F439573

General Info

Members Datasets Scaffolds Average Seq Length
419 161 838 67

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0215780|Ga0466963_0215780_367_600
Length 77
Sequence VARENVRMIPMKTSSVFKSRWMALLWAAGIIWFAYDFAGSQPQPANSTDNAEQATDASGAPVTADDEKKFAAELNSF

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.34
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 24.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0215780 3300044694 Bacteria 1343
2 JGI24740J21852_10030245 3300001979 Unclassified 1766
3 JGI24740J21852_10086993 3300001979 Bacteria 811
4 JGI24739J22299_10010582 3300001989 Bacteria 3423
5 JGI24737J22298_10000548 3300001990 Bacteria 13144
6 JGI24735J21928_10134339 3300002067 Unclassified 713
7 JGI24738J21930_10004476 3300002075 Bacteria 3419
8 Ga0070658_10000220 3300005327 Bacteria 50700
9 Ga0070658_10040951 3300005327 Bacteria 3737
10 Ga0070658_10465735 3300005327 Bacteria 1090
11 Ga0070676_10514731 3300005328 Bacteria 851
12 Ga0070683_100009023 3300005329 Bacteria 8507
13 Ga0070683_100172698 3300005329 Bacteria 2052
14 Ga0070683_100278811 3300005329 Bacteria 1590
15 Ga0070670_100021908 3300005331 Bacteria 5498
16 Ga0070677_10229384 3300005333 Bacteria 911
17 Ga0068869_102138768 3300005334 Unclassified 503
18 Ga0070666_10001568 3300005335 Bacteria 13884
19 Ga0070666_10441579 3300005335 Unclassified 939
20 Ga0070666_10550638 3300005335 Unclassified 839
21 Ga0070666_10862053 3300005335 Unclassified 669
22 Ga0070680_100000406 3300005336 Bacteria 29408
23 Ga0070680_100002258 3300005336 Bacteria 14240
24 Ga0070682_100092205 3300005337 Bacteria 1984
25 Ga0068868_100331012 3300005338 Unclassified 1300
26 Ga0068868_100959346 3300005338 Bacteria 780
27 Ga0070660_100000218 3300005339 Bacteria 37921
28 Ga0070660_100051835 3300005339 Bacteria 3162
29 Ga0070660_100350536 3300005339 Bacteria 1215
30 Ga0070660_100547812 3300005339 Bacteria 965
31 Ga0070660_100682283 3300005339 Bacteria 861
32 Ga0070691_10458632 3300005341 Bacteria 729
33 Ga0070661_100000181 3300005344 Bacteria 52052
34 Ga0070661_100236547 3300005344 Bacteria 1405
35 Ga0070661_100954508 3300005344 Bacteria 710
36 Ga0070692_10076875 3300005345 Bacteria 1790
37 Ga0070692_10190763 3300005345 Bacteria 1194
38 Ga0070668_100185471 3300005347 Bacteria 1701
39 Ga0070669_100484627 3300005353 Bacteria 1024
40 Ga0070671_100010875 3300005355 Bacteria 7306
41 Ga0070671_100024791 3300005355 Bacteria 4914
42 Ga0070671_100025393 3300005355 Bacteria 4861
43 Ga0070674_100191136 3300005356 Bacteria 1575
44 Ga0070673_100846563 3300005364 Bacteria 846
45 Ga0070659_100000310 3300005366 Bacteria 37921
46 Ga0070659_100095807 3300005366 Bacteria 2384
47 Ga0070659_100976473 3300005366 Bacteria 743
48 Ga0070659_101208652 3300005366 Bacteria 669
49 Ga0070659_101611192 3300005366 Unclassified 580
50 Ga0070667_100022597 3300005367 Bacteria 5214
51 Ga0070667_100061356 3300005367 Bacteria 3183
52 Ga0070667_100086450 3300005367 Bacteria 2690
53 Ga0070667_100276642 3300005367 Bacteria 1506
54 Ga0070667_100324848 3300005367 Bacteria 1389
55 Ga0070667_101564913 3300005367 Unclassified 619
56 Ga0070709_10901279 3300005434 Unclassified 699
57 Ga0070714_100402898 3300005435 Bacteria 1293
58 Ga0070714_100694449 3300005435 Bacteria 981
59 Ga0070714_100842566 3300005435 Bacteria 889
60 Ga0070714_100939988 3300005435 Unclassified 840
61 Ga0070713_100730959 3300005436 Unclassified 946
62 Ga0070711_102050315 3300005439 Unclassified 503
63 Ga0070663_100087618 3300005455 Bacteria 2301
64 Ga0070663_100583600 3300005455 Bacteria 938
65 Ga0070678_100026734 3300005456 Bacteria 3908
66 Ga0070678_101413197 3300005456 Bacteria 650
67 Ga0070662_100000080 3300005457 Bacteria 53280
68 Ga0070662_100004660 3300005457 Bacteria 8696
69 Ga0070662_101651819 3300005457 Unclassified 553
70 Ga0070681_10928528 3300005458 Bacteria 789
