059 3300005547 Bacteria 660
89 Ga0070704_100299855 3300005549 Bacteria 1338
90 Ga0070704_100350669 3300005549 Bacteria 1246
91 Ga0070704_100452208 3300005549 Bacteria 1106
92 Ga0070664_100057441 3300005564 Unclassified 3308
93 Ga0070664_101606759 3300005564 Bacteria 616
94 Ga0068857_102031596 3300005577 Unclassified 564
95 Ga0070702_100020642 3300005615 Unclassified 3454
96 Ga0070702_100031826 3300005615 Bacteria 2889
97 Ga0070702_100038532 3300005615 Bacteria 2662
98 Ga0070702_100080188 3300005615 Bacteria 1952
99 Ga0070702_100186990 3300005615 Bacteria 1360
100 Ga0070702_100478092 3300005615 Bacteria 910
101 Ga0070702_100742505 3300005615 Bacteria 753
102 Ga0070702_101672682 3300005615 Bacteria 528
103 Ga0068852_100554875 3300005616 Bacteria 1149
104 Ga0068852_101266976 3300005616 Bacteria 759
105 Ga0068859_100015693 3300005617 Bacteria 7611
106 Ga0068859_100021693 3300005617 Bacteria 6445
107 Ga0068859_100028956 3300005617 Bacteria 5556
108 Ga0068859_100036067 3300005617 Bacteria 4963
109 Ga0068859_100054640 3300005617 Bacteria 4017
110 Ga0068859_100116494 3300005617 Bacteria 2737
111 Ga0068859_100133908 3300005617 Bacteria 2550
112 Ga0068859_100372475 3300005617 Unclassified 1524
113 Ga0068859_100377190 3300005617 Bacteria 1514
114 Ga0068859_100448118 3300005617 Bacteria 1387
115 Ga0068859_100921703 3300005617 Unclassified 958
116 Ga0068859_100924154 3300005617 Bacteria 956
117 Ga0068859_101175797 3300005617 Bacteria 844
118 Ga0068859_101803399 3300005617 Bacteria 676
119 Ga0068864_100363150 3300005618 Bacteria 1369
120 Ga0068864_100456098 3300005618 Unclassified 1223
121 Ga0068864_100748057 3300005618 Bacteria 958
122 Ga0068864_101081260 3300005618 Bacteria 798
123 Ga0068864_101186540 3300005618 Bacteria 762
124 Ga0068864_101454532 3300005618 Unclassified 688
125 Ga0068866_10221084 3300005718 Bacteria 1143
126 Ga0068861_100171810 3300005719 Unclassified 1797
127 Ga0068851_10010914 3300005834 Bacteria 4248
128 Ga0068863_100153261 3300005841 Bacteria 2206
129 Ga0068863_100439186 3300005841 Bacteria 1280
130 Ga0068863_100819137 3300005841 Bacteria 929
131 Ga0068863_101272091 3300005841 Bacteria 742
132 Ga0068858_100040645 3300005842 Bacteria 4313
133 Ga0068858_100046594 3300005842 Bacteria 4018
134 Ga0068858_100100001 3300005842 Bacteria 2704
135 Ga0068858_100156078 3300005842 Bacteria 2147
136 Ga0068858_100603591 3300005842 Bacteria 1065
137 Ga0068858_100788129 3300005842 Unclassified 927
138 Ga0068858_101046530 3300005842 Bacteria 800
139 Ga0068860_100058363 3300005843 Bacteria 3669
140 Ga0068860_100070982 3300005843 Bacteria 3311
141 Ga0068860_100250272 3300005843 Bacteria 1725
142 Ga0068860_101047208 3300005843 Bacteria 834
143 Ga0068862_100046888 3300005844 Bacteria 3687
144 Ga0081539_10005208 3300005985 Bacteria 13481
145 Ga0097621_100024928 3300006237 Bacteria 4677
146 Ga0097621_100153750 3300006237 Bacteria 1974
147 Ga0097621_100156281 3300006237 Unclassified 1957
148 Ga0068871_100009511 3300006358 Bacteria 7050
149 Ga0068871_100209868 3300006358 Bacteria 1684
150 Ga0075428_100490719 3300006844 Unclassified 1314
151 Ga0075428_100610285 3300006844 Bacteria 1165
152 Ga0075428_101532565 3300006844 Unclassified 698
153 Ga0075430_100028706 3300006846 Unclassified 4724
154 Ga0075431_100200035 3300006847 Bacteria 2044
155 Ga0075431_100847164 3300006847 Bacteria 886
156 Ga0075431_101645402 3300006847 Bacteria 599
157 Ga0075433_10050389 3300006852 Bacteria 3625
158 Ga0075434_100046399 3300006871 Bacteria 4312
159 Ga0075429_100799755 3300006880 Bacteria 826
160 Ga0075429_100999457 3300006880 Unclassified 731
161 Ga0068865_101003831 3300006881 Unclassified 731
162 Ga0097620_100015692 3300006931 Bacteria 7611
163 Ga0097620_100021693 3300006931 Bacteria 6445
164 Ga0097620_100028956 3300006931 Bacteria 5556
165 Ga0097620_100036065 3300006931 Bacteria 4963
166 Ga0097620_100054642 3300006931 Bacteria 4017
167 Ga0097620_100116486 3300006931 Bacteria 2737
168 Ga0097620_100133901 3300006931 Bacteria 2550
169 Ga0097620_100372456 3300006931 Unclassified 1524
170 Ga0097620_100377171 3300006931 Bacteria 1514
171 Ga0097620_100448068 3300006931 Bacteria 1387
172 Ga0097620_100921677 3300006931 Unclassified 958
173 Ga0097620_100924155 3300006931 Bacteria 956
174 Ga0097620_101175793 3300006931 Bacteria 844
175 Ga0097620_101803271 3300006931 Bacteria 676
176 Ga0075435_100005606 3300007076 Bacteria 8791
177 Ga0075435_100425634 3300007076 Bacteria 1144
178 Ga0099794_10173630 3300007265 Bacteria 1099
179 Ga0105251_10116382 3300009011 Unclassified 1215
180 Ga0105240_11118400 3300009093 Bacteria 837
181 Ga0105240_11973560 3300009093 Bacteria 607
182 Ga0111539_10280648 3300009094 Bacteria 1938
183 Ga0105245_10260982 3300009098 Bacteria 1686
184 Ga0105247_10017819 3300009101 Unclassified 4259
185 Ga0105247_10032074 3300009101 Bacteria 3191
186 Ga0105247_10300185 3300009101 Bacteria 1114
187 Ga0114129_10001658 3300009147 Bacteria 30299
188 Ga0114129_10748866 3300009147 Bacteria 1251
189 Ga0114129_11143310 3300009147 Unclassified 972
190 Ga0105243_10142104 3300009148 Bacteria 2049
191 Ga0105243_12065758 3300009148 Unclassified 605
192 Ga0105241_10040080 3300009174 Bacteria 3535
193 Ga0105241_10454239 3300009174 Bacteria 1134
194 Ga0105241_10482339 3300009174 Unclassified 1102
195 Ga0105241_10890873 3300009174 Bacteria 826
196 Ga0105241_11223532 3300009174 Bacteria 712
