F439494

General Info

Members Datasets Scaffolds Average Seq Length
419 221 838 345

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10040923|Ga0081455_100409233
Length 377
Sequence MLIVMKPSATASEIDAVVNVVEAVGFRAHPMPGATRTAIGITGNEGPIDGRRFENLPGVAEVIRVTKPYKLITLDLRPDKTVVRASDATIGGPELAIIAGPCAIESREQAFAIAKTVQQSGARFFRGCVWKPRTSPYTFQGLGDKGWEMMSAVREEFGLKIVTEAVEESHVDLIEKLGDMIQIGARNMQNFSLLKRAGRSRLPVLLKRGMAATLEEWLLAAEYIMAEGNYNVILCERGVRTFAQHTRNTLDLASVPAIRRISHLPVIVDPSHGTGTAYMVTPLARAGVAAGADGLMIEVHNQPELSLSDSAQALTPSQYLQLVAEVRAIHELVSCSHGPAGRPSIINEQSDRPQAGGYNCDEMDLTSGSAKHAAADR

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.58
Rhizosphere 95.23
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10040923 3300005937 Bacteria 4083
2 JGI25405J52794_10003102 3300003911 Bacteria 2892
3 JGI25405J52794_10003410 3300003911 Bacteria 2785
4 JGI25405J52794_10007156 3300003911 Bacteria 2053
5 Ga0065704_10106064 3300005289 Bacteria 2089
6 Ga0065704_10131577 3300005289 Bacteria 1622
7 Ga0065712_10080998 3300005290 Bacteria 3050
8 Ga0065712_10085064 3300005290 Bacteria 2698
9 Ga0065712_10087869 3300005290 Bacteria 2535
10 Ga0065712_10088979 3300005290 Bacteria 2487
11 Ga0065712_10100898 3300005290 Bacteria 2049
12 Ga0065715_10001742 3300005293 Bacteria 5667
13 Ga0065715_10089294 3300005293 Bacteria 11457
14 Ga0070683_100000040 3300005329 Bacteria 117545
15 Ga0070683_100027635 3300005329 Bacteria 5119
16 Ga0070683_100076559 3300005329 Bacteria 3127
17 Ga0070683_100195795 3300005329 Bacteria 1919
18 Ga0070690_100139671 3300005330 Unclassified 1643
19 Ga0070670_100001093 3300005331 Bacteria 21540
20 Ga0070677_10037467 3300005333 Bacteria 1892
21 Ga0068869_100019293 3300005334 Bacteria 4656
22 Ga0068869_100027841 3300005334 Bacteria 3944
23 Ga0068869_100171726 3300005334 Bacteria 1694
24 Ga0070666_10007060 3300005335 Bacteria 6923
25 Ga0070666_10009405 3300005335 Bacteria 6090
26 Ga0070680_100030939 3300005336 Bacteria 4300
27 Ga0070682_100000014 3300005337 Bacteria 249552
28 Ga0070682_100342504 3300005337 Unclassified 1112
29 Ga0068868_100000018 3300005338 Bacteria 94882
30 Ga0068868_100004739 3300005338 Bacteria 9551
31 Ga0068868_100033859 3300005338 Bacteria 3941
32 Ga0070689_100025206 3300005340 Bacteria 4467
33 Ga0070689_100189931 3300005340 Unclassified 1672
34 Ga0070689_100191481 3300005340 Bacteria 1665
35 Ga0070661_100056777 3300005344 Bacteria 2869
36 Ga0070668_100106987 3300005347 Unclassified 2223
37 Ga0070669_100143214 3300005353 Bacteria 1845
38 Ga0070671_100000518 3300005355 Bacteria 27083
39 Ga0070671_100126158 3300005355 Bacteria 2154
40 Ga0070671_100199689 3300005355 Unclassified 1696
41 Ga0070688_100061527 3300005365 Unclassified 2374
42 Ga0070688_100121443 3300005365 Bacteria 1751
43 Ga0070667_100176206 3300005367 Bacteria 1890
44 Ga0070667_100183783 3300005367 Unclassified 1850
45 Ga0070709_10046377 3300005434 Unclassified 2702
46 Ga0070714_100117581 3300005435 Bacteria 2361
47 Ga0070714_100377889 3300005435 Bacteria 1335
48 Ga0070713_100009752 3300005436 Bacteria 6901
49 Ga0070713_100058284 3300005436 Bacteria 3220
50 Ga0070713_100134236 3300005436 Bacteria 2185
51 Ga0070705_100050199 3300005440 Bacteria 2425
52 Ga0070708_100025662 3300005445 Bacteria 5040
53 Ga0070708_100053928 3300005445 Bacteria 3569
54 Ga0070708_100220936 3300005445 Bacteria 1777
55 Ga0070708_100410519 3300005445 Bacteria 1277
56 Ga0070663_100062955 3300005455 Bacteria 2676
57 Ga0070678_100018153 3300005456 Bacteria 4554
58 Ga0070662_100106672 3300005457 Unclassified 2128
59 Ga0068867_100043724 3300005459 Unclassified 3280
60 Ga0070685_10011423 3300005466 Bacteria 4648
61 Ga0070685_10027410 3300005466 Bacteria 3148
62 Ga0070706_100067476 3300005467 Bacteria 3309
63 Ga0070706_100084864 3300005467 Bacteria 2934
64 Ga0070706_100164865 3300005467 Bacteria 2069
65 Ga0070706_100222386 3300005467 Bacteria 1762
66 Ga0070706_100232348 3300005467 Bacteria 1721
67 Ga0070706_100298436 3300005467 Bacteria 1503
68 Ga0070707_100000044 3300005468 Bacteria 108715
69 Ga0070707_100006052 3300005468 Bacteria 11295
70 Ga0070707_100007459 3300005468 Bacteria 10156
71 Ga0070707_100010968 3300005468 Bacteria 8441
72 Ga0070707_100025781 3300005468 Bacteria 5580
73 Ga0070707_100034011 3300005468 Bacteria 4862
74 Ga0070707_100040797 3300005468 Bacteria 4441
75 Ga0070707_100099186 3300005468 Bacteria 2822
76 Ga0070707_100123605 3300005468 Bacteria 2513
77 Ga0070707_100177479 3300005468 Bacteria 2076