71 Ga0068867_100069921 3300005459 Bacteria 2623
72 Ga0070679_100070012 3300005530 Bacteria 3499
73 Ga0070679_100110295 3300005530 Bacteria 2738
74 Ga0070679_100198682 3300005530 Bacteria 1972
75 Ga0070679_100499092 3300005530 Unclassified 1161
76 Ga0070679_101084002 3300005530 Unclassified 746
77 Ga0070684_100674478 3300005535 Unclassified 963
78 Ga0070684_100702526 3300005535 Bacteria 943
79 Ga0070684_101239582 3300005535 Unclassified 702
80 Ga0068853_100000134 3300005539 Bacteria 50184
81 Ga0068853_100107295 3300005539 Bacteria 2476
82 Ga0070672_100290152 3300005543 Bacteria 1385
83 Ga0070686_100716743 3300005544 Bacteria 799
84 Ga0070686_101234730 3300005544 Unclassified 622
85 Ga0070693_100000536 3300005547 Bacteria 17016
86 Ga0070665_100045739 3300005548 Bacteria 4396
87 Ga0070665_100987857 3300005548 Archaea 854
88 Ga0068855_100043926 3300005563 Bacteria 5291
89 Ga0068855_100064651 3300005563 Bacteria 4267
90 Ga0068855_100070838 3300005563 Bacteria 4055
91 Ga0068855_100209046 3300005563 Bacteria 2194
92 Ga0068855_100215621 3300005563 Bacteria 2155
93 Ga0068855_100509767 3300005563 Bacteria 1306
94 Ga0070664_100000047 3300005564 Bacteria 73560
95 Ga0068857_100305520 3300005577 Unclassified 1467
96 Ga0068854_100012702 3300005578 Bacteria 5515
97 Ga0068854_100083626 3300005578 Bacteria 2360
98 Ga0068854_100108885 3300005578 Bacteria 2087
99 Ga0068854_101964826 3300005578 Bacteria 539
100 Ga0068856_100001328 3300005614 Bacteria 26042
101 Ga0068856_100056308 3300005614 Bacteria 3879
102 Ga0068856_100466005 3300005614 Unclassified 1284
103 Ga0068856_100568954 3300005614 Bacteria 1154
104 Ga0068856_101434384 3300005614 Bacteria 704
105 Ga0068856_101468637 3300005614 Bacteria 696
106 Ga0068852_100002050 3300005616 Bacteria 13737
107 Ga0068852_100002251 3300005616 Bacteria 13240
108 Ga0068852_100014063 3300005616 Bacteria 6143
109 Ga0068852_100015243 3300005616 Bacteria 5952
110 Ga0068852_100200323 3300005616 Bacteria 1889
111 Ga0068852_100321415 3300005616 Unclassified 1503
112 Ga0068852_100450182 3300005616 Bacteria 1274
113 Ga0068852_100870838 3300005616 Bacteria 917
114 Ga0068864_100052557 3300005618 Bacteria 3512
115 Ga0068863_100544868 3300005841 Unclassified 1145
116 Ga0068858_100023710 3300005842 Bacteria 5717
117 Ga0068860_100060777 3300005843 Bacteria 3591
118 Ga0068860_100207376 3300005843 Bacteria 1901
119 Ga0068860_101971064 3300005843 Unclassified 605
120 Ga0068862_100005042 3300005844 Bacteria 11111
121 Ga0068862_100743201 3300005844 Bacteria 954
122 Ga0070716_100772781 3300006173 Bacteria 741
123 Ga0070712_102028139 3300006175 Bacteria 504
124 Ga0068865_100098745 3300006881 Bacteria 2134
125 Ga0105240_10013759 3300009093 Bacteria 11088
126 Ga0105240_10214866 3300009093 Bacteria 2244
127 Ga0105245_12991289 3300009098 Unclassified 524
128 Ga0105241_10077754 3300009174 Bacteria 2591
129 Ga0105241_10168154 3300009174 Unclassified 1809
130 Ga0105248_10000276 3300009177 Bacteria 60451
131 Ga0105248_10040529 3300009177 Bacteria 5221
132 Ga0105248_10048181 3300009177 Bacteria 4780
133 Ga0105237_11459487 3300009545 Unclassified 691
134 Ga0105238_10034298 3300009551 Bacteria 5164
135 Ga0105238_10148872 3300009551 Bacteria 2317
136 Ga0105238_11317270 3300009551 Bacteria 748
137 Ga0105238_12095054 3300009551 Unclassified 600
138 Ga0105238_12377822 3300009551 Unclassified 565
139 Ga0105249_10476786 3300009553 Bacteria 1290
140 Ga0105239_10559959 3300010375 Unclassified 1302
141 Ga0105239_11352700 3300010375 Unclassified 822
142 Ga0105246_10392161 3300011119 Bacteria 1150
143 Ga0105246_11168098 3300011119 Unclassified 707
144 Ga0157373_10007891 3300013100 Bacteria 7920
145 Ga0157373_10274165 3300013100 Bacteria 1195
146 Ga0157373_10428772 3300013100 Unclassified 950
147 Ga0157373_10475017 3300013100 Unclassified 902