197 Ga0105241_11540772 3300009174 Unclassified 641
198 Ga0105242_10677691 3300009176 Bacteria 1006
199 Ga0105242_10780298 3300009176 Bacteria 944
200 Ga0105248_10096509 3300009177 Unclassified 3330
201 Ga0105248_10130939 3300009177 Unclassified 2830
202 Ga0105248_10290096 3300009177 Bacteria 1842
203 Ga0105248_10344203 3300009177 Unclassified 1678
204 Ga0105237_10001408 3300009545 Bacteria 31791
205 Ga0105237_10158563 3300009545 Unclassified 2260
206 Ga0105237_10302300 3300009545 Bacteria 1603
207 Ga0105237_11424931 3300009545 Bacteria 699
208 Ga0105238_10007668 3300009551 Bacteria 10796
209 Ga0105238_10032185 3300009551 Bacteria 5336
210 Ga0105238_10267792 3300009551 Bacteria 1689
211 Ga0105249_10336765 3300009553 Unclassified 1524
212 Ga0105249_10947764 3300009553 Bacteria 929
213 Ga0105249_11165885 3300009553 Bacteria 841
214 Ga0105239_10288471 3300010375 Unclassified 1848
215 Ga0105239_10392395 3300010375 Bacteria 1570
216 Ga0105246_11644239 3300011119 Bacteria 608
217 Ga0157373_10124846 3300013100 Bacteria 1810
218 Ga0157373_10248924 3300013100 Bacteria 1257
219 Ga0157373_11043508 3300013100 Bacteria 611
220 Ga0157371_10404897 3300013102 Unclassified 999
221 Ga0157371_10715950 3300013102 Unclassified 750
222 Ga0157370_10135637 3300013104 Bacteria 2294
223 Ga0157374_11359251 3300013296 Bacteria 733
224 Ga0157378_10547008 3300013297 Unclassified 1163
225 Ga0163162_10235048 3300013306 Unclassified 1963
226 Ga0163162_10562252 3300013306 Bacteria 1268
227 Ga0163162_11300546 3300013306 Unclassified 826
228 Ga0163162_11407529 3300013306 Unclassified 793
229 Ga0163162_12886717 3300013306 Unclassified 553
230 Ga0157372_11710830 3300013307 Bacteria 724
231 Ga0157375_10090825 3300013308 Bacteria 3114
232 Ga0157375_10467647 3300013308 Unclassified 1426
233 Ga0157375_13445177 3300013308 Unclassified 527
234 Ga0163163_10000208 3300014325 Bacteria 60820
235 Ga0163163_10541162 3300014325 Bacteria 1227
236 Ga0157380_10020258 3300014326 Bacteria 4971
237 Ga0157380_10539220 3300014326 Bacteria 1142
238 Ga0157380_11725552 3300014326 Bacteria 684
239 Ga0157377_10066935 3300014745 Bacteria 2067
240 Ga0157377_10788794 3300014745 Unclassified 699
241 Ga0157377_11018552 3300014745 Bacteria 628
242 Ga0157379_10186244 3300014968 Bacteria 1876
243 Ga0157379_10451850 3300014968 Bacteria 1186
244 Ga0157379_11196625 3300014968 Bacteria 731
245 Ga0209646_1000091 3300025246 Bacteria 188727
246 Ga0209026_1000466 3300025250 Bacteria 31172
247 Ga0209129_1061127 3300025258 Bacteria 557
248 Ga0209758_1012064 3300025297 Bacteria 4897
249 Ga0207426_1000251 3300025302 Bacteria 117462
250 Ga0207656_10004481 3300025321 Bacteria 4884
251 Ga0207653_10005416 3300025885 Bacteria 3992
252 Ga0207710_10000506 3300025900 Bacteria 24282
253 Ga0207710_10272908 3300025900 Bacteria 850
254 Ga0207647_10067984 3300025904 Bacteria 2157
255 Ga0207647_10599519 3300025904 Unclassified 608
256 Ga0207643_10120525 3300025908 Unclassified 1553
257 Ga0207643_10309078 3300025908 Bacteria 985
258 Ga0207684_10000150 3300025910 Bacteria 121849
259 Ga0207654_10117757 3300025911 Bacteria 1663
260 Ga0207654_10341915 3300025911 Unclassified 1028
261 Ga0207654_10770988 3300025911 Bacteria 694
262 Ga0207707_10036797 3300025912 Unclassified 4278
263 Ga0207695_11314892 3300025913 Bacteria 603
264 Ga0207671_10015044 3300025914 Bacteria 6082
265 Ga0207671_10293236 3300025914 Unclassified 1284
266 Ga0207660_10038955 3300025917 Bacteria 3321
267 Ga0207662_10118388 3300025918 Bacteria 1659
268 Ga0207681_10161760 3300025923 Bacteria 1688
269 Ga0207694_10001815 3300025924 Bacteria 17786
270 Ga0207694_10081589 3300025924 Bacteria 2541
271 Ga0207650_10000011 3300025925 Bacteria 450115
272 Ga0207650_10348165 3300025925 Unclassified 1218
273 Ga0207659_10347476 3300025926 Bacteria 1230
274 Ga0207644_10468154 3300025931 Bacteria 1037
275 Ga0207690_10292974 3300025932 Bacteria 1271
276 Ga0207706_10045766 3300025933 Bacteria 3876
277 Ga0207686_10299317 3300025934 Bacteria 1194
278 Ga0207709_10091879 3300025935 Unclassified 1986
279 Ga0207709_10301057 3300025935 Bacteria 1192
280 Ga0207670_10192461 3300025936 Bacteria 1544
281 Ga0207704_10776532 3300025938 Unclassified 798
282 Ga0207665_10558279 3300025939 Bacteria 890
283 Ga0207691_10115537 3300025940 Bacteria 2383
284 Ga0207691_10706828 3300025940 Bacteria 850
285 Ga0207711_10057545 3300025941 Bacteria 3342
286 Ga0207711_10250441 3300025941 Bacteria 1626
287 Ga0207689_10013601 3300025942 Bacteria 6941
288 Ga0207689_10133750 3300025942 Unclassified 2041
289 Ga0207689_10432695 3300025942 Bacteria 1099
290 Ga0207689_10528388 3300025942 Bacteria 990
291 Ga0207679_10751467 3300025945 Bacteria 887
292 Ga0207651_10192560 3300025960 Unclassified 1628
293 Ga0207651_10348678 3300025960 Bacteria 1246
294 Ga0207651_10381662 3300025960 Unclassified 1194
295 Ga0207651_11332295 3300025960 Bacteria 646
296 Ga0207712_10321855 3300025961 Unclassified 1276
297 Ga0207712_10984208 3300025961 Bacteria 748
298 Ga0207640_10055965 3300025981 Bacteria 2587
299 Ga0207640_10333285 3300025981 Bacteria 1213
300 Ga0207640_10605429 3300025981 Bacteria 928
301 Ga0207640_11224269 3300025981 Bacteria 668
302 Ga0207658_10348633 3300025986 Bacteria 1289
303 Ga0207677_10972105 3300026023 Unclassified 769
304 Ga0207703_10038126 3300026035 Bacteria 3833
305 Ga0207703_10118915 3300026035 Bacteria 2266