78 Ga0070707_100379868 3300005468 Bacteria 1372
79 Ga0070698_100000832 3300005471 Bacteria 33743
80 Ga0070698_100003689 3300005471 Bacteria 16813
81 Ga0070698_100020868 3300005471 Bacteria 6865
82 Ga0070698_100054554 3300005471 Bacteria 4057
83 Ga0070698_100231221 3300005471 Bacteria 1782
84 Ga0070699_100000427 3300005518 Bacteria 40529
85 Ga0070699_100061631 3300005518 Bacteria 3250
86 Ga0070699_100287687 3300005518 Bacteria 1473
87 Ga0070679_100062659 3300005530 Bacteria 3708
88 Ga0070679_100112520 3300005530 Bacteria 2708
89 Ga0070684_100003182 3300005535 Bacteria 12277
90 Ga0070684_100005720 3300005535 Bacteria 9550
91 Ga0070684_100034801 3300005535 Bacteria 4308
92 Ga0070684_100277497 3300005535 Bacteria 1535
93 Ga0070697_100000011 3300005536 Bacteria 163240
94 Ga0070697_100007971 3300005536 Bacteria 8257
95 Ga0070697_100138910 3300005536 Bacteria 2042
96 Ga0070697_100160821 3300005536 Bacteria 1897
97 Ga0070697_100220670 3300005536 Bacteria 1616
98 Ga0070697_100267188 3300005536 Bacteria 1466
99 Ga0070697_100356449 3300005536 Bacteria 1264
100 Ga0068853_100002024 3300005539 Bacteria 14993
101 Ga0068853_100172901 3300005539 Bacteria 1955
102 Ga0070672_100007328 3300005543 Bacteria 7480
103 Ga0070672_100101132 3300005543 Unclassified 2339
104 Ga0070686_100155954 3300005544 Bacteria 1603
105 Ga0070665_100002223 3300005548 Bacteria 21641
106 Ga0070665_100068090 3300005548 Bacteria 3569
107 Ga0070704_100010864 3300005549 Bacteria 5554
108 Ga0068855_100237105 3300005563 Bacteria 2040
109 Ga0070664_100095106 3300005564 Bacteria 2584
110 Ga0068854_100006027 3300005578 Bacteria 7680
111 Ga0068854_100017776 3300005578 Bacteria 4764
112 Ga0068856_100073568 3300005614 Bacteria 3383
113 Ga0070702_100240729 3300005615 Bacteria 1221
114 Ga0068852_100214038 3300005616 Bacteria 1829
115 Ga0068859_100033159 3300005617 Bacteria 5187
116 Ga0068859_100062197 3300005617 Bacteria 3763
117 Ga0068864_100000589 3300005618 Bacteria 30925
118 Ga0068864_100004135 3300005618 Bacteria 11904
119 Ga0068863_100033483 3300005841 Bacteria 4895
120 Ga0068863_100121687 3300005841 Bacteria 2489
121 Ga0068863_100178797 3300005841 Bacteria 2037
122 Ga0068863_100184262 3300005841 Unclassified 2005
123 Ga0068858_100000243 3300005842 Bacteria 58808
124 Ga0068858_100207383 3300005842 Bacteria 1854
125 Ga0068858_100342248 3300005842 Bacteria 1431
126 Ga0068860_100099504 3300005843 Unclassified 2773
127 Ga0068860_100137193 3300005843 Bacteria 2349
128 Ga0068862_100067728 3300005844 Bacteria 3079
129 Ga0081455_10000382 3300005937 Bacteria 58627
130 Ga0081455_10002396 3300005937 Bacteria 22378
131 Ga0081455_10004372 3300005937 Bacteria 15913
132 Ga0081455_10056273 3300005937 Bacteria 3341
133 Ga0081455_10162927 3300005937 Bacteria 1707
134 Ga0081540_1000018 3300005983 Bacteria 164931
135 Ga0081540_1025518 3300005983 Bacteria 3397
136 Ga0081539_10017643 3300005985 Bacteria 4999
137 Ga0070717_10000278 3300006028 Bacteria 35073
138 Ga0070717_10002165 3300006028 Bacteria 13779
139 Ga0070717_10020031 3300006028 Bacteria 5255
140 Ga0070717_10097939 3300006028 Bacteria 2485
141 Ga0070712_100021909 3300006175 Bacteria 4201
142 Ga0070712_100063565 3300006175 Bacteria 2614
143 Ga0097621_100002089 3300006237 Bacteria 13681
144 Ga0097621_100142084 3300006237 Bacteria 2052
145 Ga0068871_100019157 3300006358 Bacteria 5222
146 Ga0075431_100015431 3300006847 Bacteria 7739
147 Ga0075434_100037167 3300006871 Bacteria 4820
148 Ga0075434_100280583 3300006871 Bacteria 1685
149 Ga0075434_100392607 3300006871 Bacteria 1408
150 Ga0097620_100033162 3300006931 Bacteria 5187
151 Ga0097620_100062197 3300006931 Bacteria 3763
152 Ga0075435_100009353 3300007076 Bacteria 7089
153 Ga0075435_100052238 3300007076 Bacteria 3294
154 Ga0105240_10150827 3300009093 Unclassified 2769
155 Ga0105240_10556916 3300009093 Bacteria 1268
156 Ga0111539_10000837 3300009094 Bacteria 40029
157 Ga0105245_10000024 3300009098 Bacteria 178565
158 Ga0105245_10000893 3300009098 Bacteria 27163
159 Ga0105245_10186069 3300009098 Bacteria 1987
160 Ga0105245_10269543 3300009098 Bacteria 1660
161 Ga0114129_10015499 3300009147 Bacteria 10839
162 Ga0114129_10084328 3300009147 Bacteria 4412
163 Ga0114129_10126608 3300009147 Bacteria 3512
164 Ga0114129_10254449 3300009147 Bacteria 2356
165 Ga0114129_10339681 3300009147 Bacteria 1992
166 Ga0105243_10488792 3300009148 Bacteria 1163
167 Ga0105241_10178712 3300009174 Bacteria 1758