148 Ga0157373_10705518 3300013100 Unclassified 739
149 Ga0157371_10006963 3300013102 Bacteria 9209
150 Ga0157371_10034220 3300013102 Bacteria 3645
151 Ga0157371_10058976 3300013102 Unclassified 2722
152 Ga0157371_10154085 3300013102 Bacteria 1639
153 Ga0157371_10944386 3300013102 Bacteria 656
154 Ga0157371_11321199 3300013102 Bacteria 558
155 Ga0157371_11554784 3300013102 Bacteria 517
156 Ga0157370_10020725 3300013104 Bacteria 6560
157 Ga0157370_10192665 3300013104 Bacteria 1892
158 Ga0157370_10214303 3300013104 Bacteria 1784
159 Ga0157370_10369034 3300013104 Bacteria 1322
160 Ga0157370_10815791 3300013104 Unclassified 849
161 Ga0157370_11508725 3300013104 Unclassified 604
162 Ga0157370_11625409 3300013104 Unclassified 580
163 Ga0157369_10077904 3300013105 Bacteria 3552
164 Ga0157369_10236532 3300013105 Bacteria 1908
165 Ga0157369_10320237 3300013105 Bacteria 1612
166 Ga0157369_10346853 3300013105 Bacteria 1542
167 Ga0157369_10842473 3300013105 Bacteria 941
168 Ga0157369_11304533 3300013105 Unclassified 740
169 Ga0157369_11429158 3300013105 Unclassified 704
170 Ga0157374_10007006 3300013296 Bacteria 9595
171 Ga0157378_11324827 3300013297 Unclassified 762
172 Ga0157378_11807379 3300013297 Bacteria 659
173 Ga0157378_11835396 3300013297 Unclassified 655
174 Ga0163162_10031161 3300013306 Bacteria 5288
175 Ga0163162_10966387 3300013306 Archaea 962
176 Ga0157372_10100747 3300013307 Bacteria 3296
177 Ga0157372_10217309 3300013307 Bacteria 2215
178 Ga0157372_10347830 3300013307 Bacteria 1727
179 Ga0157372_10431082 3300013307 Bacteria 1537
180 Ga0157372_10593328 3300013307 Unclassified 1291
181 Ga0157372_10959213 3300013307 Bacteria 991
182 Ga0157372_12026667 3300013307 Bacteria 661
183 Ga0163163_10001248 3300014325 Bacteria 21440
184 Ga0157379_10078482 3300014968 Bacteria 2957
185 Ga0157376_11234513 3300014969 Unclassified 776
186 Ga0163161_10086896 3300017792 Bacteria 2309
187 Ga0163161_10297508 3300017792 Bacteria 1270
188 Ga0207642_10161261 3300025899 Bacteria 1204
189 Ga0207680_10028950 3300025903 Bacteria 3106
190 Ga0207680_10592208 3300025903 Unclassified 793
191 Ga0207705_10123198 3300025909 Bacteria 1925
192 Ga0207705_10185647 3300025909 Bacteria 1571
193 Ga0207705_10235937 3300025909 Bacteria 1392
194 Ga0207705_10486011 3300025909 Unclassified 958
195 Ga0207705_10660276 3300025909 Bacteria 813
196 Ga0207695_10119754 3300025913 Bacteria 2602
197 Ga0207695_10146117 3300025913 Bacteria 2309
198 Ga0207660_10000515 3300025917 Bacteria 25797
199 Ga0207660_10001062 3300025917 Bacteria 18218
200 Ga0207660_10004418 3300025917 Bacteria 9165
201 Ga0207660_10453676 3300025917 Bacteria 1037
202 Ga0207657_10046172 3300025919 Bacteria 3816
203 Ga0207657_10135254 3300025919 Bacteria 2017
204 Ga0207657_10194833 3300025919 Unclassified 1633
205 Ga0207657_11342522 3300025919 Bacteria 539
206 Ga0207649_10121141 3300025920 Bacteria 1764
207 Ga0207649_10293616 3300025920 Bacteria 1186
208 Ga0207649_10361115 3300025920 Unclassified 1078
209 Ga0207652_10076931 3300025921 Bacteria 2911
210 Ga0207652_10268064 3300025921 Unclassified 1540
211 Ga0207681_10756015 3300025923 Bacteria 810
212 Ga0207694_10383349 3300025924 Unclassified 1167
213 Ga0207694_10954473 3300025924 Unclassified 725
214 Ga0207694_11726290 3300025924 Bacteria 527
215 Ga0207664_10013360 3300025929 Bacteria 5890
216 Ga0207664_10163475 3300025929 Bacteria 1900
217 Ga0207664_10319311 3300025929 Bacteria 1370
218 Ga0207644_10124308 3300025931 Bacteria 1967
219 Ga0207690_10065934 3300025932 Bacteria 2478
220 Ga0207690_10084601 3300025932 Bacteria 2224
221 Ga0207690_10565500 3300025932 Unclassified 925
222 Ga0207706_10004820 3300025933 Bacteria 12639
223 Ga0207669_10152890 3300025937 Bacteria 1619
224 Ga0207704_10043056 3300025938 Bacteria 2662
225 Ga0207691_10520686 3300025940 Bacteria 1009