306 Ga0207703_10425805 3300026035 Unclassified 1236
307 Ga0207703_10596792 3300026035 Bacteria 1044
308 Ga0207703_10803121 3300026035 Unclassified 898
309 Ga0207703_12186575 3300026035 Unclassified 529
310 Ga0207639_10096279 3300026041 Bacteria 2381
311 Ga0207639_10529395 3300026041 Bacteria 1080
312 Ga0207708_10006548 3300026075 Bacteria 8620
313 Ga0207708_10038642 3300026075 Bacteria 3635
314 Ga0207708_10115446 3300026075 Bacteria 2088
315 Ga0207708_10154886 3300026075 Bacteria 1807
316 Ga0207708_10714468 3300026075 Bacteria 857
317 Ga0207708_11075775 3300026075 Unclassified 701
318 Ga0207641_10136401 3300026088 Bacteria 2209
319 Ga0207641_10382452 3300026088 Bacteria 1348
320 Ga0207648_10473145 3300026089 Bacteria 1143
321 Ga0207676_10624650 3300026095 Bacteria 1037
322 Ga0207676_10813933 3300026095 Unclassified 912
323 Ga0207676_11380893 3300026095 Bacteria 700
324 Ga0207676_12076245 3300026095 Bacteria 567
325 Ga0207676_12497665 3300026095 Unclassified 513
326 Ga0207674_10149474 3300026116 Bacteria 2293
327 Ga0207674_10739363 3300026116 Bacteria 949
328 Ga0207675_100222580 3300026118 Unclassified 1818
329 Ga0207683_10220819 3300026121 Bacteria 1727
330 Ga0209281_1000372 3300027111 Bacteria 72453
331 Ga0209588_1091128 3300027671 Bacteria 982
332 Ga0268265_10265115 3300028380 Bacteria 1529
333 Ga0268265_10835176 3300028380 Unclassified 900
334 Ga0268264_10027314 3300028381 Bacteria 4662
335 Ga0268264_10109302 3300028381 Bacteria 2419
336 Ga0268264_10201880 3300028381 Bacteria 1819
337 Ga0268264_10567376 3300028381 Bacteria 1115
338 Ga0268264_11419229 3300028381 Bacteria 705
339 Ga0314311_1085357 3300030733 Unclassified 568
340 Ga0307410_10486729 3300031852 Bacteria 1013
341 Ga0307406_11017620 3300031901 Unclassified 711
342 Ga0307412_10247507 3300031911 Bacteria 1382
343 Ga0307409_100248353 3300031995 Unclassified 1625
344 Ga0307416_101204872 3300032002 Unclassified 863
345 Ga0307414_10490504 3300032004 Unclassified 1085
346 Ga0307411_10491628 3300032005 Unclassified 1035
347 Ga0307415_100152087 3300032126 Unclassified 1782
348 Ga0373949_0007412 3300035090 Bacteria 2402
349 Ga0373933_1046107 3300035724 Bacteria 538
350 Ga0395898_0422142 3300037466 Bacteria 1271
351 Ga0395901_1143151 3300038443 Bacteria 747
352 Ga0436365_1154153 3300039437 Unclassified 1188
353 Ga0436362_0062455 3300039453 Bacteria 663
354 Ga0453683_0067863 3300044673 Bacteria 2229
355 Ga0453684_0689000 3300044712 Unclassified 1111
356 Ga0453684_1150180 3300044712 Bacteria 817
357 Ga0451576_0536556 3300045051 Unclassified 1229
358 Ga0451576_0891724 3300045051 Bacteria 933
359 Ga0451576_1359782 3300045051 Bacteria 740
360 Ga0495592_0389731 3300046454 Bacteria 885
361 Ga0495651_0103658 3300046462 Bacteria 2113
362 Ga0495653_0218291 3300046463 Bacteria 1283
363 Ga0495662_0056695 3300046476 Bacteria 1892
364 Ga0495664_0431393 3300046477 Bacteria 790
365 Ga0495608_0129224 3300046511 Bacteria 1617
366 Ga0495630_0006722 3300046517 Bacteria 8194
367 Ga0495652_0049782 3300046529 Bacteria 3585
368 Ga0495586_0240285 3300046535 Bacteria 1032
369 Ga0495586_0388294 3300046535 Bacteria 803
370 Ga0495587_0175620 3300046536 Bacteria 1216
371 Ga0495598_0066542 3300046537 Unclassified 1124
372 Ga0495667_0005947 3300046559 Bacteria 8256
373 Ga0495657_0022249 3300046675 Bacteria 4545
374 Ga0495646_0032311 3300046680 Bacteria 3257
375 Ga0495600_0034748 3300046809 Bacteria 3273
376 Ga0495675_0005460 3300047444 Bacteria 7754
377 Ga0495684_0247616 3300047471 Bacteria 1297
378 Ga0495593_0076229 3300047673 Bacteria 1738
379 Ga0495602_0038357 3300048088 Bacteria 4431
380 Ga0496106_0115099 3300048909 Bacteria 2097
381 Ga0496107_0078346 3300048910 Bacteria 2408
382 Ga0496107_0433522 3300048910 Bacteria 977
383 Ga0496112_0807322 3300048915 Unclassified 863
384 Ga0496112_0832712 3300048915 Bacteria 847
385 Ga0496113_0414468 3300048916 Bacteria 1082
386 Ga0496113_1397266 3300048916 Unclassified 542
387 Ga0496124_0395386 3300048927 Bacteria 961
388 Ga0496126_0007543 3300048929 Bacteria 11904
389 Ga0501292_028012 3300049515 Unclassified 936
390 Ga0501295_094049 3300049518 Unclassified 696
391 Ga0501296_000412 3300049519 Bacteria 4204
392 Ga0501298_002527 3300049521 Bacteria 2771
393 Ga0501198_015348 3300049649 Bacteria 1175
394 Ga0501202_004541 3300049652 Unclassified 2431
395 Ga0501208_013178 3300049655 Unclassified 1230
396 Ga0501216_022828 3300049660 Unclassified 1109
397 Ga0501217_017751 3300049661 Bacteria 1644
398 Ga0501233_044051 3300049668 Unclassified 1059
399 Ga0501235_009612 3300049669 Bacteria 2113
400 Ga0501225_0029124 3300049705 Bacteria 1517
401 Ga0501234_003445 3300049707 Bacteria 2487
402 Ga0501268_071331 3300049765 Unclassified 703
403 Ga0501271_012872 3300049768 Unclassified 911
404 nmdc:mga05p37_1080919_c1 3300050507 Unclassified 842
405 nmdc:mga05p37_5202_c1 3300050507 Bacteria 15268
406 nmdc:mga05p37_696689_c1 3300050507 Bacteria 1129
407 nmdc:mga09592_123363_c1 3300050508 Bacteria 2226
408 nmdc:mga0qj67_34083_c1 3300050509 Bacteria 3976
409 nmdc:mga06r32_182415_c1 3300050510 Bacteria 2085
410 nmdc:mga0n895_1006327_c1 3300050512 Unclassified 814
411 nmdc:mga0n895_31788_c1 3300050512 Bacteria 5058
412 nmdc:mga0rr50_835538_c1 3300050513 Bacteria 786
413 nmdc:mga0a205_1011021_c1 3300050515 Unclassified 678
414 nmdc:mga0a205_52442_c1 3300050515 Bacteria 3936