168 Ga0105242_10004508 3300009176 Bacteria 10819
169 Ga0105242_10099220 3300009176 Unclassified 2465
170 Ga0105248_10106298 3300009177 Bacteria 3164
171 Ga0105238_10000001 3300009551 Bacteria 2036163
172 Ga0105249_10024683 3300009553 Bacteria 5404
173 Ga0105239_10228339 3300010375 Bacteria 2088
174 Ga0157371_10144170 3300013102 Bacteria 1697
175 Ga0157370_10168670 3300013104 Bacteria 2035
176 Ga0157369_10000139 3300013105 Bacteria 102679
177 Ga0157374_10000012 3300013296 Bacteria 462353
178 Ga0157374_10052381 3300013296 Bacteria 3801
179 Ga0157374_10179224 3300013296 Bacteria 2069
180 Ga0157374_10321716 3300013296 Bacteria 1533
181 Ga0157378_10000393 3300013297 Bacteria 43092
182 Ga0157378_10001059 3300013297 Bacteria 25185
183 Ga0157378_10007219 3300013297 Bacteria 9706
184 Ga0157378_10012303 3300013297 Bacteria 7493
185 Ga0163162_10169440 3300013306 Bacteria 2308
186 Ga0163162_10200394 3300013306 Unclassified 2125
187 Ga0157375_10000001 3300013308 Bacteria 696576
188 Ga0157375_10000008 3300013308 Bacteria 373560
189 Ga0157375_10000793 3300013308 Bacteria 27652
190 Ga0157375_10086848 3300013308 Bacteria 3180
191 Ga0157375_10196666 3300013308 Unclassified 2171
192 Ga0163163_10102808 3300014325 Bacteria 2882
193 Ga0163163_10144280 3300014325 Unclassified 2424
194 Ga0163163_10201625 3300014325 Bacteria 2038
195 Ga0163163_10203473 3300014325 Bacteria 2028
196 Ga0157380_10023497 3300014326 Unclassified 4650
197 Ga0157380_10051380 3300014326 Bacteria 3260
198 Ga0157380_10099021 3300014326 Bacteria 2424
199 Ga0157380_10100893 3300014326 Bacteria 2404
200 Ga0157377_10000002 3300014745 Bacteria 473827
201 Ga0157377_10001410 3300014745 Bacteria 10365
202 Ga0157379_10021814 3300014968 Bacteria 5674
203 Ga0157379_10273316 3300014968 Bacteria 1537
204 Ga0157376_10000004 3300014969 Bacteria 508493
205 Ga0157376_10000024 3300014969 Bacteria 220018
206 Ga0157376_10048459 3300014969 Bacteria 3513
207 Ga0157376_10203700 3300014969 Bacteria 1822
208 Ga0213873_10010298 3300021358 Bacteria 1968
209 Ga0213876_10000012 3300021384 Bacteria 396530
210 Ga0213876_10012261 3300021384 Bacteria 4564
211 Ga0207666_1000841 3300025271 Unclassified 3687
212 Ga0207673_1000316 3300025290 Bacteria 4866
213 Ga0207697_10004321 3300025315 Bacteria 6808
214 Ga0207697_10006019 3300025315 Bacteria 5550
215 Ga0207697_10006598 3300025315 Bacteria 5238
216 Ga0207697_10011859 3300025315 Bacteria 3674
217 Ga0207697_10023308 3300025315 Bacteria 2534
218 Ga0207642_10023903 3300025899 Bacteria 2449
219 Ga0207688_10097964 3300025901 Bacteria 1690
220 Ga0207680_10012532 3300025903 Bacteria 4321
221 Ga0207680_10016487 3300025903 Bacteria 3880
222 Ga0207699_10043635 3300025906 Bacteria 2606
223 Ga0207705_10205222 3300025909 Bacteria 1494
224 Ga0207684_10000263 3300025910 Bacteria 78040
225 Ga0207684_10007107 3300025910 Bacteria 10118
226 Ga0207684_10043063 3300025910 Bacteria 3826
227 Ga0207684_10043684 3300025910 Bacteria 3800
228 Ga0207684_10054670 3300025910 Bacteria 3387
229 Ga0207684_10142956 3300025910 Bacteria 2057
230 Ga0207684_10156915 3300025910 Bacteria 1958
231 Ga0207707_10158779 3300025912 Bacteria 1977
232 Ga0207693_10004539 3300025915 Bacteria 11722
233 Ga0207693_10034999 3300025915 Bacteria 3961
234 Ga0207693_10049081 3300025915 Bacteria 3314
235 Ga0207693_10054624 3300025915 Bacteria 3133
236 Ga0207663_10036530 3300025916 Bacteria 2956
237 Ga0207662_10021025 3300025918 Bacteria 3725
238 Ga0207649_10015800 3300025920 Bacteria 4244
239 Ga0207652_10050965 3300025921 Bacteria 3547
240 Ga0207646_10000012 3300025922 Bacteria 367049
241 Ga0207646_10000155 3300025922 Bacteria 94258
242 Ga0207646_10003412 3300025922 Bacteria 17937
243 Ga0207646_10006120 3300025922 Bacteria 12528
244 Ga0207646_10044905 3300025922 Bacteria 3966
245 Ga0207646_10094187 3300025922 Bacteria 2682
246 Ga0207646_10100820 3300025922 Bacteria 2588
247 Ga0207646_10230247 3300025922 Bacteria 1674
248 Ga0207681_10180490 3300025923 Bacteria 1608
249 Ga0207694_10000001 3300025924 Bacteria 4078485
250 Ga0207650_10000870 3300025925 Bacteria 22893
251 Ga0207659_10069811 3300025926 Bacteria 2560
252 Ga0207687_10000003 3300025927 Bacteria 875159
253 Ga0207687_10000242 3300025927 Bacteria 37275
254 Ga0207687_10101982 3300025927 Bacteria 2113
255 Ga0207700_10095252 3300025928 Bacteria 2361
256 Ga0207644_10000241 3300025931 Bacteria 37521
257 Ga0207644_10093874 3300025931 Bacteria 2241