226 Ga0207711_10135155 3300025941 Bacteria 2214
227 Ga0207711_10360660 3300025941 Bacteria 1346
228 Ga0207661_10123031 3300025944 Bacteria 2212
229 Ga0207661_10215114 3300025944 Unclassified 1696
230 Ga0207661_10258944 3300025944 Bacteria 1549
231 Ga0207667_10141230 3300025949 Bacteria 2479
232 Ga0207667_10173335 3300025949 Unclassified 2217
233 Ga0207667_10182114 3300025949 Bacteria 2157
234 Ga0207667_10434749 3300025949 Bacteria 1334
235 Ga0207651_10900522 3300025960 Unclassified 788
236 Ga0207651_11311910 3300025960 Bacteria 651
237 Ga0207668_10098976 3300025972 Bacteria 2162
238 Ga0207668_11244953 3300025972 Bacteria 669
239 Ga0207640_10286204 3300025981 Unclassified 1297
240 Ga0207640_10906708 3300025981 Unclassified 770
241 Ga0207640_11643104 3300025981 Unclassified 579
242 Ga0207658_10055350 3300025986 Bacteria 2939
243 Ga0207658_10236558 3300025986 Bacteria 1544
244 Ga0207658_10331927 3300025986 Archaea 1319
245 Ga0207658_11397846 3300025986 Unclassified 640
246 Ga0207677_10352166 3300026023 Unclassified 1234
247 Ga0207639_10327669 3300026041 Bacteria 1361
248 Ga0207639_11046861 3300026041 Unclassified 765
249 Ga0207702_10156815 3300026078 Bacteria 2076
250 Ga0207702_10197621 3300026078 Bacteria 1862
251 Ga0207702_10348001 3300026078 Bacteria 1417
252 Ga0207648_10551459 3300026089 Bacteria 1059
253 Ga0207683_10093274 3300026121 Bacteria 2683
254 Ga0207683_11435266 3300026121 Bacteria 638
255 Ga0207698_10000986 3300026142 Bacteria 16510
256 Ga0207698_10001169 3300026142 Bacteria 15304
257 Ga0207698_10007388 3300026142 Bacteria 6884
258 Ga0207698_10130564 3300026142 Bacteria 2146
259 Ga0207698_10175750 3300026142 Bacteria 1891
260 Ga0207698_10483748 3300026142 Bacteria 1201
261 Ga0207698_10939002 3300026142 Bacteria 874
262 Ga0207698_12026231 3300026142 Bacteria 590
263 Ga0268266_10019318 3300028379 Bacteria 5805
264 Ga0268266_11026080 3300028379 Archaea 798
265 Ga0268265_10004462 3300028380 Bacteria 9704
266 Ga0268265_10447833 3300028380 Bacteria 1205
267 Ga0268264_10017800 3300028381 Bacteria 5817
268 Ga0268264_10553639 3300028381 Bacteria 1128
269 Ga0307515_10269935 3300028794 Unclassified 1424
270 Ga0373953_0167211 3300035117 Unclassified 946
271 Ga0373954_0225952 3300035118 Unclassified 921
272 Ga0373957_0098322 3300035120 Unclassified 1169
273 Ga0373955_0002452 3300035172 Bacteria 8098
274 Ga0373935_0213541 3300035692 Unclassified 1338
275 Ga0373933_0720137 3300035724 Unclassified 656
276 Ga0373937_0001514 3300036401 Bacteria 19522
277 Ga0395899_0016732 3300037312 Bacteria 5590
278 Ga0395899_0028045 3300037312 Bacteria 4240
279 Ga0395899_0078045 3300037312 Bacteria 2414
280 Ga0395899_0082403 3300037312 Bacteria 2340
281 Ga0395899_0136735 3300037312 Bacteria 1746
282 Ga0395899_0192314 3300037312 Bacteria 1427
283 Ga0395899_0240863 3300037312 Unclassified 1245
284 Ga0395899_0356812 3300037312 Bacteria 976
285 Ga0395899_0395566 3300037312 Bacteria 915
286 Ga0395899_0580238 3300037312 Bacteria 717
287 Ga0395899_0830668 3300037312 Unclassified 568
288 Ga0395900_0027658 3300037418 Bacteria 5809
289 Ga0395900_0063046 3300037418 Bacteria 3810
290 Ga0395900_0119134 3300037418 Bacteria 2709
291 Ga0395900_0165384 3300037418 Bacteria 2254
292 Ga0395900_0180359 3300037418 Bacteria 2146
293 Ga0395900_0207813 3300037418 Bacteria 1978
294 Ga0395900_0251987 3300037418 Bacteria 1766
295 Ga0395900_0286711 3300037418 Bacteria 1637
296 Ga0395900_0541645 3300037418 Unclassified 1109
297 Ga0395900_0599309 3300037418 Unclassified 1042
298 Ga0395900_0631166 3300037418 Unclassified 1009
299 Ga0395900_0861181 3300037418 Bacteria 831
300 Ga0395900_0949203 3300037418 Unclassified 781
301 Ga0395900_1014451 3300037418 Unclassified 749
302 Ga0395900_1104939 3300037418 Bacteria 710
303 Ga0395900_1173944 3300037418 Bacteria 683