415 Ga0500652_061750 3300053131 Unclassified 1543
416 Ga0500568_0055308 3300053139 Bacteria 1549
417 Ga0500573_0001072 3300053140 Bacteria 12663
418 Ga0590077_089598 3300059426 Bacteria 713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005543 Ga0070672_100527239 Ga0070672_1005272391 131
2 3300025940 Ga0207691_10706828 Ga0207691_107068281 134
3 3300006847 Ga0075431_100847164 Ga0075431_1008471641 135
4 3300030733 Ga0314311_1085357 Ga0314311_10853571 135
5 3300050508 nmdc:mga09592_123363_c1 nmdc:mga09592_123363_c1_1681_2106 135
6 iso_pu_bacteria 2738541284 2738764304 135
7 3300035724 Ga0373933_1046107 Ga0373933_1046107_71_481 136
8 3300044673 Ga0453683_0067863 Ga0453683_0067863_1156_1566 136
9 3300044712 Ga0453684_0689000 Ga0453684_0689000_348_758 136
10 3300044712 Ga0453684_1150180 Ga0453684_1150180_182_592 136
11 3300045051 Ga0451576_0536556 Ga0451576_0536556_158_568 136
12 3300046454 Ga0495592_0389731 Ga0495592_0389731_445_855 136
13 3300005343 Ga0070687_100248019 Ga0070687_1002480192 137
14 3300005617 Ga0068859_100921703 Ga0068859_1009217031 137
15 3300006931 Ga0097620_100921677 Ga0097620_1009216772 137
16 3300009093 Ga0105240_11973560 Ga0105240_119735601 137
17 3300009553 Ga0105249_10947764 Ga0105249_109477642 137
18 3300025913 Ga0207695_11314892 Ga0207695_113148921 137
19 3300025945 Ga0207679_10751467 Ga0207679_107514672 137
20 3300026118 Ga0207675_100222580 Ga0207675_1002225801 137
21 3300005353 Ga0070669_101018575 Ga0070669_1010185752 138
22 3300005615 Ga0070702_101672682 Ga0070702_1016726822 138
23 3300005617 Ga0068859_101803399 Ga0068859_1018033992 138
24 3300006844 Ga0075428_100490719 Ga0075428_1004907192 138
25 3300006852 Ga0075433_10050389 Ga0075433_100503892 138
26 3300006871 Ga0075434_100046399 Ga0075434_1000463995 138
27 3300006880 Ga0075429_100999457 Ga0075429_1009994572 138
28 3300006931 Ga0097620_101803271 Ga0097620_1018032712 138
29 3300007076 Ga0075435_100005606 Ga0075435_1000056064 138
30 3300009147 Ga0114129_10001658 Ga0114129_1000165817 138
31 3300028381 Ga0268264_11419229 Ga0268264_114192292 138
32 3300039437 Ga0436365_1154153 Ga0436365_1154153_390_812 138
33 3300046462 Ga0495651_0103658 Ga0495651_0103658_345_761 138
34 3300046463 Ga0495653_0218291 Ga0495653_0218291_68_484 138
35 3300046476 Ga0495662_0056695 Ga0495662_0056695_656_1072 138
36 3300046477 Ga0495664_0431393 Ga0495664_0431393_293_709 138
37 3300046511 Ga0495608_0129224 Ga0495608_0129224_868_1284 138
38 3300046517 Ga0495630_0006722 Ga0495630_0006722_193_609 138
39 3300046529 Ga0495652_0049782 Ga0495652_0049782_1774_2190 138
40 3300046535 Ga0495586_0240285 Ga0495586_0240285_248_664 138
41 3300046536 Ga0495587_0175620 Ga0495587_0175620_656_1072 138
42 3300046559 Ga0495667_0005947 Ga0495667_0005947_999_1415 138
43 3300046675 Ga0495657_0022249 Ga0495657_0022249_581_997 138
44 3300046680 Ga0495646_0032311 Ga0495646_0032311_781_1197 138
45 3300046809 Ga0495600_0034748 Ga0495600_0034748_2098_2514 138
46 3300047444 Ga0495675_0005460 Ga0495675_0005460_1238_1654 138
47 3300047471 Ga0495684_0247616 Ga0495684_0247616_664_1080 138
48 3300047673 Ga0495593_0076229 Ga0495593_0076229_656_1072 138
49 3300048088 Ga0495602_0038357 Ga0495602_0038357_647_1063 138
50 3300050507 nmdc:mga05p37_5202_c1 nmdc:mga05p37_5202_c1_5936_6352 138
51 3300050512 nmdc:mga0n895_31788_c1 nmdc:mga0n895_31788_c1_1621_2037 138
52 3300050515 nmdc:mga0a205_52442_c1 nmdc:mga0a205_52442_c1_3418_3834 138
53 3300005331 Ga0070670_100161324 Ga0070670_1001613242 139
54 3300005334 Ga0068869_100822622 Ga0068869_1008226221 139
55 3300005340 Ga0070689_100182512 Ga0070689_1001825121 139
56 3300005436 Ga0070713_100539236 Ga0070713_1005392361 139
57 3300005617 Ga0068859_100021693 Ga0068859_1000216938 139
58 3300005618 Ga0068864_100363150 Ga0068864_1003631501 139
59 3300006931 Ga0097620_100021693 Ga0097620_1000216932 139
60 3300007076 Ga0075435_100425634 Ga0075435_1004256342 139
61 3300007265 Ga0099794_10173630 Ga0099794_101736302 139
62 3300009545 Ga0105237_11424931 Ga0105237_114249311 139
63 3300025925 Ga0207650_10348165 Ga0207650_103481652 139
64 3300025926 Ga0207659_10347476 Ga0207659_103474762 139
65 3300025942 Ga0207689_10432695 Ga0207689_104326952 139
66 3300027671 Ga0209588_1091128 Ga0209588_10911282 139
67 3300039453 Ga0436362_0062455 Ga0436362_0062455_203_631 139
68 3300045051 Ga0451576_1359782 Ga0451576_1359782_212_649 139
69 3300050513 nmdc:mga0rr50_835538_c1 nmdc:mga0rr50_835538_c1_337_774 139
70 3300053140 Ga0500573_0001072 Ga0500573_0001072_3441_3860 139
71 3300005290 Ga0065712_10023794 Ga0065712_100237943 140
72 3300005293 Ga0065715_10020401 Ga0065715_100204012 140
73 3300005441 Ga0070700_100923292 Ga0070700_1009232921 140
74 3300005466 Ga0070685_10513295 Ga0070685_105132952 140
75 3300005615 Ga0070702_100186990 Ga0070702_1001869902 140
76 3300005616 Ga0068852_101266976 Ga0068852_1012669761 140
77 3300005617 Ga0068859_100054640 Ga0068859_1000546402 140
78 3300005842 Ga0068858_100046594 Ga0068858_1000465942 140
79 3300006931 Ga0097620_100054642 Ga0097620_1000546426 140
80 3300009101 Ga0105247_10032074 Ga0105247_100320744 140
81 3300009174 Ga0105241_11223532 Ga0105241_112235322 140
82 3300013306 Ga0163162_10562252 Ga0163162_105622521 140
83 3300013307 Ga0157372_11710830 Ga0157372_117108301 140
84 3300014968 Ga0157379_11196625 Ga0157379_111966251 140
85 3300025900 Ga0207710_10272908 Ga0207710_102729082 140