258 Ga0207706_10042957 3300025933 Unclassified 4006
259 Ga0207706_10099066 3300025933 Unclassified 2564
260 Ga0207686_10012379 3300025934 Bacteria 4691
261 Ga0207670_10016260 3300025936 Bacteria 4467
262 Ga0207670_10132765 3300025936 Bacteria 1826
263 Ga0207665_10069338 3300025939 Bacteria 2404
264 Ga0207665_10078442 3300025939 Bacteria 2269
265 Ga0207665_10210910 3300025939 Bacteria 1419
266 Ga0207691_10014435 3300025940 Bacteria 7533
267 Ga0207711_10212957 3300025941 Bacteria 1765
268 Ga0207689_10028890 3300025942 Bacteria 4636
269 Ga0207689_10033569 3300025942 Bacteria 4264
270 Ga0207661_10000001 3300025944 Bacteria 937688
271 Ga0207661_10183080 3300025944 Bacteria 1831
272 Ga0207661_10204039 3300025944 Bacteria 1739
273 Ga0207679_10041906 3300025945 Bacteria 3286
274 Ga0207679_10306172 3300025945 Bacteria 1371
275 Ga0207668_10152693 3300025972 Bacteria 1790
276 Ga0207640_10001929 3300025981 Bacteria 11167
277 Ga0207640_10088975 3300025981 Bacteria 2133
278 Ga0207640_10339604 3300025981 Bacteria 1202
279 Ga0207658_10050653 3300025986 Bacteria 3057
280 Ga0207658_10062105 3300025986 Unclassified 2795
281 Ga0207658_10305945 3300025986 Bacteria 1371
282 Ga0207677_10000035 3300026023 Bacteria 117469
283 Ga0207677_10000258 3300026023 Bacteria 40707
284 Ga0207703_10000046 3300026035 Bacteria 154474
285 Ga0207703_10206115 3300026035 Bacteria 1750
286 Ga0207703_10325835 3300026035 Bacteria 1408
287 Ga0207639_10002069 3300026041 Bacteria 13526
288 Ga0207639_10116127 3300026041 Bacteria 2190
289 Ga0207678_10013367 3300026067 Bacteria 7204
290 Ga0207702_10027800 3300026078 Bacteria 4699
291 Ga0207641_10002304 3300026088 Bacteria 17751
292 Ga0207641_10165226 3300026088 Bacteria 2015
293 Ga0207641_10180561 3300026088 Bacteria 1933
294 Ga0207648_10166265 3300026089 Unclassified 1949
295 Ga0207676_10000052 3300026095 Bacteria 129811
296 Ga0207676_10281288 3300026095 Bacteria 1511
297 Ga0207676_10388118 3300026095 Unclassified 1301
298 Ga0207683_10208060 3300026121 Unclassified 1780
299 Ga0207698_10115707 3300026142 Bacteria 2258
300 Ga0209998_10021626 3300027717 Bacteria 1382
301 Ga0207428_10000669 3300027907 Bacteria 40037
302 Ga0268266_10001048 3300028379 Bacteria 34678
303 Ga0268266_10075964 3300028379 Bacteria 2919
304 Ga0268265_10087280 3300028380 Unclassified 2482
305 Ga0268264_10065780 3300028381 Bacteria 3055
306 Ga0268264_10086630 3300028381 Bacteria 2691
307 Ga0265338_10011527 3300028800 Bacteria 10197
308 Ga0265338_10012322 3300028800 Bacteria 9755
309 Ga0265338_10032862 3300028800 Bacteria 5050
310 Ga0307511_10004063 3300030521 Bacteria 14959
311 Ga0265760_10000786 3300031090 Bacteria 9128
312 Ga0265760_10031669 3300031090 Bacteria 1560
313 Ga0265320_10091660 3300031240 Bacteria 1407
314 Ga0265325_10010816 3300031241 Bacteria 5263
315 Ga0265339_10062171 3300031249 Bacteria 2008
316 Ga0316576_10008422 3300031727 Bacteria 6576
317 Ga0316578_10004590 3300031728 Bacteria 6544
318 Ga0307406_10086220 3300031901 Bacteria 2102
319 Ga0307407_10109146 3300031903 Bacteria 1734
320 Ga0307416_100046719 3300032002 Bacteria 3420
321 Ga0316583_10008483 3300032133 Bacteria 3707
322 Ga0373923_0116712 3300035111 Bacteria 1189
323 Ga0373932_0000779 3300035112 Bacteria 9453
324 Ga0373954_0044867 3300035118 Bacteria 2064
325 Ga0373956_0058553 3300035119 Bacteria 1742
326 Ga0373943_0112939 3300035170 Bacteria 1435
327 Ga0373935_0006372 3300035692 Bacteria 7040
328 Ga0373935_0202523 3300035692 Bacteria 1372
329 Ga0373933_0040655 3300035724 Bacteria 2741
330 Ga0373947_0021304 3300035725 Bacteria 3751
331 Ga0373937_0017249 3300036401 Bacteria 6428
332 Ga0316582_0212731 3300036647 Bacteria 1321
333 Ga0316584_0014253 3300036712 Bacteria 5655
334 Ga0316584_0165757 3300036712 Bacteria 1641
335 Ga0373925_0122484 3300037068 Bacteria 2020
336 Ga0395899_0124647 3300037312 Bacteria 1843
337 Ga0395900_0015317 3300037418 Bacteria 7816
338 Ga0395900_0352045 3300037418 Bacteria 1446
339 Ga0395898_0012348 3300037466 Bacteria 8834
340 Ga0395905_0005136 3300037471 Bacteria 13434
341 Ga0395905_0013999 3300037471 Bacteria 7674
342 Ga0395905_0018078 3300037471 Bacteria 6692
343 Ga0395905_0102537 3300037471 Bacteria 2686
344 Ga0395901_0069351 3300038443 Bacteria 3672
345 Ga0395901_0177958 3300038443 Bacteria 2231
346 Ga0395901_0194066 3300038443 Bacteria 2129
347 Ga0395901_0428916 3300038443 Bacteria 1355
348 Ga0436365_0120716 3300039437 Bacteria 90169