304 Ga0395900_1503222 3300037418 Bacteria 585
305 Ga0395900_1566701 3300037418 Unclassified 570
306 Ga0395900_1598785 3300037418 Bacteria 563
307 Ga0395898_0063085 3300037466 Bacteria 3596
308 Ga0395898_0170353 3300037466 Bacteria 2081
309 Ga0395898_0178947 3300037466 Bacteria 2026
310 Ga0395898_0188201 3300037466 Bacteria 1972
311 Ga0395898_0236532 3300037466 Unclassified 1742
312 Ga0395898_0240295 3300037466 Bacteria 1727
313 Ga0395898_0269600 3300037466 Bacteria 1623
314 Ga0395898_0321372 3300037466 Bacteria 1476
315 Ga0395898_0343487 3300037466 Bacteria 1423
316 Ga0395898_0412613 3300037466 Bacteria 1287
317 Ga0395898_0495150 3300037466 Unclassified 1162
318 Ga0395898_0527086 3300037466 Unclassified 1123
319 Ga0395898_0751250 3300037466 Bacteria 916
320 Ga0395905_0020258 3300037471 Bacteria 6301
321 Ga0395905_0054494 3300037471 Bacteria 3742
322 Ga0395905_0079747 3300037471 Bacteria 3068
323 Ga0395905_0125108 3300037471 Bacteria 2417
324 Ga0395905_0250587 3300037471 Bacteria 1654
325 Ga0395905_0259802 3300037471 Bacteria 1621
326 Ga0395905_0389872 3300037471 Bacteria 1287
327 Ga0395905_0457495 3300037471 Unclassified 1174
328 Ga0395905_0504892 3300037471 Unclassified 1109
329 Ga0395905_0697405 3300037471 Unclassified 917
330 Ga0395905_0902560 3300037471 Bacteria 786
331 Ga0395905_1078217 3300037471 Unclassified 706
332 Ga0395905_1208345 3300037471 Unclassified 659
333 Ga0395905_1506481 3300037471 Unclassified 577
334 Ga0395901_0018576 3300038443 Bacteria 7100
335 Ga0395901_0020133 3300038443 Bacteria 6827
336 Ga0395901_0102698 3300038443 Bacteria 3000
337 Ga0395901_0134585 3300038443 Bacteria 2597
338 Ga0395901_0153979 3300038443 Bacteria 2414
339 Ga0395901_0158559 3300038443 Bacteria 2376
340 Ga0395901_0199840 3300038443 Bacteria 2095
341 Ga0395901_0300121 3300038443 Bacteria 1665
342 Ga0395901_0359936 3300038443 Bacteria 1500
343 Ga0395901_0539549 3300038443 Bacteria 1183
344 Ga0395901_0698198 3300038443 Bacteria 1012
345 Ga0395901_0713291 3300038443 Bacteria 999
346 Ga0395901_1009644 3300038443 Unclassified 807
347 Ga0395901_1236403 3300038443 Bacteria 711
348 Ga0395901_1335085 3300038443 Bacteria 678
349 Ga0395901_1565049 3300038443 Unclassified 613
350 Ga0451807_0571521 3300041486 Bacteria 597
351 Ga0466969_0035747 3300044656 Bacteria 2512
352 Ga0466969_0041854 3300044656 Bacteria 2290
353 Ga0466965_0422507 3300044683 Bacteria 739
354 Ga0466966_0016847 3300044684 Bacteria 4829
355 Ga0466966_0051018 3300044684 Bacteria 2630
356 Ga0466961_0196745 3300044693 Bacteria 1248
357 Ga0466961_0392714 3300044693 Unclassified 842
358 Ga0466963_0003212 3300044694 Bacteria 9298
359 Ga0466963_0042133 3300044694 Bacteria 2997
360 Ga0466963_0060917 3300044694 Bacteria 2521
361 Ga0466963_0208446 3300044694 Bacteria 1367
362 Ga0466963_0258132 3300044694 Unclassified 1223
363 Ga0466963_0333151 3300044694 Bacteria 1068
364 Ga0466963_1075953 3300044694 Unclassified 566
365 Ga0466971_0136071 3300044719 Bacteria 1143
366 Ga0466971_0139918 3300044719 Bacteria 1127
367 Ga0466968_0004855 3300044735 Bacteria 5032
368 Ga0466970_0015259 3300044765 Bacteria 3950
369 Ga0466957_0129410 3300044842 Bacteria 1616
370 Ga0466957_0621748 3300044842 Bacteria 757
371 Ga0466957_0626450 3300044842 Unclassified 755
372 Ga0466960_0257972 3300044901 Unclassified 970
373 Ga0466960_0570094 3300044901 Unclassified 669
374 Ga0466959_0456934 3300045049 Unclassified 865
375 Ga0466958_0020162 3300045836 Bacteria 3886
376 Ga0466958_0214172 3300045836 Bacteria 1228
377 Ga0466958_0340520 3300045836 Bacteria 965
378 Ga0466958_0513306 3300045836 Bacteria 778
379 Ga0466967_0025320 3300045976 Bacteria 4891
380 Ga0466967_0085879 3300045976 Bacteria 2850
381 Ga0466967_0086675 3300045976 Bacteria 2837
382 Ga0466967_0128577 3300045976 Bacteria 2349
383 Ga0466967_1069502 3300045976 Unclassified 804