86 3300025918 Ga0207662_10118388 Ga0207662_101183882 140
87 3300025960 Ga0207651_10348678 Ga0207651_103486782 140
88 3300026035 Ga0207703_10038126 Ga0207703_100381266 140
89 3300026075 Ga0207708_10154886 Ga0207708_101548862 140
90 3300027111 Ga0209281_1000372 Ga0209281_100037253 140
91 3300046535 Ga0495586_0388294 Ga0495586_0388294_197_619 140
92 3300048916 Ga0496113_1397266 Ga0496113_1397266_32_454 140
93 3300048927 Ga0496124_0395386 Ga0496124_0395386_289_711 140
94 3300048929 Ga0496126_0007543 Ga0496126_0007543_7281_7703 140
95 3300002738 JGI25154J39366_1000080 JGI25154J39366_100008047 141
96 3300002741 JGI25157J39369_1012474 JGI25157J39369_10124742 141
97 3300003215 JGI25153J46596_10010315 JGI25153J46596_100103157 141
98 3300003354 JGI25160J50197_1021418 JGI25160J50197_10214182 141
99 3300005467 Ga0070706_100002023 Ga0070706_10000202310 141
100 3300005471 Ga0070698_100612748 Ga0070698_1006127482 141
101 3300005617 Ga0068859_100448118 Ga0068859_1004481183 141
102 3300005841 Ga0068863_101272091 Ga0068863_1012720912 141
103 3300006931 Ga0097620_100448068 Ga0097620_1004480681 141
104 3300014745 Ga0157377_10066935 Ga0157377_100669352 141
105 3300025246 Ga0209646_1000091 Ga0209646_100009119 141
106 3300025250 Ga0209026_1000466 Ga0209026_100046624 141
107 3300025258 Ga0209129_1061127 Ga0209129_10611271 141
108 3300025297 Ga0209758_1012064 Ga0209758_10120647 141
109 3300025302 Ga0207426_1000251 Ga0207426_100025138 141
110 3300025910 Ga0207684_10000150 Ga0207684_1000015097 141
111 3300037466 Ga0395898_0422142 Ga0395898_0422142_712_1137 141
112 3300038443 Ga0395901_1143151 Ga0395901_1143151_46_471 141
113 3300046537 Ga0495598_0066542 Ga0495598_0066542_225_650 141
114 3300050507 nmdc:mga05p37_696689_c1 nmdc:mga05p37_696689_c1_650_1075 141
115 3300050515 nmdc:mga0a205_1011021_c1 nmdc:mga0a205_1011021_c1_71_496 141
116 3300053131 Ga0500652_061750 Ga0500652_061750_896_1321 141
117 3300053139 Ga0500568_0055308 Ga0500568_0055308_754_1179 141
118 3300005290 Ga0065712_10012125 Ga0065712_100121253 142
119 3300005290 Ga0065712_10016741 Ga0065712_100167412 142
120 3300005336 Ga0070680_100005011 Ga0070680_1000050112 142
121 3300005340 Ga0070689_102090052 Ga0070689_1020900521 142
122 3300005343 Ga0070687_100192167 Ga0070687_1001921673 142
123 3300005354 Ga0070675_101024534 Ga0070675_1010245341 142
124 3300005364 Ga0070673_100187931 Ga0070673_1001879314 142
125 3300005364 Ga0070673_100445563 Ga0070673_1004455632 142
126 3300005438 Ga0070701_10068911 Ga0070701_100689112 142
127 3300005438 Ga0070701_10978008 Ga0070701_109780081 142
128 3300005444 Ga0070694_100643962 Ga0070694_1006439622 142
129 3300005456 Ga0070678_100275679 Ga0070678_1002756792 142
130 3300005539 Ga0068853_100573958 Ga0068853_1005739581 142
131 3300005545 Ga0070695_100029218 Ga0070695_1000292182 142
132 3300005546 Ga0070696_100022817 Ga0070696_1000228172 142
133 3300005546 Ga0070696_101489262 Ga0070696_1014892621 142
134 3300005549 Ga0070704_100350669 Ga0070704_1003506692 142
135 3300005617 Ga0068859_100015693 Ga0068859_1000156936 142
136 3300005617 Ga0068859_100036067 Ga0068859_1000360674 142
137 3300005617 Ga0068859_100377190 Ga0068859_1003771902 142
138 3300005617 Ga0068859_100924154 Ga0068859_1009241542 142
139 3300005718 Ga0068866_10221084 Ga0068866_102210842 142
140 3300005842 Ga0068858_100040645 Ga0068858_1000406452 142
141 3300005844 Ga0068862_100046888 Ga0068862_1000468883 142
142 3300006237 Ga0097621_100156281 Ga0097621_1001562812 142
143 3300006880 Ga0075429_100799755 Ga0075429_1007997552 142
144 3300006931 Ga0097620_100015692 Ga0097620_1000156926 142
145 3300006931 Ga0097620_100036065 Ga0097620_1000360654 142
146 3300006931 Ga0097620_100377171 Ga0097620_1003771712 142
147 3300006931 Ga0097620_100924155 Ga0097620_1009241552 142
148 3300009094 Ga0111539_10280648 Ga0111539_102806483 142
149 3300009101 Ga0105247_10300185 Ga0105247_103001852 142
150 3300009176 Ga0105242_10780298 Ga0105242_107802982 142
151 3300009177 Ga0105248_10096509 Ga0105248_100965092 142
152 3300009177 Ga0105248_10130939 Ga0105248_101309392 142
153 3300009553 Ga0105249_10336765 Ga0105249_103367653 142
154 3300010375 Ga0105239_10288471 Ga0105239_102884712 142
155 3300013104 Ga0157370_10135637 Ga0157370_101356372 142
156 3300013306 Ga0163162_11300546 Ga0163162_113005461 142
157 3300013308 Ga0157375_10467647 Ga0157375_104676472 142
158 3300014326 Ga0157380_10020258 Ga0157380_100202581 142
159 3300014326 Ga0157380_10539220 Ga0157380_105392202 142
160 3300014745 Ga0157377_10788794 Ga0157377_107887941 142
161 3300025917 Ga0207660_10038955 Ga0207660_100389553 142
162 3300025933 Ga0207706_10045766 Ga0207706_100457664 142
163 3300025941 Ga0207711_10057545 Ga0207711_100575455 142
164 3300025941 Ga0207711_10250441 Ga0207711_102504412 142
165 3300025942 Ga0207689_10133750 Ga0207689_101337502 142
166 3300025960 Ga0207651_10192560 Ga0207651_101925602 142
167 3300025960 Ga0207651_10381662 Ga0207651_103816622 142
168 3300025961 Ga0207712_10321855 Ga0207712_103218551 142
169 3300026023 Ga0207677_10972105 Ga0207677_109721051 142
170 3300026035 Ga0207703_10425805 Ga0207703_104258052 142
171 3300026075 Ga0207708_10115446 Ga0207708_101154462 142
172 3300026121 Ga0207683_10220819 Ga0207683_102208192 142
173 3300028380 Ga0268265_10265115 Ga0268265_102651152 142
174 3300035090 Ga0373949_0007412 Ga0373949_0007412_1868_2296 142