349 Ga0436365_0941626 3300039437 Bacteria 19200
350 Ga0436360_1116729 3300039438 Bacteria 1500
351 Ga0436362_0077551 3300039453 Bacteria 3770
352 Ga0451577_0025986 3300042876 Bacteria 5306
353 Ga0451577_0077801 3300042876 Bacteria 2958
354 Ga0451577_0228485 3300042876 Bacteria 1682
355 Ga0453684_0006686 3300044712 Bacteria 21754
356 Ga0466967_0221900 3300045976 Bacteria 1796
357 Ga0495651_0055496 3300046462 Bacteria 3044
358 Ga0495653_0106612 3300046463 Bacteria 2021
359 Ga0495580_0000271 3300046472 Bacteria 41618
360 Ga0495582_0004525 3300046473 Bacteria 7811
361 Ga0495664_0013294 3300046477 Bacteria 4669
362 Ga0495664_0101657 3300046477 Bacteria 1732
363 Ga0495618_0035298 3300046514 Bacteria 3139
364 Ga0495628_0010446 3300046516 Bacteria 7885
365 Ga0495630_0084857 3300046517 Bacteria 2391
366 Ga0495665_0046814 3300046531 Unclassified 2296
367 Ga0495665_0105777 3300046531 Bacteria 1477
368 Ga0495586_0070315 3300046535 Bacteria 1911
369 Ga0495587_0008462 3300046536 Bacteria 6613
370 Ga0495645_0003457 3300046543 Bacteria 10717
371 Ga0495645_0090390 3300046543 Bacteria 2188
372 Ga0495667_0099432 3300046559 Unclassified 1883
373 Ga0495656_0071393 3300046615 Bacteria 1543
374 Ga0495668_0001833 3300046616 Bacteria 19216
375 Ga0495634_0023752 3300046642 Bacteria 4308
376 Ga0495635_0064712 3300046663 Bacteria 2510
377 Ga0495599_0020475 3300046678 Bacteria 4119
378 Ga0495623_0014728 3300046679 Bacteria 5056
379 Ga0495646_0013553 3300046680 Bacteria 5183
380 Ga0495669_0054445 3300046684 Bacteria 1801
381 Ga0495613_0135112 3300046689 Unclassified 1765
382 Ga0495613_0166884 3300046689 Bacteria 1564
383 Ga0495600_0117284 3300046809 Unclassified 1732
384 Ga0495604_0023589 3300047317 Bacteria 4908
385 Ga0495604_0103739 3300047317 Unclassified 2085
386 Ga0495674_0275649 3300047319 Bacteria 1379
387 Ga0495675_0016001 3300047444 Bacteria 4742
388 Ga0495679_007551 3300047446 Bacteria 4517
389 Ga0495684_0005356 3300047471 Bacteria 9991
390 Ga0495602_0199472 3300048088 Bacteria 1528
391 Ga0496103_0054754 3300048906 Bacteria 2473
392 Ga0496105_0085329 3300048908 Bacteria 2609
393 Ga0496105_0208235 3300048908 Bacteria 1595
394 Ga0496106_0047658 3300048909 Bacteria 3226
395 Ga0496107_0061378 3300048910 Bacteria 2722
396 Ga0496107_0139817 3300048910 Bacteria 1790
397 Ga0496108_0104681 3300048911 Bacteria 2415
398 Ga0496108_0121708 3300048911 Bacteria 2239
399 Ga0496109_0022802 3300048912 Bacteria 5548
400 Ga0496110_0451921 3300048913 Bacteria 1171
401 Ga0496112_0081418 3300048915 Bacteria 3202
402 Ga0496114_0098871 3300048917 Bacteria 2488
403 Ga0496114_0151273 3300048917 Bacteria 2013
404 Ga0496115_0091198 3300048918 Bacteria 2490
405 Ga0496115_0179222 3300048918 Bacteria 1752
406 nmdc:mga05p37_170811_c1 3300050507 Bacteria 2651
407 nmdc:mga05p37_40983_c1 3300050507 Bacteria 5686
408 nmdc:mga06r32_12217_c1 3300050510 Bacteria 7745
409 nmdc:mga08y16_226653_c1 3300050511 Bacteria 1934
410 nmdc:mga08y16_393_c1 3300050511 Bacteria 40037
411 nmdc:mga0n895_20472_c1 3300050512 Bacteria 6170
412 nmdc:mga0n895_272054_c1 3300050512 Bacteria 1718
413 nmdc:mga0n895_90046_c1 3300050512 Bacteria 3069
414 nmdc:mga0rr50_223605_c1 3300050513 Bacteria 1555
415 nmdc:mga0rr50_24376_c1 3300050513 Bacteria 4189
416 nmdc:mga0rr50_312312_c1 3300050513 Bacteria 1317
417 nmdc:mga0rr50_43059_c1 3300050513 Bacteria 3301
418 Ga0495595_0121568 3300053084 Bacteria 1272
419 Ga0495619_0208432 3300053085 Bacteria 1353
420 Ga0081455_10040923
421 JGI25405J52794_10003102
422 JGI25405J52794_10003410
423 JGI25405J52794_10007156
424 Ga0065704_10106064
425 Ga0065704_10131577
426 Ga0065712_10080998
427 Ga0065712_10085064
428 Ga0065712_10087869
429 Ga0065712_10088979
430 Ga0065712_10100898
431 Ga0065715_10001742
432 Ga0065715_10089294
433 Ga0070683_100000040
434 Ga0070683_100027635
435 Ga0070683_100076559
436 Ga0070683_100195795
437 Ga0070690_100139671
438 Ga0070670_100001093
439 Ga0070677_10037467
440 Ga0068869_100019293
441 Ga0068869_100027841
442 Ga0068869_100171726
443 Ga0070666_10007060
444 Ga0070666_10009405
445 Ga0070680_100030939
446 Ga0070682_100000014
447 Ga0070682_100342504
448 Ga0068868_100000018
449 Ga0068868_100004739
450 Ga0068868_100033859
451 Ga0070689_100025206
452 Ga0070689_100189931
453 Ga0070689_100191481
454 Ga0070661_100056777
455 Ga0070668_100106987
456 Ga0070669_100143214
457 Ga0070671_100000518
458 Ga0070671_100126158
459 Ga0070671_100199689
460 Ga0070688_100061527