384 Ga0466967_1099937 3300045976 Bacteria 792
385 Ga0495582_0282761 3300046473 Bacteria 953
386 Ga0495642_0260845 3300046528 Bacteria 758
387 Ga0495642_0358846 3300046528 Bacteria 641
388 Ga0495621_0140959 3300046539 Bacteria 943
389 Ga0495668_0785623 3300046616 Bacteria 527
390 Ga0495669_0020214 3300046684 Bacteria 2880
391 Ga0495669_0039061 3300046684 Bacteria 2101
392 Ga0495669_0076719 3300046684 Bacteria 1530
393 Ga0495669_0165080 3300046684 Unclassified 1052
394 Ga0495677_0173769 3300047445 Bacteria 834
395 Ga0495602_0041409 3300048088 Bacteria 4208
396 Ga0496100_1033112 3300048903 Bacteria 647
397 Ga0496100_1229888 3300048903 Unclassified 591
398 Ga0496101_1114926 3300048904 Unclassified 619
399 Ga0496106_0375402 3300048909 Unclassified 1143
400 Ga0496107_0024175 3300048910 Bacteria 4298
401 Ga0496107_0199602 3300048910 Bacteria 1487
402 Ga0496108_0262097 3300048911 Unclassified 1504
403 Ga0496109_0039480 3300048912 Bacteria 4273
404 Ga0496110_0460040 3300048913 Bacteria 1159
405 Ga0496112_0019602 3300048915 Bacteria 6387
406 Ga0496112_0870510 3300048915 Bacteria 824
407 Ga0496113_0261240 3300048916 Unclassified 1383
408 Ga0496113_1259645 3300048916 Unclassified 576
409 Ga0501047_0372054 3300049581 Unclassified 1264
410 Ga0501070_0138285 3300049586 Bacteria 2011
411 Ga0501071_0203135 3300049587 Bacteria 1489
412 Ga0501073_0296868 3300049589 Bacteria 1115
413 Ga0501074_0038808 3300049590 Bacteria 3450
414 Ga0501074_0665837 3300049590 Bacteria 735
415 Ga0501080_0135940 3300049742 Bacteria 2275
416 Ga0501080_0674181 3300049742 Bacteria 913
417 nmdc:mga07m45_230532_c1 3300050496 Bacteria 1077
418 Ga0466962_0075659 3300061719 Bacteria 1609
419 Ga0466962_0537449 3300061719 Unclassified 593
420 Ga0466963_0215780
421 JGI24740J21852_10030245
422 JGI24740J21852_10086993
423 JGI24739J22299_10010582
424 JGI24737J22298_10000548
425 JGI24735J21928_10134339
426 JGI24738J21930_10004476
427 Ga0070658_10000220
428 Ga0070658_10040951
429 Ga0070658_10465735
430 Ga0070676_10514731
431 Ga0070683_100009023
432 Ga0070683_100172698
433 Ga0070683_100278811
434 Ga0070670_100021908
435 Ga0070677_10229384
436 Ga0068869_102138768
437 Ga0070666_10001568
438 Ga0070666_10441579
439 Ga0070666_10550638
440 Ga0070666_10862053
441 Ga0070680_100000406
442 Ga0070680_100002258
443 Ga0070682_100092205
444 Ga0068868_100331012
445 Ga0068868_100959346
446 Ga0070660_100000218
447 Ga0070660_100051835
448 Ga0070660_100350536
449 Ga0070660_100547812
450 Ga0070660_100682283
451 Ga0070691_10458632
452 Ga0070661_100000181
453 Ga0070661_100236547
454 Ga0070661_100954508
455 Ga0070692_10076875
456 Ga0070692_10190763
457 Ga0070668_100185471
458 Ga0070669_100484627
459 Ga0070671_100010875
460 Ga0070671_100024791
461 Ga0070671_100025393
462 Ga0070674_100191136
463 Ga0070673_100846563
464 Ga0070659_100000310
465 Ga0070659_100095807
466 Ga0070659_100976473
467 Ga0070659_101208652
468 Ga0070659_101611192
469 Ga0070667_100022597
470 Ga0070667_100061356
471 Ga0070667_100086450
472 Ga0070667_100276642
473 Ga0070667_100324848
474 Ga0070667_101564913
475 Ga0070709_10901279
476 Ga0070714_100402898
477 Ga0070714_100694449
478 Ga0070714_100842566
479 Ga0070714_100939988
480 Ga0070713_100730959
481 Ga0070711_102050315
482 Ga0070663_100087618
483 Ga0070663_100583600
484 Ga0070678_100026734
485 Ga0070678_101413197
486 Ga0070662_100000080
487 Ga0070662_100004660
488 Ga0070662_101651819
489 Ga0070681_10928528
490 Ga0068867_100069921
491 Ga0070679_100070012
492 Ga0070679_100110295
493 Ga0070679_100198682
494 Ga0070679_100499092
495 Ga0070679_101084002
496 Ga0070684_100674478
497 Ga0070684_100702526
498 Ga0070684_101239582
499 Ga0068853_100000134
500 Ga0068853_100107295
501 Ga0070672_100290152
502 Ga0070686_100716743
503 Ga0070686_101234730
504 Ga0070693_100000536
505 Ga0070665_100045739