175 3300003320 rootH2_10121869 rootH2_101218693 143
176 3300005290 Ga0065712_10008444 Ga0065712_100084442 143
177 3300005293 Ga0065715_10011089 Ga0065715_100110892 143
178 3300005293 Ga0065715_10330812 Ga0065715_103308122 143
179 3300005295 Ga0065707_10119647 Ga0065707_101196472 143
180 3300005330 Ga0070690_100819437 Ga0070690_1008194372 143
181 3300005334 Ga0068869_100085533 Ga0068869_1000855332 143
182 3300005336 Ga0070680_100530475 Ga0070680_1005304751 143
183 3300005337 Ga0070682_100081773 Ga0070682_1000817732 143
184 3300005337 Ga0070682_101377255 Ga0070682_1013772552 143
185 3300005345 Ga0070692_10128004 Ga0070692_101280042 143
186 3300005353 Ga0070669_100104068 Ga0070669_1001040682 143
187 3300005356 Ga0070674_101661510 Ga0070674_1016615101 143
188 3300005364 Ga0070673_100527636 Ga0070673_1005276361 143
189 3300005365 Ga0070688_101485209 Ga0070688_1014852091 143
190 3300005366 Ga0070659_100337648 Ga0070659_1003376482 143
191 3300005367 Ga0070667_101779482 Ga0070667_1017794821 143
192 3300005406 Ga0070703_10084650 Ga0070703_100846501 143
193 3300005438 Ga0070701_10008248 Ga0070701_100082483 143
194 3300005440 Ga0070705_100040560 Ga0070705_1000405603 143
195 3300005440 Ga0070705_100370854 Ga0070705_1003708542 143
196 3300005440 Ga0070705_100512452 Ga0070705_1005124522 143
197 3300005441 Ga0070700_100021789 Ga0070700_1000217893 143
198 3300005441 Ga0070700_100700036 Ga0070700_1007000362 143
199 3300005444 Ga0070694_100078426 Ga0070694_1000784262 143
200 3300005444 Ga0070694_100505900 Ga0070694_1005059002 143
201 3300005457 Ga0070662_101146133 Ga0070662_1011461332 143
202 3300005458 Ga0070681_10130341 Ga0070681_101303415 143
203 3300005459 Ga0068867_100655254 Ga0068867_1006552542 143
204 3300005518 Ga0070699_100105058 Ga0070699_1001050583 143
205 3300005539 Ga0068853_100584350 Ga0068853_1005843502 143
206 3300005543 Ga0070672_100228183 Ga0070672_1002281834 143
207 3300005544 Ga0070686_100798080 Ga0070686_1007980801 143
208 3300005546 Ga0070696_100577882 Ga0070696_1005778822 143
209 3300005547 Ga0070693_100265047 Ga0070693_1002650472 143
210 3300005547 Ga0070693_100390267 Ga0070693_1003902672 143
211 3300005547 Ga0070693_100909059 Ga0070693_1009090591 143
212 3300005549 Ga0070704_100299855 Ga0070704_1002998551 143
213 3300005549 Ga0070704_100452208 Ga0070704_1004522082 143
214 3300005564 Ga0070664_100057441 Ga0070664_1000574412 143
215 3300005564 Ga0070664_101606759 Ga0070664_1016067592 143
216 3300005615 Ga0070702_100020642 Ga0070702_1000206425 143
217 3300005615 Ga0070702_100080188 Ga0070702_1000801882 143
218 3300005615 Ga0070702_100478092 Ga0070702_1004780922 143
219 3300005615 Ga0070702_100742505 Ga0070702_1007425052 143
220 3300005616 Ga0068852_100554875 Ga0068852_1005548751 143
221 3300005617 Ga0068859_100028956 Ga0068859_1000289562 143
222 3300005617 Ga0068859_100116494 Ga0068859_1001164941 143
223 3300005617 Ga0068859_100133908 Ga0068859_1001339082 143
224 3300005617 Ga0068859_100372475 Ga0068859_1003724751 143
225 3300005618 Ga0068864_100456098 Ga0068864_1004560982 143
226 3300005618 Ga0068864_100748057 Ga0068864_1007480572 143
227 3300005618 Ga0068864_101081260 Ga0068864_1010812602 143
228 3300005719 Ga0068861_100171810 Ga0068861_1001718103 143
229 3300005834 Ga0068851_10010914 Ga0068851_100109143 143
230 3300005841 Ga0068863_100153261 Ga0068863_1001532612 143
231 3300005841 Ga0068863_100819137 Ga0068863_1008191372 143
232 3300005842 Ga0068858_100100001 Ga0068858_1001000012 143
233 3300005842 Ga0068858_100156078 Ga0068858_1001560782 143
234 3300005842 Ga0068858_101046530 Ga0068858_1010465302 143
235 3300005843 Ga0068860_100058363 Ga0068860_1000583633 143
236 3300005843 Ga0068860_100070982 Ga0068860_1000709822 143
237 3300006881 Ga0068865_101003831 Ga0068865_1010038311 143
238 3300006931 Ga0097620_100028956 Ga0097620_1000289562 143
239 3300006931 Ga0097620_100116486 Ga0097620_1001164861 143
240 3300006931 Ga0097620_100133901 Ga0097620_1001339012 143
241 3300006931 Ga0097620_100372456 Ga0097620_1003724561 143
242 3300009011 Ga0105251_10116382 Ga0105251_101163822 143
243 3300009093 Ga0105240_11118400 Ga0105240_111184002 143
244 3300009098 Ga0105245_10260982 Ga0105245_102609822 143
245 3300009101 Ga0105247_10017819 Ga0105247_100178192 143
246 3300009148 Ga0105243_10142104 Ga0105243_101421042 143
247 3300009148 Ga0105243_12065758 Ga0105243_120657581 143
248 3300009174 Ga0105241_10454239 Ga0105241_104542391 143
249 3300009174 Ga0105241_10482339 Ga0105241_104823391 143
250 3300009174 Ga0105241_10890873 Ga0105241_108908731 143
251 3300009176 Ga0105242_10677691 Ga0105242_106776912 143
252 3300009177 Ga0105248_10344203 Ga0105248_103442032 143
253 3300009545 Ga0105237_10001408 Ga0105237_1000140828 143
254 3300009545 Ga0105237_10158563 Ga0105237_101585632 143
255 3300009545 Ga0105237_10302300 Ga0105237_103023002 143
256 3300009551 Ga0105238_10007668 Ga0105238_100076687 143
257 3300009553 Ga0105249_11165885 Ga0105249_111658851 143
258 3300010375 Ga0105239_10392395 Ga0105239_103923952 143
259 3300011119 Ga0105246_11644239 Ga0105246_116442392 143
260 3300013100 Ga0157373_10124846 Ga0157373_101248463 143
261 3300013100 Ga0157373_10248924 Ga0157373_102489242 143
262 3300013100 Ga0157373_11043508 Ga0157373_110435081 143
263 3300013102 Ga0157371_10404897 Ga0157371_104048972 143
264 3300013102 Ga0157371_10715950 Ga0157371_107159502 143