461 Ga0070688_100121443
462 Ga0070667_100176206
463 Ga0070667_100183783
464 Ga0070709_10046377
465 Ga0070714_100117581
466 Ga0070714_100377889
467 Ga0070713_100009752
468 Ga0070713_100058284
469 Ga0070713_100134236
470 Ga0070705_100050199
471 Ga0070708_100025662
472 Ga0070708_100053928
473 Ga0070708_100220936
474 Ga0070708_100410519
475 Ga0070663_100062955
476 Ga0070678_100018153
477 Ga0070662_100106672
478 Ga0068867_100043724
479 Ga0070685_10011423
480 Ga0070685_10027410
481 Ga0070706_100067476
482 Ga0070706_100084864
483 Ga0070706_100164865
484 Ga0070706_100222386
485 Ga0070706_100232348
486 Ga0070706_100298436
487 Ga0070707_100000044
488 Ga0070707_100006052
489 Ga0070707_100007459
490 Ga0070707_100010968
491 Ga0070707_100025781
492 Ga0070707_100034011
493 Ga0070707_100040797
494 Ga0070707_100099186
495 Ga0070707_100123605
496 Ga0070707_100177479
497 Ga0070707_100379868
498 Ga0070698_100000832
499 Ga0070698_100003689
500 Ga0070698_100020868
501 Ga0070698_100054554
502 Ga0070698_100231221
503 Ga0070699_100000427
504 Ga0070699_100061631
505 Ga0070699_100287687
506 Ga0070679_100062659
507 Ga0070679_100112520
508 Ga0070684_100003182
509 Ga0070684_100005720
510 Ga0070684_100034801
511 Ga0070684_100277497
512 Ga0070697_100000011
513 Ga0070697_100007971
514 Ga0070697_100138910
515 Ga0070697_100160821
516 Ga0070697_100220670
517 Ga0070697_100267188
518 Ga0070697_100356449
519 Ga0068853_100002024
520 Ga0068853_100172901
521 Ga0070672_100007328
522 Ga0070672_100101132
523 Ga0070686_100155954
524 Ga0070665_100002223
525 Ga0070665_100068090
526 Ga0070704_100010864
527 Ga0068855_100237105
528 Ga0070664_100095106
529 Ga0068854_100006027
530 Ga0068854_100017776
531 Ga0068856_100073568
532 Ga0070702_100240729
533 Ga0068852_100214038
534 Ga0068859_100033159
535 Ga0068859_100062197
536 Ga0068864_100000589
537 Ga0068864_100004135
538 Ga0068863_100033483
539 Ga0068863_100121687
540 Ga0068863_100178797
541 Ga0068863_100184262
542 Ga0068858_100000243
543 Ga0068858_100207383
544 Ga0068858_100342248
545 Ga0068860_100099504
546 Ga0068860_100137193
547 Ga0068862_100067728
548 Ga0081455_10000382
549 Ga0081455_10002396
550 Ga0081455_10004372
551 Ga0081455_10056273
552 Ga0081455_10162927
553 Ga0081540_1000018
554 Ga0081540_1025518
555 Ga0081539_10017643
556 Ga0070717_10000278
557 Ga0070717_10002165
558 Ga0070717_10020031
559 Ga0070717_10097939
560 Ga0070712_100021909
561 Ga0070712_100063565
562 Ga0097621_100002089
563 Ga0097621_100142084
564 Ga0068871_100019157
565 Ga0075431_100015431
566 Ga0075434_100037167
567 Ga0075434_100280583
568 Ga0075434_100392607
569 Ga0097620_100033162
570 Ga0097620_100062197
571 Ga0075435_100009353
572 Ga0075435_100052238
573 Ga0105240_10150827
574 Ga0105240_10556916
575 Ga0111539_10000837
576 Ga0105245_10000024
577 Ga0105245_10000893
578 Ga0105245_10186069
579 Ga0105245_10269543
580 Ga0114129_10015499
581 Ga0114129_10084328
582 Ga0114129_10126608
583 Ga0114129_10254449
584 Ga0114129_10339681
585 Ga0105243_10488792
586 Ga0105241_10178712
587 Ga0105242_10004508
588 Ga0105242_10099220
589 Ga0105248_10106298
590 Ga0105238_10000001
591 Ga0105249_10024683
592 Ga0105239_10228339
593 Ga0157371_10144170
594 Ga0157370_10168670
595 Ga0157369_10000139
596 Ga0157374_10000012
597 Ga0157374_10052381
598 Ga0157374_10179224
599 Ga0157374_10321716
600 Ga0157378_10000393
601 Ga0157378_10001059
602 Ga0157378_10007219
603 Ga0157378_10012303
604 Ga0163162_10169440
605 Ga0163162_10200394
606 Ga0157375_10000001
607 Ga0157375_10000008
608 Ga0157375_10000793
609 Ga0157375_10086848
610 Ga0157375_10196666
611 Ga0163163_10102808
612 Ga0163163_10144280
613 Ga0163163_10201625
614 Ga0163163_10203473
615 Ga0157380_10023497
616 Ga0157380_10051380
617 Ga0157380_10099021
618 Ga0157380_10100893
619 Ga0157377_10000002
620 Ga0157377_10001410
621 Ga0157379_10021814
622 Ga0157379_10273316
623 Ga0157376_10000004
624 Ga0157376_10000024
625 Ga0157376_10048459
626 Ga0157376_10203700
627 Ga0213873_10010298
628 Ga0213876_10000012
629 Ga0213876_10012261
630 Ga0207666_1000841
631 Ga0207673_1000316
632 Ga0207697_10004321
633 Ga0207697_10006019
634 Ga0207697_10006598
635 Ga0207697_10011859
636 Ga0207697_10023308
637 Ga0207642_10023903
638 Ga0207688_10097964
639 Ga0207680_10012532
640 Ga0207680_10016487
641 Ga0207699_10043635
642 Ga0207705_10205222
643 Ga0207684_10000263
644 Ga0207684_10007107
645 Ga0207684_10043063
646 Ga0207684_10043684
647 Ga0207684_10054670
648 Ga0207684_10142956