506 Ga0070665_100987857
507 Ga0068855_100043926
508 Ga0068855_100064651
509 Ga0068855_100070838
510 Ga0068855_100209046
511 Ga0068855_100215621
512 Ga0068855_100509767
513 Ga0070664_100000047
514 Ga0068857_100305520
515 Ga0068854_100012702
516 Ga0068854_100083626
517 Ga0068854_100108885
518 Ga0068854_101964826
519 Ga0068856_100001328
520 Ga0068856_100056308
521 Ga0068856_100466005
522 Ga0068856_100568954
523 Ga0068856_101434384
524 Ga0068856_101468637
525 Ga0068852_100002050
526 Ga0068852_100002251
527 Ga0068852_100014063
528 Ga0068852_100015243
529 Ga0068852_100200323
530 Ga0068852_100321415
531 Ga0068852_100450182
532 Ga0068852_100870838
533 Ga0068864_100052557
534 Ga0068863_100544868
535 Ga0068858_100023710
536 Ga0068860_100060777
537 Ga0068860_100207376
538 Ga0068860_101971064
539 Ga0068862_100005042
540 Ga0068862_100743201
541 Ga0070716_100772781
542 Ga0070712_102028139
543 Ga0068865_100098745
544 Ga0105240_10013759
545 Ga0105240_10214866
546 Ga0105245_12991289
547 Ga0105241_10077754
548 Ga0105241_10168154
549 Ga0105248_10000276
550 Ga0105248_10040529
551 Ga0105248_10048181
552 Ga0105237_11459487
553 Ga0105238_10034298
554 Ga0105238_10148872
555 Ga0105238_11317270
556 Ga0105238_12095054
557 Ga0105238_12377822
558 Ga0105249_10476786
559 Ga0105239_10559959
560 Ga0105239_11352700
561 Ga0105246_10392161
562 Ga0105246_11168098
563 Ga0157373_10007891
564 Ga0157373_10274165
565 Ga0157373_10428772
566 Ga0157373_10475017
567 Ga0157373_10705518
568 Ga0157371_10006963
569 Ga0157371_10034220
570 Ga0157371_10058976
571 Ga0157371_10154085
572 Ga0157371_10944386
573 Ga0157371_11321199
574 Ga0157371_11554784
575 Ga0157370_10020725
576 Ga0157370_10192665
577 Ga0157370_10214303
578 Ga0157370_10369034
579 Ga0157370_10815791
580 Ga0157370_11508725
581 Ga0157370_11625409
582 Ga0157369_10077904
583 Ga0157369_10236532
584 Ga0157369_10320237
585 Ga0157369_10346853
586 Ga0157369_10842473
587 Ga0157369_11304533
588 Ga0157369_11429158
589 Ga0157374_10007006
590 Ga0157378_11324827
591 Ga0157378_11807379
592 Ga0157378_11835396
593 Ga0163162_10031161
594 Ga0163162_10966387
595 Ga0157372_10100747
596 Ga0157372_10217309
597 Ga0157372_10347830
598 Ga0157372_10431082
599 Ga0157372_10593328
600 Ga0157372_10959213
601 Ga0157372_12026667
602 Ga0163163_10001248
603 Ga0157379_10078482
604 Ga0157376_11234513
605 Ga0163161_10086896
606 Ga0163161_10297508
607 Ga0207642_10161261
608 Ga0207680_10028950
609 Ga0207680_10592208
610 Ga0207705_10123198
611 Ga0207705_10185647
612 Ga0207705_10235937
613 Ga0207705_10486011
614 Ga0207705_10660276
615 Ga0207695_10119754
616 Ga0207695_10146117
617 Ga0207660_10000515
618 Ga0207660_10001062
619 Ga0207660_10004418
620 Ga0207660_10453676
621 Ga0207657_10046172
622 Ga0207657_10135254
623 Ga0207657_10194833
624 Ga0207657_11342522
625 Ga0207649_10121141
626 Ga0207649_10293616
627 Ga0207649_10361115
628 Ga0207652_10076931
629 Ga0207652_10268064
630 Ga0207681_10756015
631 Ga0207694_10383349
632 Ga0207694_10954473
633 Ga0207694_11726290
634 Ga0207664_10013360
635 Ga0207664_10163475
636 Ga0207664_10319311
637 Ga0207644_10124308
638 Ga0207690_10065934
639 Ga0207690_10084601
640 Ga0207690_10565500
641 Ga0207706_10004820
642 Ga0207669_10152890
643 Ga0207704_10043056
644 Ga0207691_10520686
645 Ga0207711_10135155
646 Ga0207711_10360660
647 Ga0207661_10123031
648 Ga0207661_10215114
649 Ga0207661_10258944
650 Ga0207667_10141230
651 Ga0207667_10173335
652 Ga0207667_10182114
653 Ga0207667_10434749
654 Ga0207651_10900522
655 Ga0207651_11311910
656 Ga0207668_10098976
657 Ga0207668_11244953
658 Ga0207640_10286204
659 Ga0207640_10906708
660 Ga0207640_11643104
661 Ga0207658_10055350
662 Ga0207658_10236558
663 Ga0207658_10331927
664 Ga0207658_11397846
665 Ga0207677_10352166
666 Ga0207639_10327669
667 Ga0207639_11046861
668 Ga0207702_10156815
669 Ga0207702_10197621