265 3300013296 Ga0157374_11359251 Ga0157374_113592512 143
266 3300013297 Ga0157378_10547008 Ga0157378_105470082 143
267 3300013306 Ga0163162_10235048 Ga0163162_102350482 143
268 3300013306 Ga0163162_11407529 Ga0163162_114075292 143
269 3300013308 Ga0157375_10090825 Ga0157375_100908255 143
270 3300013308 Ga0157375_13445177 Ga0157375_134451772 143
271 3300014325 Ga0163163_10541162 Ga0163163_105411622 143
272 3300014326 Ga0157380_11725552 Ga0157380_117255522 143
273 3300014745 Ga0157377_11018552 Ga0157377_110185522 143
274 3300014968 Ga0157379_10186244 Ga0157379_101862444 143
275 3300014968 Ga0157379_10451850 Ga0157379_104518502 143
276 3300025321 Ga0207656_10004481 Ga0207656_100044813 143
277 3300025885 Ga0207653_10005416 Ga0207653_100054161 143
278 3300025900 Ga0207710_10000506 Ga0207710_100005067 143
279 3300025904 Ga0207647_10067984 Ga0207647_100679843 143
280 3300025904 Ga0207647_10599519 Ga0207647_105995192 143
281 3300025908 Ga0207643_10120525 Ga0207643_101205253 143
282 3300025908 Ga0207643_10309078 Ga0207643_103090782 143
283 3300025911 Ga0207654_10341915 Ga0207654_103419152 143
284 3300025911 Ga0207654_10770988 Ga0207654_107709882 143
285 3300025912 Ga0207707_10036797 Ga0207707_100367975 143
286 3300025914 Ga0207671_10015044 Ga0207671_100150447 143
287 3300025914 Ga0207671_10293236 Ga0207671_102932362 143
288 3300025923 Ga0207681_10161760 Ga0207681_101617602 143
289 3300025924 Ga0207694_10001815 Ga0207694_100018157 143
290 3300025932 Ga0207690_10292974 Ga0207690_102929741 143
291 3300025934 Ga0207686_10299317 Ga0207686_102993172 143
292 3300025935 Ga0207709_10091879 Ga0207709_100918792 143
293 3300025935 Ga0207709_10301057 Ga0207709_103010572 143
294 3300025936 Ga0207670_10192461 Ga0207670_101924612 143
295 3300025940 Ga0207691_10115537 Ga0207691_101155372 143
296 3300025942 Ga0207689_10013601 Ga0207689_100136013 143
297 3300025960 Ga0207651_11332295 Ga0207651_113322951 143
298 3300025961 Ga0207712_10984208 Ga0207712_109842082 143
299 3300025981 Ga0207640_10055965 Ga0207640_100559652 143
300 3300025981 Ga0207640_10333285 Ga0207640_103332853 143
301 3300025981 Ga0207640_10605429 Ga0207640_106054292 143
302 3300025981 Ga0207640_11224269 Ga0207640_112242691 143
303 3300025986 Ga0207658_10348633 Ga0207658_103486332 143
304 3300026035 Ga0207703_10118915 Ga0207703_101189152 143
305 3300026035 Ga0207703_10803121 Ga0207703_108031212 143
306 3300026035 Ga0207703_12186575 Ga0207703_121865752 143
307 3300026041 Ga0207639_10529395 Ga0207639_105293951 143
308 3300026075 Ga0207708_10038642 Ga0207708_100386423 143
309 3300026075 Ga0207708_10714468 Ga0207708_107144682 143
310 3300026075 Ga0207708_11075775 Ga0207708_110757751 143
311 3300026088 Ga0207641_10136401 Ga0207641_101364013 143
312 3300026089 Ga0207648_10473145 Ga0207648_104731452 143
313 3300026095 Ga0207676_10624650 Ga0207676_106246501 143
314 3300026095 Ga0207676_10813933 Ga0207676_108139332 143
315 3300026095 Ga0207676_12076245 Ga0207676_120762452 143
316 3300026116 Ga0207674_10149474 Ga0207674_101494742 143
317 3300026116 Ga0207674_10739363 Ga0207674_107393632 143
318 3300028380 Ga0268265_10835176 Ga0268265_108351762 143
319 3300028381 Ga0268264_10027314 Ga0268264_100273144 143
320 3300028381 Ga0268264_10109302 Ga0268264_101093023 143
321 3300048909 Ga0496106_0115099 Ga0496106_0115099_456_887 143
322 3300048910 Ga0496107_0078346 Ga0496107_0078346_1918_2379 143
323 3300048910 Ga0496107_0433522 Ga0496107_0433522_253_684 143
324 3300048915 Ga0496112_0807322 Ga0496112_0807322_361_792 143
325 3300048915 Ga0496112_0832712 Ga0496112_0832712_367_798 143
326 3300048916 Ga0496113_0414468 Ga0496113_0414468_608_1039 143
327 3300059426 Ga0590077_089598 Ga0590077_089598_106_537 143
328 3300002459 JGI24751J29686_10000012 JGI24751J29686_1000001237 144
329 3300005290 Ga0065712_10025668 Ga0065712_100256683 144
330 3300005331 Ga0070670_100000174 Ga0070670_10000017413 144
331 3300005337 Ga0070682_100093552 Ga0070682_1000935522 144
332 3300005353 Ga0070669_101448081 Ga0070669_1014480811 144
333 3300005440 Ga0070705_100013974 Ga0070705_1000139743 144
334 3300005547 Ga0070693_100631113 Ga0070693_1006311132 144
335 3300005615 Ga0070702_100031826 Ga0070702_1000318261 144
336 3300005615 Ga0070702_100038532 Ga0070702_1000385324 144
337 3300005617 Ga0068859_101175797 Ga0068859_1011757971 144
338 3300005618 Ga0068864_101186540 Ga0068864_1011865402 144
339 3300005841 Ga0068863_100439186 Ga0068863_1004391862 144
340 3300005842 Ga0068858_100603591 Ga0068858_1006035912 144
341 3300005842 Ga0068858_100788129 Ga0068858_1007881292 144
342 3300005843 Ga0068860_100250272 Ga0068860_1002502722 144
343 3300006237 Ga0097621_100153750 Ga0097621_1001537502 144
344 3300006358 Ga0068871_100209868 Ga0068871_1002098682 144
345 3300006844 Ga0075428_100610285 Ga0075428_1006102852 144
346 3300006844 Ga0075428_101532565 Ga0075428_1015325652 144
347 3300006846 Ga0075430_100028706 Ga0075430_1000287065 144
348 3300006847 Ga0075431_100200035 Ga0075431_1002000352 144
349 3300006847 Ga0075431_101645402 Ga0075431_1016454021 144
350 3300006931 Ga0097620_101175793 Ga0097620_1011757931 144
351 3300009147 Ga0114129_10748866 Ga0114129_107488662 144
352 3300009147 Ga0114129_11143310 Ga0114129_111433101 144
353 3300009174 Ga0105241_10040080 Ga0105241_100400805 144
354 3300009177 Ga0105248_10290096 Ga0105248_102900962 144