649 Ga0207684_10156915
650 Ga0207707_10158779
651 Ga0207693_10004539
652 Ga0207693_10034999
653 Ga0207693_10049081
654 Ga0207693_10054624
655 Ga0207663_10036530
656 Ga0207662_10021025
657 Ga0207649_10015800
658 Ga0207652_10050965
659 Ga0207646_10000012
660 Ga0207646_10000155
661 Ga0207646_10003412
662 Ga0207646_10006120
663 Ga0207646_10044905
664 Ga0207646_10094187
665 Ga0207646_10100820
666 Ga0207646_10230247
667 Ga0207681_10180490
668 Ga0207694_10000001
669 Ga0207650_10000870
670 Ga0207659_10069811
671 Ga0207687_10000003
672 Ga0207687_10000242
673 Ga0207687_10101982
674 Ga0207700_10095252
675 Ga0207644_10000241
676 Ga0207644_10093874
677 Ga0207706_10042957
678 Ga0207706_10099066
679 Ga0207686_10012379
680 Ga0207670_10016260
681 Ga0207670_10132765
682 Ga0207665_10069338
683 Ga0207665_10078442
684 Ga0207665_10210910
685 Ga0207691_10014435
686 Ga0207711_10212957
687 Ga0207689_10028890
688 Ga0207689_10033569
689 Ga0207661_10000001
690 Ga0207661_10183080
691 Ga0207661_10204039
692 Ga0207679_10041906
693 Ga0207679_10306172
694 Ga0207668_10152693
695 Ga0207640_10001929
696 Ga0207640_10088975
697 Ga0207640_10339604
698 Ga0207658_10050653
699 Ga0207658_10062105
700 Ga0207658_10305945
701 Ga0207677_10000035
702 Ga0207677_10000258
703 Ga0207703_10000046
704 Ga0207703_10206115
705 Ga0207703_10325835
706 Ga0207639_10002069
707 Ga0207639_10116127
708 Ga0207678_10013367
709 Ga0207702_10027800
710 Ga0207641_10002304
711 Ga0207641_10165226
712 Ga0207641_10180561
713 Ga0207648_10166265
714 Ga0207676_10000052
715 Ga0207676_10281288
716 Ga0207676_10388118
717 Ga0207683_10208060
718 Ga0207698_10115707
719 Ga0209998_10021626
720 Ga0207428_10000669
721 Ga0268266_10001048
722 Ga0268266_10075964
723 Ga0268265_10087280
724 Ga0268264_10065780
725 Ga0268264_10086630
726 Ga0265338_10011527
727 Ga0265338_10012322
728 Ga0265338_10032862
729 Ga0307511_10004063
730 Ga0265760_10000786
731 Ga0265760_10031669
732 Ga0265320_10091660
733 Ga0265325_10010816
734 Ga0265339_10062171
735 Ga0316576_10008422
736 Ga0316578_10004590
737 Ga0307406_10086220
738 Ga0307407_10109146
739 Ga0307416_100046719
740 Ga0316583_10008483
741 Ga0373923_0116712
742 Ga0373932_0000779
743 Ga0373954_0044867
744 Ga0373956_0058553
745 Ga0373943_0112939
746 Ga0373935_0006372
747 Ga0373935_0202523
748 Ga0373933_0040655
749 Ga0373947_0021304
750 Ga0373937_0017249
751 Ga0316582_0212731
752 Ga0316584_0014253
753 Ga0316584_0165757
754 Ga0373925_0122484
755 Ga0395899_0124647
756 Ga0395900_0015317
757 Ga0395900_0352045
758 Ga0395898_0012348
759 Ga0395905_0005136
760 Ga0395905_0013999
761 Ga0395905_0018078
762 Ga0395905_0102537
763 Ga0395901_0069351
764 Ga0395901_0177958
765 Ga0395901_0194066
766 Ga0395901_0428916
767 Ga0436365_0120716
768 Ga0436365_0941626
769 Ga0436360_1116729
770 Ga0436362_0077551
771 Ga0451577_0025986
772 Ga0451577_0077801
773 Ga0451577_0228485
774 Ga0453684_0006686
775 Ga0466967_0221900
776 Ga0495651_0055496
777 Ga0495653_0106612
778 Ga0495580_0000271
779 Ga0495582_0004525
780 Ga0495664_0013294
781 Ga0495664_0101657
782 Ga0495618_0035298
783 Ga0495628_0010446
784 Ga0495630_0084857
785 Ga0495665_0046814
786 Ga0495665_0105777
787 Ga0495586_0070315
788 Ga0495587_0008462
789 Ga0495645_0003457
790 Ga0495645_0090390
791 Ga0495667_0099432
792 Ga0495656_0071393
793 Ga0495668_0001833
794 Ga0495634_0023752
795 Ga0495635_0064712
796 Ga0495599_0020475
797 Ga0495623_0014728
798 Ga0495646_0013553
799 Ga0495669_0054445
800 Ga0495613_0135112
801 Ga0495613_0166884
802 Ga0495600_0117284
803 Ga0495604_0023589
804 Ga0495604_0103739
805 Ga0495674_0275649
806 Ga0495675_0016001
807 Ga0495679_007551
808 Ga0495684_0005356
809 Ga0495602_0199472
810 Ga0496103_0054754
811 Ga0496105_0085329
812 Ga0496105_0208235
813 Ga0496106_0047658
814 Ga0496107_0061378
815 Ga0496107_0139817
816 Ga0496108_0104681
817 Ga0496108_0121708
818 Ga0496109_0022802
819 Ga0496110_0451921
820 Ga0496112_0081418
821 Ga0496114_0098871
822 Ga0496114_0151273
823 Ga0496115_0091198
824 Ga0496115_0179222
825 nmdc:mga05p37_170811_c1
826 nmdc:mga05p37_40983_c1
827 nmdc:mga06r32_12217_c1
828 nmdc:mga08y16_226653_c1
829 nmdc:mga08y16_393_c1
830 nmdc:mga0n895_20472_c1
831 nmdc:mga0n895_272054_c1
832 nmdc:mga0n895_90046_c1
833 nmdc:mga0rr50_223605_c1
834 nmdc:mga0rr50_24376_c1
835 nmdc:mga0rr50_312312_c1
836 nmdc:mga0rr50_43059_c1
837 Ga0495595_0121568
838 Ga0495619_0208432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18152