670 Ga0207702_10348001
671 Ga0207648_10551459
672 Ga0207683_10093274
673 Ga0207683_11435266
674 Ga0207698_10000986
675 Ga0207698_10001169
676 Ga0207698_10007388
677 Ga0207698_10130564
678 Ga0207698_10175750
679 Ga0207698_10483748
680 Ga0207698_10939002
681 Ga0207698_12026231
682 Ga0268266_10019318
683 Ga0268266_11026080
684 Ga0268265_10004462
685 Ga0268265_10447833
686 Ga0268264_10017800
687 Ga0268264_10553639
688 Ga0307515_10269935
689 Ga0373953_0167211
690 Ga0373954_0225952
691 Ga0373957_0098322
692 Ga0373955_0002452
693 Ga0373935_0213541
694 Ga0373933_0720137
695 Ga0373937_0001514
696 Ga0395899_0016732
697 Ga0395899_0028045
698 Ga0395899_0078045
699 Ga0395899_0082403
700 Ga0395899_0136735
701 Ga0395899_0192314
702 Ga0395899_0240863
703 Ga0395899_0356812
704 Ga0395899_0395566
705 Ga0395899_0580238
706 Ga0395899_0830668
707 Ga0395900_0027658
708 Ga0395900_0063046
709 Ga0395900_0119134
710 Ga0395900_0165384
711 Ga0395900_0180359
712 Ga0395900_0207813
713 Ga0395900_0251987
714 Ga0395900_0286711
715 Ga0395900_0541645
716 Ga0395900_0599309
717 Ga0395900_0631166
718 Ga0395900_0861181
719 Ga0395900_0949203
720 Ga0395900_1014451
721 Ga0395900_1104939
722 Ga0395900_1173944
723 Ga0395900_1503222
724 Ga0395900_1566701
725 Ga0395900_1598785
726 Ga0395898_0063085
727 Ga0395898_0170353
728 Ga0395898_0178947
729 Ga0395898_0188201
730 Ga0395898_0236532
731 Ga0395898_0240295
732 Ga0395898_0269600
733 Ga0395898_0321372
734 Ga0395898_0343487
735 Ga0395898_0412613
736 Ga0395898_0495150
737 Ga0395898_0527086
738 Ga0395898_0751250
739 Ga0395905_0020258
740 Ga0395905_0054494
741 Ga0395905_0079747
742 Ga0395905_0125108
743 Ga0395905_0250587
744 Ga0395905_0259802
745 Ga0395905_0389872
746 Ga0395905_0457495
747 Ga0395905_0504892
748 Ga0395905_0697405
749 Ga0395905_0902560
750 Ga0395905_1078217
751 Ga0395905_1208345
752 Ga0395905_1506481
753 Ga0395901_0018576
754 Ga0395901_0020133
755 Ga0395901_0102698
756 Ga0395901_0134585
757 Ga0395901_0153979
758 Ga0395901_0158559
759 Ga0395901_0199840
760 Ga0395901_0300121
761 Ga0395901_0359936
762 Ga0395901_0539549
763 Ga0395901_0698198
764 Ga0395901_0713291
765 Ga0395901_1009644
766 Ga0395901_1236403
767 Ga0395901_1335085
768 Ga0395901_1565049
769 Ga0451807_0571521
770 Ga0466969_0035747
771 Ga0466969_0041854
772 Ga0466965_0422507
773 Ga0466966_0016847
774 Ga0466966_0051018
775 Ga0466961_0196745
776 Ga0466961_0392714
777 Ga0466963_0003212
778 Ga0466963_0042133
779 Ga0466963_0060917
780 Ga0466963_0208446
781 Ga0466963_0258132
782 Ga0466963_0333151
783 Ga0466963_1075953
784 Ga0466971_0136071
785 Ga0466971_0139918
786 Ga0466968_0004855
787 Ga0466970_0015259
788 Ga0466957_0129410
789 Ga0466957_0621748
790 Ga0466957_0626450
791 Ga0466960_0257972
792 Ga0466960_0570094
793 Ga0466959_0456934
794 Ga0466958_0020162
795 Ga0466958_0214172
796 Ga0466958_0340520
797 Ga0466958_0513306
798 Ga0466967_0025320
799 Ga0466967_0085879
800 Ga0466967_0086675
801 Ga0466967_0128577
802 Ga0466967_1069502
803 Ga0466967_1099937
804 Ga0495582_0282761
805 Ga0495642_0260845
806 Ga0495642_0358846
807 Ga0495621_0140959
808 Ga0495668_0785623
809 Ga0495669_0020214
810 Ga0495669_0039061
811 Ga0495669_0076719
812 Ga0495669_0165080
813 Ga0495677_0173769
814 Ga0495602_0041409
815 Ga0496100_1033112
816 Ga0496100_1229888
817 Ga0496101_1114926
818 Ga0496106_0375402
819 Ga0496107_0024175
820 Ga0496107_0199602
821 Ga0496108_0262097
822 Ga0496109_0039480
823 Ga0496110_0460040
824 Ga0496112_0019602
825 Ga0496112_0870510
826 Ga0496113_0261240
827 Ga0496113_1259645
828 Ga0501047_0372054
829 Ga0501070_0138285
830 Ga0501071_0203135
831 Ga0501073_0296868
832 Ga0501074_0038808
833 Ga0501074_0665837
834 Ga0501080_0135940
835 Ga0501080_0674181
836 nmdc:mga07m45_230532_c1
837 Ga0466962_0075659
838 Ga0466962_0537449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map