355 3300009551 Ga0105238_10267792 Ga0105238_102677922 144
356 3300014325 Ga0163163_10000208 Ga0163163_1000020836 144
357 3300025911 Ga0207654_10117757 Ga0207654_101177572 144
358 3300025925 Ga0207650_10000011 Ga0207650_10000011262 144
359 3300025931 Ga0207644_10468154 Ga0207644_104681542 144
360 3300025938 Ga0207704_10776532 Ga0207704_107765321 144
361 3300025939 Ga0207665_10558279 Ga0207665_105582792 144
362 3300025942 Ga0207689_10528388 Ga0207689_105283882 144
363 3300026035 Ga0207703_10596792 Ga0207703_105967922 144
364 3300026041 Ga0207639_10096279 Ga0207639_100962792 144
365 3300026088 Ga0207641_10382452 Ga0207641_103824522 144
366 3300026095 Ga0207676_11380893 Ga0207676_113808932 144
367 3300028381 Ga0268264_10567376 Ga0268264_105673761 144
368 3300050507 nmdc:mga05p37_1080919_c1 nmdc:mga05p37_1080919_c1_370_804 144
369 3300050509 nmdc:mga0qj67_34083_c1 nmdc:mga0qj67_34083_c1_791_1225 144
370 3300050510 nmdc:mga06r32_182415_c1 nmdc:mga06r32_182415_c1_1324_1758 144
371 3300050512 nmdc:mga0n895_1006327_c1 nmdc:mga0n895_1006327_c1_258_692 144
372 3300003203 JGI25406J46586_10114835 JGI25406J46586_101148352 145
373 3300005434 Ga0070709_10612133 Ga0070709_106121332 145
374 3300005545 Ga0070695_100096579 Ga0070695_1000965794 145
375 3300005985 Ga0081539_10005208 Ga0081539_100052087 145
376 3300005618 Ga0068864_101454532 Ga0068864_1014545322 146
377 3300026095 Ga0207676_12497665 Ga0207676_124976651 146
378 3300031852 Ga0307410_10486729 Ga0307410_104867292 146
379 3300031901 Ga0307406_11017620 Ga0307406_110176202 146
380 3300031911 Ga0307412_10247507 Ga0307412_102475072 146
381 3300031995 Ga0307409_100248353 Ga0307409_1002483533 146
382 3300032004 Ga0307414_10490504 Ga0307414_104905042 146
383 3300032005 Ga0307411_10491628 Ga0307411_104916282 146
384 3300032126 Ga0307415_100152087 Ga0307415_1001520873 146
385 3300045051 Ga0451576_0891724 Ga0451576_0891724_51_491 146
386 3300049515 Ga0501292_028012 Ga0501292_028012_135_578 146
387 3300049518 Ga0501295_094049 Ga0501295_094049_218_661 146
388 3300049519 Ga0501296_000412 Ga0501296_000412_1857_2300 146
389 3300049521 Ga0501298_002527 Ga0501298_002527_1697_2140 146
390 3300049649 Ga0501198_015348 Ga0501198_015348_669_1112 146
391 3300049652 Ga0501202_004541 Ga0501202_004541_1218_1661 146
392 3300049655 Ga0501208_013178 Ga0501208_013178_155_598 146
393 3300049660 Ga0501216_022828 Ga0501216_022828_307_750 146
394 3300049661 Ga0501217_017751 Ga0501217_017751_946_1389 146
395 3300049668 Ga0501233_044051 Ga0501233_044051_475_918 146
396 3300049669 Ga0501235_009612 Ga0501235_009612_1633_2076 146
397 3300049705 Ga0501225_0029124 Ga0501225_0029124_408_851 146
398 3300049707 Ga0501234_003445 Ga0501234_003445_610_1053 146
399 3300049765 Ga0501268_071331 Ga0501268_071331_232_675 146
400 3300049768 Ga0501271_012872 Ga0501271_012872_141_584 146
401 2162886011 MRS1b_contig_9093553 MRS1b_0725.00000800 147
402 3300005288 Ga0065714_10064422 Ga0065714_10064422155 147
403 3300005290 Ga0065712_10067728 Ga0065712_1006772810 147
404 3300005293 Ga0065715_10091058 Ga0065715_100910582 147
405 3300005293 Ga0065715_10094314 Ga0065715_100943146 147
406 3300005366 Ga0070659_101848166 Ga0070659_1018481661 147
407 3300005441 Ga0070700_100031330 Ga0070700_1000313304 147
408 3300005545 Ga0070695_100058181 Ga0070695_1000581812 147
409 3300005577 Ga0068857_102031596 Ga0068857_1020315961 147
410 3300005843 Ga0068860_101047208 Ga0068860_1010472082 147
411 3300006237 Ga0097621_100024928 Ga0097621_1000249285 147
412 3300006358 Ga0068871_100009511 Ga0068871_1000095112 147
413 3300009174 Ga0105241_11540772 Ga0105241_115407721 147
414 3300009551 Ga0105238_10032185 Ga0105238_100321855 147
415 3300013306 Ga0163162_12886717 Ga0163162_128867172 147
416 3300025924 Ga0207694_10081589 Ga0207694_100815892 147
417 3300026075 Ga0207708_10006548 Ga0207708_100065482 147
418 3300028381 Ga0268264_10201880 Ga0268264_102018803 147
419 3300032002 Ga0307416_101204872 Ga0307416_1012048722 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

25

130

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7313 14 132
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6794 14 132
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6556 14 135
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5978 14 135
6xqw-assembly1.cif.gz_E crystal structure of malim03 fab in complex with pfmsp1-19 0.5329 56 78
ID Description Score Start End Superfamily
af_Q9VDT4_85_169_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8631 14 41 1.20.120.550
af_Q8IIW6_8_142_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7364 52 70 3.30.420.40
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.644 14 125 3.90.1150.200
af_Q8MM62_938_1073_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6193 107 140 2.60.120.10
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5815 14 125 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A7C4UNG3-F1-model_v4 DUF1801 domain-containing protein 0.9858 14 134
AF-A0A2G2LJT3-F1-model_v4 YdhG-like domain-containing protein 0.9839 5 136
AF-A0A363TCG9-F1-model_v4 YdhG-like domain-containing protein 0.9837 1 131
AF-A0A7V0UHD2-F1-model_v4 DUF1801 domain-containing protein 0.9835 1 136
AF-A0A842R5P8-F1-model_v4 DUF1801 domain-containing protein 0.9825 1 136

Feature Viewer

pLDDT pTM Quality
91.32 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map