DAHP_snth_FXD

DAHP synthase ferredoxin-like domain

1

67

0.99

PF00793

DAHP_synth_1

DAHP synthetase I family

79

333

0.94

PF03102

NeuB

NeuB family

133

337

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pg8-assembly1.cif.gz_B truncated form of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from thermotoga maritima 0.9635 71 332
3pg8-assembly1.cif.gz_A truncated form of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from thermotoga maritima 0.9602 71 332
1vs1-assembly1.cif.gz_B crystal structure of 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase (dahp synthase) from aeropyrum pernix in complex with mn2+ and pep 0.96 80 328
4c1k-assembly1.cif.gz_E crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase 0.9586 72 329
4c1l-assembly1.cif.gz_A crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase i181d interface mutant 0.9581 72 329
ID Description Score Start End Superfamily
3pg8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9599 71 332 3.20.20.70
3pg8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9214 71 332 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.921 95 333 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8736 79 333 3.20.20.70
4z1aA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8692 94 332 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A645HI73-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) 0.9808 220 332 GO:0003849
GO:0009058
AF-A0A7J4K246-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) 0.9804 247 332 GO:0003849
GO:0009058
AF-A0A7C5M4X6-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase 0.979 204 333 GO:0009058
AF-A0A352TTM3-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase 0.9785 207 333 GO:0009058
AF-A0A7C7DVZ8-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) 0.9782 203 332 GO:0003849
GO:0009058

Map